F392022

General Info

Members Datasets Scaffolds Average Seq Length
294 262 123 303

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10027797|Ga0099794_100277972
Length 310
Sequence MTMKGLAMRSPAQRSAAFRFPAHSIAGRAGTSLKHEHLQAILADEKRDRFFEVHAENYMGAGGPPHAALNRIRHDYPVSLHGVCMSIGGPQPLDETHLGRFKALVDRYEPALVSEHLAWSTHGTTYFNDLLPLPYTAETLARVADHIDQVQETLGRQLLLENPSTYLFFPASTMSETLFIAELVRRTGCGLLLDINNVFVSATNHGFAALTYLADFPLEHVGEIHLAGHIEQADDEGELLLIDSHDRPVTDAVWKLFDTVIGQCGPIPTLVEWDSDLPDWPLLKAEADAAQAIIDRHAHGFMTGRAHAAR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2516143018 Ensifer sp. BR816 Isolate Nodule
12 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
13 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
14 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
15 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
16 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
17 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
18 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
19 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
20 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
21 2643221557 Ensifer sp. Root558 Isolate Unclassified
22 2643221610 Ensifer sp. Root74 Isolate Unclassified
23 2643221668 Ensifer sp. Root423 Isolate Unclassified
24 2643221675 Ensifer sp. Root1298 Isolate Unclassified
25 2643221680 Ensifer sp. Root1312 Isolate Unclassified
26 2643221723 Ensifer sp. Root278 Isolate Unclassified
27 2643221726 Ensifer sp. Root954 Isolate Unclassified
28 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
29 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
30 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
31 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
32 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
33 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
34 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
35 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
36 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
37 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
38 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
39 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
40 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
41 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
42 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
43 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
44 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
45 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
46 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
47 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
48 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
49 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
50 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
51 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
52 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
53 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
54 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
55 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
56 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
57 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
58 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
59 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
60 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
61 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
62 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
63 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
64 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
65 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
66 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
67 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
68 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
69 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
70 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
71 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
72 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
73 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
74 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
75 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
76 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
77 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
