F391960

General Info

Members Datasets Scaffolds Average Seq Length
294 181 294 209

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100180753|Ga0070698_1001807531
Length 219
Sequence MTQPIATCPNCGAKIIFRWSSSVQTVCEYCKSVLVRSDVDLKKVGQVADLPPDISPIQLNAEGNYRNKAFVVIGRILYQYDQGGWNEWHLMMNDGTSGWLSDAQEEYAISFAATGSTTGPTTSQKLPAESQVQIGQTYSWNDANYTVSVITQAHFRGVEGELPFQYWDKDDVAFADLRSSSRKFATLDYSDIEPVLYLGELVEFDDLKLKNLRQFEGWS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 1.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 2.72
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10238831 3300005290 Bacteria 990
2 Ga0065707_10047719 3300005295 Unclassified 859
3 Ga0070683_100699202 3300005329 Archaea 971
4 Ga0070690_100006879 3300005330 Bacteria 6471
5 Ga0068869_100486755 3300005334 Unclassified 1028
6 Ga0068869_100651749 3300005334 Unclassified 894
7 Ga0070666_10690328 3300005335 Bacteria 748
8 Ga0070682_100058708 3300005337 Unclassified 2427
9 Ga0068868_100266146 3300005338 Unclassified 1447
10 Ga0068868_100570137 3300005338 Unclassified 1000
11 Ga0070689_100182376 3300005340 Bacteria 1706
12 Ga0070689_100221244 3300005340 Bacteria 1553
13 Ga0070689_100239713 3300005340 Bacteria 1493
14 Ga0070687_100009503 3300005343 Unclassified 4170
15 Ga0070675_100000911 3300005354 Bacteria 21029
16 Ga0070671_100332602 3300005355 Bacteria 1295
17 Ga0070673_100096765 3300005364 Bacteria 2423
18 Ga0070667_100510069 3300005367 Unclassified 1103
19 Ga0070703_10009330 3300005406 Bacteria 2768
20 Ga0070709_10000507 3300005434 Bacteria 22990
21 Ga0070709_10015653 3300005434 Bacteria 4319
22 Ga0070709_10022241 3300005434 Bacteria 3706
23 Ga0070709_10254039 3300005434 Bacteria 1267
24 Ga0070709_10441748 3300005434 Unclassified 978
25 Ga0070714_100003412 3300005435 Bacteria 11838
26 Ga0070714_100034327 3300005435 Bacteria 4248
27 Ga0070714_100089449 3300005435 Archaea 2695
28 Ga0070714_100333523 3300005435 Bacteria 1421
29 Ga0070714_100522780 3300005435 Bacteria 1134
30 Ga0070713_100001370 3300005436 Bacteria 15591
31 Ga0070713_100026542 3300005436 Bacteria 4549
32 Ga0070713_100049435 3300005436 Bacteria 3469
33 Ga0070710_10026213 3300005437 Unclassified 3095
34 Ga0070710_10043366 3300005437 Unclassified 2491
35 Ga0070711_100006665 3300005439 Bacteria 6982
36 Ga0070711_100015030 3300005439 Bacteria 4892
37 Ga0070711_100060080 3300005439 Unclassified 2641
38 Ga0070711_100260426 3300005439 Bacteria 1364
39 Ga0070711_101038997 3300005439 Unclassified 704
40 Ga0070705_100003341 3300005440 Bacteria 7874
41 Ga0070708_100002244 3300005445 Bacteria 14935
42 Ga0070708_100267322 3300005445 Bacteria 1608
43 Ga0070681_10102560 3300005458 Unclassified 2806
44 Ga0068867_100015874 3300005459 Bacteria 5346
45 Ga0068867_100192282 3300005459 Unclassified 1629
46 Ga0068867_100281819 3300005459 Unclassified 1363
47 Ga0070685_10136875 3300005466 Unclassified 1537
48 Ga0070706_100001656 3300005467 Bacteria 23195
49 Ga0070698_100180753 3300005471 Bacteria 2048
50 Ga0070698_100869317 3300005471 Unclassified 847
51 Ga0070699_100015160 3300005518 Bacteria 6621
52 Ga0070679_100017595 3300005530 Bacteria 6918
53 Ga0070697_100001122 3300005536 Bacteria 20239
54 Ga0070686_100000751 3300005544 Bacteria 18805
55 Ga0070695_100023474 3300005545 Bacteria 3791
56 Ga0070695_100435987 3300005545 Unclassified 1001
57 Ga0070696_100049419 3300005546 Unclassified 2922
58 Ga0070693_100000295 3300005547 Bacteria 23286
59 Ga0070665_100001033 3300005548 Bacteria 34868
60 Ga0070665_100075831 3300005548 Bacteria 3370
61 Ga0070704_100558228 3300005549 Unclassified 1001
62 Ga0068854_100029588 3300005578 Unclassified 3793
63 Ga0068859_100174929 3300005617 Unclassified 2228
64 Ga0068864_100562120 3300005618 Unclassified 1104
65 Ga0068866_10080469 3300005718 Unclassified 1748
66 Ga0068866_10113267 3300005718 Unclassified 1517
67 Ga0068861_100230922 3300005719 Unclassified 1569
68 Ga0068870_10182636 3300005840 Bacteria 1260
69 Ga0068863_101168406 3300005841 Bacteria 775
70 Ga0068858_100035778 3300005842 Bacteria 4605
71 Ga0068858_100552330 3300005842 Bacteria 1115