78 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
79 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
80 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
81 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
82 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
83 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
84 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
85 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
86 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
87 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
88 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
89 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
90 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
91 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
92 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
93 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
94 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
95 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
96 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
97 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
98 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
99 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
100 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
101 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
102 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
103 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
104 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
105 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
106 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
107 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
108 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
109 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
110 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
111 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
112 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
113 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
114 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
115 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
116 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
117 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
118 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
119 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
120 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
121 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
122 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
123 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
124 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
125 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
126 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
127 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
128 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
129 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
130 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
131 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
132 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
133 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
134 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
135 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
136 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
137 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
138 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
139 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
140 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
141 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
142 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
143 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
144 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
145 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
146 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
147 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
148 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
149 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
150 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
151 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
152 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
153 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
154 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
155 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
156 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
157 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
158 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
159 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
160 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
161 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
162 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
163 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
164 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
165 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
166 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
169 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
170 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
171 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
172 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
173 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
174 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
175 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
176 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
177 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
178 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
179 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
180 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
181 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
182 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
183 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
184 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
185 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
186 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
187 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
188 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
189 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
190 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
191 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
192 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
193 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
194 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
195 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
196 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
197 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
198 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
199 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
200 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
201 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
202 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
203 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
204 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
205 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
206 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
207 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
211 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
213 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
215 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
259 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
260 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
261 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
262 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.84
Metatranscriptomes 0
Isolates 58.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.18
Nodule 50.34
Rhizoplane 6.12
Rhizosphere 25.51
Stem 0
Stem Tuber 0
Unclassified 8.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000055 3300002987 Bacteria 56500
2 JGI25160J50197_1000073 3300003354 Bacteria 104247
3 JGI25161J50226_1000221 3300003374 Bacteria 35290
4 JGI25161J50226_1000248 3300003374 Bacteria 32273
5 Ga0055526_1008039 3300003771 Bacteria 5332
6 Ga0055524_1001705 3300003775 Bacteria 12241
7 Ga0055531_10012573 3300003794 Bacteria 3971
8 Ga0055543_1000143 3300004625 Bacteria 59615
9 Ga0055543_1000722 3300004625 Bacteria 16763
10 Ga0065165_1000198 3300005262 Bacteria 104285
11 Ga0065165_1000983 3300005262 Bacteria 35328
12 Ga0070683_100421518 3300005329 Bacteria 1273
13 Ga0070689_100114738 3300005340 Bacteria 2146
14 Ga0070709_10000309 3300005434 Bacteria 30970
15 Ga0070709_10020857 3300005434 Bacteria 3811
16 Ga0070714_100262720 3300005435 Bacteria 1599
17 Ga0070713_100037011 3300005436 Bacteria 3943
18 Ga0070710_10004223 3300005437 Bacteria 6808
19 Ga0070701_10218469 3300005438 Bacteria 1135
20 Ga0070711_100010653 3300005439 Bacteria 5696
21 Ga0070711_100081423 3300005439 Bacteria 2307
22 Ga0070711_100124048 3300005439 Bacteria 1915
23 Ga0070706_100136982 3300005467 Bacteria 2285
24 Ga0070707_100520966 3300005468 Bacteria 1151
25 Ga0070698_100031109 3300005471 Bacteria 5533
26 Ga0070698_100036706 3300005471 Bacteria 5059
27 Ga0068856_100128890 3300005614 Bacteria 2534
28 Ga0068859_100076918 3300005617 Bacteria 3378
29 Ga0081455_10037019 3300005937 Bacteria 4337
30 Ga0081455_10045970 3300005937 Bacteria 3794
31 Ga0081538_10016822 3300005981 Bacteria 5584
32 Ga0070717_10240528 3300006028 Bacteria 1596
33 Ga0070715_10032299 3300006163 Bacteria 2132
34 Ga0070716_100007109 3300006173 Bacteria 5497
35 Ga0070712_100009861 3300006175 Bacteria 6020
36 Ga0070712_100029016 3300006175 Bacteria 3707
37 Ga0070712_100045150 3300006175 Bacteria 3041
38 Ga0097620_100076920 3300006931 Bacteria 3378
39 Ga0099794_10027797 3300007265 Bacteria 2625
40 Ga0099795_10001608 3300007788 Bacteria 4985
41 Ga0099795_10020420 3300007788 Bacteria 2158
42 Ga0099795_10020791 3300007788 Bacteria 2143
43 Ga0099795_10023092 3300007788 Bacteria 2060
44 Ga0105247_10042412 3300009101 Bacteria 2787
45 Ga0099796_10005972 3300010159 Bacteria 3083
46 Ga0099796_10017214 3300010159 Bacteria 2148
47 Ga0099796_10048563 3300010159 Bacteria 1464
48 Ga0105246_10092750 3300011119 Bacteria 2180
49 Ga0171463_1002 3300013249 Bacteria 1274851
50 Ga0157374_10320974 3300013296 Bacteria 1535
51 Ga0157379_10084707 3300014968 Bacteria 2840
52 Ga0183363_1101 3300015690 Bacteria 24246
53 Ga0214542_1000012 3300021321 Bacteria 235800
54 Ga0214543_1000024 3300021327 Bacteria 235745
55 Ga0214543_1000038 3300021327 Bacteria 182106
56 Ga0213876_10002812 3300021384 Bacteria 10133
57 Ga0209436_100673 3300025208 Bacteria 14548
58 Ga0209673_1021693 3300025273 Bacteria 2238
59 Ga0209130_1000153 3300025284 Bacteria 104299
60 Ga0209130_1000563 3300025284 Bacteria 36702
61 Ga0209676_1001074 3300025292 Bacteria 30947
62 Ga0209676_1017594 3300025292 Bacteria 2524
63 Ga0209025_1000333 3300025294 Bacteria 104266
64 Ga0209564_1000280 3300025295 Bacteria 104429
65 Ga0209758_1006305 3300025297 Bacteria 8616
66 Ga0209256_1000064 3300025299 Bacteria 250853
67 Ga0209256_1001404 3300025299 Bacteria 25040
68 Ga0207426_1000272 3300025302 Bacteria 107804
69 Ga0207426_1000280 3300025302 Bacteria 104299
70 Ga0209257_1002371 3300025304 Bacteria 18884
71 Ga0209257_1011178 3300025304 Bacteria 4371
72 Ga0207692_10036819 3300025898 Bacteria 2389
73 Ga0207692_10265379 3300025898 Bacteria 1034
74 Ga0207710_10140593 3300025900 Bacteria 1165
75 Ga0207685_10014666 3300025905 Bacteria 2459
76 Ga0207699_10001376 3300025906 Bacteria 11583
77 Ga0207699_10084143 3300025906 Bacteria 1981
78 Ga0207684_10114420 3300025910 Bacteria 2310
79 Ga0207693_10081498 3300025915 Bacteria 2533
80 Ga0207693_10201882 3300025915 Bacteria 1563
81 Ga0207663_10060028 3300025916 Bacteria 2408
82 Ga0207663_10074772 3300025916 Bacteria 2197
83 Ga0207700_10031909 3300025928 Bacteria 3749
84 Ga0207664_10139106 3300025929 Bacteria 2052
85 Ga0207665_10002793 3300025939 Bacteria 11701
86 Ga0207665_10092455 3300025939 Bacteria 2098
87 Ga0207661_10398910 3300025944 Bacteria 1247
88 Ga0207676_10122598 3300026095 Bacteria 2195
89 Ga0209281_1004979 3300027111 Bacteria 3805
90 Ga0209179_1000415 3300027512 Bacteria 4252
91 Ga0209588_1000218 3300027671 Bacteria 15364
92 Ga0307408_100296382 3300031548 Bacteria 1353
93 Ga0307409_100532997 3300031995 Bacteria 1149
94 Ga0307414_10072502 3300032004 Bacteria 2488
95 Ga0436365_0160289 3300039437 Bacteria 39593
96 Ga0436360_0979897 3300039438 Bacteria 910
97 Ga0436361_0245690 3300039447 Bacteria 5661
98 Ga0436363_0132925 3300039450 Bacteria 2619
99 Ga0436363_1219520 3300039450 Bacteria 2220
100 Ga0439466_0039263 3300041411 Bacteria 1588
101 Ga0439465_0024605 3300041413 Bacteria 1898
102 Ga0495639_0026659 3300046475 Bacteria 2556
103 Ga0495664_0094441 3300046477 Bacteria 1800
104 Ga0495664_0397279 3300046477 Bacteria 828
105 Ga0496100_0053103 3300048903 Bacteria 2638
106 Ga0496101_0048177 3300048904 Bacteria 3062
107 Ga0496104_0009152 3300048907 Bacteria 8806
108 Ga0496104_0012980 3300048907 Bacteria 7500
109 Ga0496105_0010297 3300048908 Bacteria 7350
110 Ga0496106_0024365 3300048909 Bacteria 4499
111 Ga0496107_0030034 3300048910 Bacteria 3872
112 Ga0496108_0051828 3300048911 Bacteria 3438
113 Ga0496108_0211524 3300048911 Bacteria 1683
114 Ga0496110_0014579 3300048913 Bacteria 6530
115 Ga0496111_0154129 3300048914 Bacteria 1705
116 Ga0496112_0006351 3300048915 Bacteria 10372
117 Ga0496113_0019439 3300048916 Bacteria 4752
118 Ga0496114_0151896 3300048917 Bacteria 2009
119 Ga0496115_0129958 3300048918 Bacteria 2076
120 Ga0496115_0134215 3300048918 Bacteria 2041
121 Ga0501076_0144761 3300049592 Bacteria 1932
122 Ga0500642_0000210 3300053130 Bacteria 23755
123 Ga0501084_0210560 3300054114 Bacteria 1640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0979897 Ga0436360_0979897_117_866 249
2 3300048911 Ga0496108_0211524 Ga0496108_0211524_911_1666 251
3 3300003775 Ga0055524_1001705 Ga0055524_10017058 252
4 3300025299 Ga0209256_1000064 Ga0209256_100006491 252
5 3300046477 Ga0495664_0397279 Ga0495664_0397279_50_808 252
6 iso_pu_bacteria 2597489875 2597814979 254
7 iso_pu_bacteria 2960652885 2960656356 256
8 3300048917 Ga0496114_0151896 Ga0496114_0151896_783_1556 257
9 iso_pu_bacteria 2906660503 2906663025 258
10 3300039447 Ga0436361_0245690 Ga0436361_0245690_919_1779 286
11 3300009101 Ga0105247_10042412 Ga0105247_100424123 287
12 3300011119 Ga0105246_10092750 Ga0105246_100927503 287
13 3300013296 Ga0157374_10320974 Ga0157374_103209742 287
14 3300014968 Ga0157379_10084707 Ga0157379_100847073 287
15 3300039450 Ga0436363_1219520 Ga0436363_1219520_1054_1917 287
16 3300048904 Ga0496101_0048177 Ga0496101_0048177_102_965 287
17 3300048907 Ga0496104_0009152 Ga0496104_0009152_900_1763 287
18 3300048908 Ga0496105_0010297 Ga0496105_0010297_1057_1920 287
19 3300048909 Ga0496106_0024365 Ga0496106_0024365_2802_3665 287
20 3300048910 Ga0496107_0030034 Ga0496107_0030034_1893_2756 287
21 3300048911 Ga0496108_0051828 Ga0496108_0051828_2199_3062 287
22 3300048913 Ga0496110_0014579 Ga0496110_0014579_5019_5882 287
23 3300048915 Ga0496112_0006351 Ga0496112_0006351_5155_6018 287
24 3300048916 Ga0496113_0019439 Ga0496113_0019439_1943_2806 287
25 3300048918 Ga0496115_0134215 Ga0496115_0134215_431_1294 287
26 3300053130 Ga0500642_0000210 Ga0500642_0000210_5065_5946 293
27 3300005937 Ga0081455_10045970 Ga0081455_100459705 297
28 iso_pu_bacteria 2889790730 2889792554 299
29 iso_pu_bacteria 2889914905 2889919106 299
30 iso_pu_bacteria 2854916844 2854918604 301
31 iso_pu_bacteria 2885312484 2885316430 301
32 3300032004 Ga0307414_10072502 Ga0307414_100725022 302
33 iso_pu_bacteria 2508501127 2509141438 302
34 iso_pu_bacteria 2508501128 2509152255 302
35 iso_pu_bacteria 2856342000 2856346854 302
36 iso_pu_bacteria 2924754689 2924756809 302
37 iso_pu_bacteria 2970524798 2970529741 302
38 iso_pu_bacteria 2970540015 2970541863 302
39 iso_pu_bacteria 8004395343 8004403994 302
40 3300003374 JGI25161J50226_1000221 JGI25161J50226_100022114 303
41 3300004625 Ga0055543_1000722 Ga0055543_100072214 303
42 3300005262 Ga0065165_1000983 Ga0065165_100098314 303
43 3300005439 Ga0070711_100124048 Ga0070711_1001240482 303
44 3300006175 Ga0070712_100029016 Ga0070712_1000290162 303
45 3300025284 Ga0209130_1000563 Ga0209130_100056314 303
46 3300025302 Ga0207426_1000272 Ga0207426_100027230 303
47 3300025898 Ga0207692_10265379 Ga0207692_102653791 303
48 iso_pu_bacteria 2513237144 2513909407 303
49 iso_pu_bacteria 2516143018 2516204052 303
50 iso_pu_bacteria 2657244999 2657681429 303
51 iso_pu_bacteria 2751185821 2753459046 303
52 iso_pu_bacteria 2791355091 2792619281 303
53 iso_pu_bacteria 2791355092 2792627054 303
54 iso_pu_bacteria 2802429268 2804752623 303
55 iso_pu_bacteria 2841734538 2841741090 303
56 iso_pu_bacteria 2871474448 2871478476 303
57 iso_pu_bacteria 2937822353 2937829328 303
58 iso_pu_bacteria 2941499720 2941506223 303
59 iso_pu_bacteria 2508501122 2509111351 304
60 iso_pu_bacteria 2509276019 2509376370 304
61 iso_pu_bacteria 2510065057 2510306134 304
62 iso_pu_bacteria 2512047086 2512530292 304
63 iso_pu_bacteria 2513237091 2513615023 304
64 iso_pu_bacteria 2513237140 2513884085 304
65 iso_pu_bacteria 2513237143 2513901521 304
66 iso_pu_bacteria 2516653046 2516895918 304
67 iso_pu_bacteria 2524023207 2524449084 304
68 iso_pu_bacteria 2551306085 2551687984 304
69 iso_pu_bacteria 2551306089 2551709815 304
70 iso_pu_bacteria 2551306090 2551724051 304
71 iso_pu_bacteria 2551306091 2551728950 304
72 iso_pu_bacteria 2558860100 2558867806 304
73 iso_pu_bacteria 2599185352 2600197285 304
74 iso_pu_bacteria 2643221557 2643804932 304
75 iso_pu_bacteria 2643221610 2644065776 304
76 iso_pu_bacteria 2643221668 2644376883 304
77 iso_pu_bacteria 2643221675 2644417668 304
78 iso_pu_bacteria 2643221680 2644453772 304
79 iso_pu_bacteria 2643221723 2644677702 304
80 iso_pu_bacteria 2643221726 2644688407 304
81 iso_pu_bacteria 2767802442 2770197993 304
82 iso_pu_bacteria 2775506902 2776267279 304
83 iso_pu_bacteria 2775506904 2776280197 304
84 iso_pu_bacteria 2791355082 2792580586 304
85 iso_pu_bacteria 2838074704 2838076971 304
86 iso_pu_bacteria 2848992105 2848998504 304
87 iso_pu_bacteria 2850079185 2850081339 304
88 iso_pu_bacteria 2858800743 2858806163 304
89 iso_pu_bacteria 2896384573 2896388066 304
90 iso_pu_bacteria 2913295892 2913299421 304
91 iso_pu_bacteria 2915993759 2915999786 304
92 iso_pu_bacteria 2916014648 2916014874 304
93 iso_pu_bacteria 2916021584 2916024420 304
94 iso_pu_bacteria 2916028427 2916028624 304
95 iso_pu_bacteria 2916048683 2916048698 304
96 iso_pu_bacteria 2916055098 2916059961 304
97 iso_pu_bacteria 2916068649 2916071461 304
98 iso_pu_bacteria 2916076590 2916078544 304
99 iso_pu_bacteria 2920760137 2920761710 304
100 iso_pu_bacteria 2920822456 2920826848 304
101 iso_pu_bacteria 2921208531 2921211844 304
102 iso_pu_bacteria 2921237296 2921243555 304
103 iso_pu_bacteria 2921244191 2921249128 304
104 iso_pu_bacteria 2921263974 2921267996 304
105 iso_pu_bacteria 2921282425 2921283988 304
106 iso_pu_bacteria 2924144063 2924150349 304
107 iso_pu_bacteria 2924150972 2924151752 304
108 iso_pu_bacteria 2924172951 2924175137 304
109 iso_pu_bacteria 2924179722 2924181328 304
110 iso_pu_bacteria 2924186466 2924187133 304
111 iso_pu_bacteria 2924193448 2924194800 304
112 iso_pu_bacteria 2924200457 2924200463 304
113 iso_pu_bacteria 2924207177 2924211997 304
114 iso_pu_bacteria 2924214083 2924219703 304
115 iso_pu_bacteria 2924221636 2924227766 304
116 iso_pu_bacteria 2937002841 2937002913 304
117 iso_pu_bacteria 2937009748 2937009766 304
118 iso_pu_bacteria 2937016420 2937022197 304
119 iso_pu_bacteria 2937042894 2937043262 304
120 iso_pu_bacteria 2937063883 2937067213 304
121 iso_pu_bacteria 2937071275 2937077943 304
122 iso_pu_bacteria 2937091812 2937095390 304
123 iso_pu_bacteria 2937113482 2937115339 304
124 iso_pu_bacteria 2937119839 2937121064 304
125 iso_pu_bacteria 2937126314 2937128308 304
126 iso_pu_bacteria 2937836603 2937840465 304
127 iso_pu_bacteria 2957382221 2957386204 304
128 iso_pu_bacteria 2957402308 2957406579 304
129 iso_pu_bacteria 2957408893 2957414352 304
130 iso_pu_bacteria 2957415311 2957419698 304
131 iso_pu_bacteria 2957422303 2957425885 304
132 iso_pu_bacteria 2957450854 2957457546 304
133 iso_pu_bacteria 2957457609 2957458516 304
134 iso_pu_bacteria 2957464669 2957470429 304
135 iso_pu_bacteria 2957471148 2957473269 304
136 iso_pu_bacteria 2957478035 2957483199 304
137 iso_pu_bacteria 2957491536 2957494744 304
138 iso_pu_bacteria 2958071322 2958071411 304
139 iso_pu_bacteria 2960584000 2960587797 304
140 iso_pu_bacteria 2960597568 2960600285 304
141 iso_pu_bacteria 2960610863 2960612055 304
142 iso_pu_bacteria 2960624210 2960624293 304
143 iso_pu_bacteria 2960645483 2960649509 304
144 iso_pu_bacteria 2960667422 2960667433 304
145 iso_pu_bacteria 2964621998 2964628790 304
146 iso_pu_bacteria 2964636051 2964640776 304
147 iso_pu_bacteria 2964643177 2964643510 304
148 iso_pu_bacteria 2964656573 2964658087 304
149 iso_pu_bacteria 2964663802 2964664142 304
150 iso_pu_bacteria 2964670856 2964677046 304
151 iso_pu_bacteria 2964678106 2964680945 304
152 iso_pu_bacteria 2964685014 2964691829 304
153 iso_pu_bacteria 2964691889 2964698376 304
154 iso_pu_bacteria 2964705432 2964707679 304
155 iso_pu_bacteria 2964712639 2964715794 304
156 iso_pu_bacteria 2967671571 2967673387 304
157 iso_pu_bacteria 2967699805 2967701576 304
158 iso_pu_bacteria 2967714385 2967718352 304
159 iso_pu_bacteria 2967735183 2967738744 304
160 iso_pu_bacteria 2967742019 2967742504 304
161 iso_pu_bacteria 2967748971 2967754638 304
162 iso_pu_bacteria 2967769361 2967774075 304
163 iso_pu_bacteria 2967775926 2967780856 304
164 iso_pu_bacteria 2970033650 2970037748 304
165 iso_pu_bacteria 2970061556 2970064801 304
166 iso_pu_bacteria 2970068827 2970075762 304
167 iso_pu_bacteria 2970076120 2970079665 304
168 iso_pu_bacteria 2970082768 2970084130 304
169 iso_pu_bacteria 2970088815 2970093384 304
170 iso_pu_bacteria 2970109326 2970110349 304
171 iso_pu_bacteria 2970164137 2970164909 304
172 iso_pu_bacteria 2970170962 2970171325 304
173 iso_pu_bacteria 2970177841 2970181549 304
174 iso_pu_bacteria 2977516862 2977519622 304
175 iso_pu_bacteria 2977558990 2977559190 304
176 iso_pu_bacteria 648276728 648735386 304
177 iso_pu_bacteria 8003992118 8003996896 304
178 iso_pu_bacteria 8004633249 8004633338 304
179 iso_pu_bacteria 8049293176 8049295218 304
180 3300025297 Ga0209758_1006305 Ga0209758_10063054 305
181 3300046477 Ga0495664_0094441 Ga0495664_0094441_527_1444 305
182 3300005329 Ga0070683_100421518 Ga0070683_1004215181 306
183 3300005340 Ga0070689_100114738 Ga0070689_1001147382 306
184 3300005434 Ga0070709_10000309 Ga0070709_1000030924 306
185 3300005436 Ga0070713_100037011 Ga0070713_1000370113 306
186 3300005438 Ga0070701_10218469 Ga0070701_102184692 306
187 3300005439 Ga0070711_100010653 Ga0070711_1000106535 306
188 3300005614 Ga0068856_100128890 Ga0068856_1001288903 306
189 3300005617 Ga0068859_100076918 Ga0068859_1000769185 306
190 3300006028 Ga0070717_10240528 Ga0070717_102405282 306
191 3300006173 Ga0070716_100007109 Ga0070716_1000071095 306
192 3300006175 Ga0070712_100009861 Ga0070712_1000098615 306
193 3300006931 Ga0097620_100076920 Ga0097620_1000769205 306
194 3300021384 Ga0213876_10002812 Ga0213876_100028123 306
195 3300025900 Ga0207710_10140593 Ga0207710_101405931 306
196 3300025906 Ga0207699_10001376 Ga0207699_100013761 306
197 3300025916 Ga0207663_10074772 Ga0207663_100747722 306
198 3300025928 Ga0207700_10031909 Ga0207700_100319093 306
199 3300025939 Ga0207665_10002793 Ga0207665_100027938 306
200 3300025944 Ga0207661_10398910 Ga0207661_103989101 306
201 3300026095 Ga0207676_10122598 Ga0207676_101225983 306
202 3300039437 Ga0436365_0160289 Ga0436365_0160289_32392_33312 306
203 3300048903 Ga0496100_0053103 Ga0496100_0053103_642_1562 306
204 3300048907 Ga0496104_0012980 Ga0496104_0012980_3800_4720 306
205 3300048914 Ga0496111_0154129 Ga0496111_0154129_281_1201 306
206 3300048918 Ga0496115_0129958 Ga0496115_0129958_359_1279 306
207 3300005467 Ga0070706_100136982 Ga0070706_1001369823 307
208 3300005468 Ga0070707_100520966 Ga0070707_1005209662 307
209 3300005471 Ga0070698_100031109 Ga0070698_1000311097 307
210 3300005471 Ga0070698_100036706 Ga0070698_1000367063 307
211 3300007788 Ga0099795_10020420 Ga0099795_100204202 307
212 3300007788 Ga0099795_10023092 Ga0099795_100230922 307
213 3300025910 Ga0207684_10114420 Ga0207684_101144202 307
214 3300031548 Ga0307408_100296382 Ga0307408_1002963822 307
215 3300031995 Ga0307409_100532997 Ga0307409_1005329971 307
216 3300039450 Ga0436363_0132925 Ga0436363_0132925_468_1391 307
217 3300041413 Ga0439465_0024605 Ga0439465_0024605_726_1652 307
218 3300046475 Ga0495639_0026659 Ga0495639_0026659_1116_2039 307
219 3300002987 JGI25159J45721_1000055 JGI25159J45721_100005528 308
220 3300003354 JGI25160J50197_1000073 JGI25160J50197_100007373 308
221 3300003374 JGI25161J50226_1000248 JGI25161J50226_100024810 308
222 3300003771 Ga0055526_1008039 Ga0055526_10080397 308
223 3300003794 Ga0055531_10012573 Ga0055531_100125732 308
224 3300004625 Ga0055543_1000143 Ga0055543_100014329 308
225 3300005262 Ga0065165_1000198 Ga0065165_100019873 308
226 3300005434 Ga0070709_10020857 Ga0070709_100208572 308
227 3300005435 Ga0070714_100262720 Ga0070714_1002627202 308
228 3300005437 Ga0070710_10004223 Ga0070710_100042239 308
229 3300005439 Ga0070711_100081423 Ga0070711_1000814233 308
230 3300005937 Ga0081455_10037019 Ga0081455_100370194 308
231 3300005981 Ga0081538_10016822 Ga0081538_100168225 308
232 3300006163 Ga0070715_10032299 Ga0070715_100322993 308
233 3300006175 Ga0070712_100045150 Ga0070712_1000451503 308
234 3300007265 Ga0099794_10027797 Ga0099794_100277972 308
235 3300007788 Ga0099795_10001608 Ga0099795_100016084 308
236 3300007788 Ga0099795_10020791 Ga0099795_100207912 308
237 3300010159 Ga0099796_10005972 Ga0099796_100059723 308
238 3300010159 Ga0099796_10017214 Ga0099796_100172143 308
239 3300010159 Ga0099796_10048563 Ga0099796_100485632 308
240 3300013249 Ga0171463_1002 Ga0171463_100278 308
241 3300015690 Ga0183363_1101 Ga0183363_11016 308
242 3300021321 Ga0214542_1000012 Ga0214542_1000012185 308
243 3300021327 Ga0214543_1000024 Ga0214543_1000024186 308
244 3300021327 Ga0214543_1000038 Ga0214543_1000038168 308
245 3300025208 Ga0209436_100673 Ga0209436_1006736 308
246 3300025273 Ga0209673_1021693 Ga0209673_10216932 308
247 3300025284 Ga0209130_1000153 Ga0209130_100015372 308
248 3300025292 Ga0209676_1001074 Ga0209676_100107428 308
249 3300025292 Ga0209676_1017594 Ga0209676_10175943 308
250 3300025294 Ga0209025_1000333 Ga0209025_100033372 308
251 3300025295 Ga0209564_1000280 Ga0209564_100028072 308
252 3300025299 Ga0209256_1001404 Ga0209256_100140417 308
253 3300025302 Ga0207426_1000280 Ga0207426_100028072 308
254 3300025304 Ga0209257_1002371 Ga0209257_10023712 308
255 3300025304 Ga0209257_1011178 Ga0209257_10111785 308
256 3300025898 Ga0207692_10036819 Ga0207692_100368192 308
257 3300025905 Ga0207685_10014666 Ga0207685_100146661 308
258 3300025906 Ga0207699_10084143 Ga0207699_100841432 308
259 3300025915 Ga0207693_10081498 Ga0207693_100814983 308
260 3300025915 Ga0207693_10201882 Ga0207693_102018822 308
261 3300025916 Ga0207663_10060028 Ga0207663_100600283 308
262 3300025929 Ga0207664_10139106 Ga0207664_101391062 308
263 3300025939 Ga0207665_10092455 Ga0207665_100924552 308
264 3300027111 Ga0209281_1004979 Ga0209281_10049794 308
265 3300027512 Ga0209179_1000415 Ga0209179_10004155 308
266 3300027671 Ga0209588_1000218 Ga0209588_10002188 308
267 3300041411 Ga0439466_0039263 Ga0439466_0039263_185_1111 308
268 3300049592 Ga0501076_0144761 Ga0501076_0144761_216_1142 308
269 3300054114 Ga0501084_0210560 Ga0501084_0210560_683_1609 308
270 iso_pu_bacteria 2915986958 2915990140 308
271 iso_pu_bacteria 2915993759 2915994581 308
272 iso_pu_bacteria 2916000859 2916005561 308
273 iso_pu_bacteria 2916007675 2916014402 308
274 iso_pu_bacteria 2921201388 2921207291 308
275 iso_pu_bacteria 2924158325 2924163726 308
276 iso_pu_bacteria 2924165586 2924171293 308
277 iso_pu_bacteria 2924228884 2924233479 308
278 iso_pu_bacteria 2937098957 2937101580 308
279 iso_pu_bacteria 2937106411 2937107112 308
280 iso_pu_bacteria 2957498199 2957504417 308
281 iso_pu_bacteria 2960637947 2960638057 308
282 iso_pu_bacteria 2960674078 2960675248 308
283 iso_pu_bacteria 2964698721 2964698778 308
284 iso_pu_bacteria 2964719344 2964726116 308
285 iso_pu_bacteria 2967664464 2967669004 308
286 iso_pu_bacteria 2967678726 2967684036 308
287 iso_pu_bacteria 2970019648 2970022580 308
288 iso_pu_bacteria 2970047711 2970052944 308
289 iso_pu_bacteria 2970054988 2970058990 308
290 iso_pu_bacteria 2970095765 2970099248 308
291 iso_pu_bacteria 2970184632 2970186553 308
292 iso_pu_bacteria 2970191845 2970195471 308
293 iso_pu_bacteria 2977551784 2977554626 308
294 iso_pu_bacteria 2977565890 2977565932 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05114

DUF692

Protein of unknown function (DUF692)

28

295

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.9064 26 300
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.869 26 300
8hci-assembly1.cif.gz_D crystal structure of a holoenzyme fe-free tglhi for pseudomonas syringae peptidyl (s) 2-mercaptoglycine biosynthesis 0.8244 28 295
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.8192 26 291
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.805 26 291
ID Description Score Start End Superfamily
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9061 26 300 3.20.20.150
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8713 26 300 3.20.20.150
1yx1B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6694 50 231 3.20.20.150
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6591 26 292 3.20.20.150
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6522 26 292 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A0P0RI84-F1-model_v4 UPF0276 protein K788_0000499 0.9678 24 292
AF-A0A7W5YXK7-F1-model_v4 deleted 0.9663 25 296
AF-A0A7W6IQQ1-F1-model_v4 UPF0276 protein GGR20_003582 0.9644 22 297
AF-A0A6L3MLN3-F1-model_v4 DUF692 family protein 0.9637 124 265
AF-A0A2S8PUG3-F1-model_v4 deleted 0.9632 31 302

Feature Viewer

pLDDT pTM Quality
85.31 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map