72 Ga0068858_101131279 3300005842 Bacteria 769
73 Ga0068860_100160295 3300005843 Bacteria 2169
74 Ga0068860_100318611 3300005843 Unclassified 1526
75 Ga0068860_100922518 3300005843 Unclassified 890
76 Ga0068862_100530831 3300005844 Unclassified 1121
77 Ga0070717_10020526 3300006028 Bacteria 5198
78 Ga0070717_10173162 3300006028 Unclassified 1878
79 Ga0070717_10189194 3300006028 Unclassified 1798
80 Ga0070717_10312888 3300006028 Unclassified 1398
81 Ga0070717_10433884 3300006028 Bacteria 1183
82 Ga0070715_10000253 3300006163 Bacteria 12883
83 Ga0070716_100000178 3300006173 Bacteria 24984
84 Ga0070716_100000490 3300006173 Bacteria 16446
85 Ga0070716_100181803 3300006173 Bacteria 1381
86 Ga0070716_100246183 3300006173 Bacteria 1215
87 Ga0070716_100823862 3300006173 Unclassified 720
88 Ga0070712_100000621 3300006175 Bacteria 20835
89 Ga0070712_100018290 3300006175 Unclassified 4549
90 Ga0070712_100051574 3300006175 Bacteria 2866
91 Ga0070712_100787193 3300006175 Bacteria 815
92 Ga0097621_100082807 3300006237 Bacteria 2672
93 Ga0097621_100133639 3300006237 Bacteria 2114
94 Ga0075370_10229698 3300006353 Bacteria 1098
95 Ga0068871_100018976 3300006358 Bacteria 5241
96 Ga0068871_100079945 3300006358 Unclassified 2706
97 Ga0068871_100203710 3300006358 Unclassified 1709
98 Ga0075428_100166769 3300006844 Unclassified 2389
99 Ga0075434_100003219 3300006871 Bacteria 14566
100 Ga0075434_100341282 3300006871 Bacteria 1519
101 Ga0068865_100000950 3300006881 Bacteria 16491
102 Ga0068865_100054311 3300006881 Bacteria 2783
103 Ga0068865_100896915 3300006881 Unclassified 771
104 Ga0075436_100000734 3300006914 Bacteria 21719
105 Ga0097620_100174930 3300006931 Unclassified 2228
106 Ga0097620_100300950 3300006931 Unclassified 1697
107 Ga0075435_100001354 3300007076 Bacteria 15787
108 Ga0099794_10014819 3300007265 Bacteria 3426
109 Ga0099794_10042570 3300007265 Bacteria 2165
110 Ga0099794_10059690 3300007265 Unclassified 1851
111 Ga0099794_10101846 3300007265 Unclassified 1434
112 Ga0099795_10204156 3300007788 Unclassified 835
113 Ga0111539_10469078 3300009094 Bacteria 1466
114 Ga0105245_10038935 3300009098 Bacteria 4231
115 Ga0105245_10110458 3300009098 Bacteria 2556
116 Ga0105245_10169604 3300009098 Unclassified 2078
117 Ga0105245_10699808 3300009098 Bacteria 1046
118 Ga0105247_10062096 3300009101 Bacteria 2317
119 Ga0105247_10139550 3300009101 Unclassified 1587
120 Ga0105243_10113933 3300009148 Unclassified 2268
121 Ga0105243_10446333 3300009148 Unclassified 1212
122 Ga0105248_10057966 3300009177 Bacteria 4348
123 Ga0105248_10110681 3300009177 Bacteria 3097
124 Ga0105248_10212924 3300009177 Bacteria 2177
125 Ga0105238_10237904 3300009551 Unclassified 1798
126 Ga0105249_10093619 3300009553 Unclassified 2815
127 Ga0099796_10139788 3300010159 Unclassified 945
128 Ga0157370_10141168 3300013104 Bacteria 2244
129 Ga0157374_10060655 3300013296 Bacteria 3540
130 Ga0157378_10217051 3300013297 Unclassified 1817
131 Ga0163162_10149397 3300013306 Unclassified 2453
132 Ga0163162_10491637 3300013306 Bacteria 1358
133 Ga0163163_10054811 3300014325 Bacteria 3940
134 Ga0163163_10076742 3300014325 Unclassified 3337
135 Ga0157380_10449365 3300014326 Bacteria 1237
136 Ga0157377_10077607 3300014745 Bacteria 1934
137 Ga0157379_10152919 3300014968 Unclassified 2081
138 Ga0157379_10435265 3300014968 Unclassified 1209
139 Ga0157376_10001580 3300014969 Bacteria 15053
140 Ga0157376_10005086 3300014969 Bacteria 9165
141 Ga0157376_10320512 3300014969 Bacteria 1473
142 Ga0213876_10076586 3300021384 Unclassified 1767
143 Ga0207653_10001051 3300025885 Bacteria 9083
144 Ga0207692_10066303 3300025898 Unclassified 1887
145 Ga0207692_10069541 3300025898 Bacteria 1850
146 Ga0207680_10013983 3300025903 Unclassified 4138
147 Ga0207685_10004549 3300025905 Unclassified 3544
148 Ga0207699_10001122 3300025906 Bacteria 12669
149 Ga0207699_10022974 3300025906 Bacteria 3388
150 Ga0207699_10338738 3300025906 Bacteria 1059
151 Ga0207684_10048990 3300025910 Bacteria 3584
152 Ga0207684_10054909 3300025910 Bacteria 3380
153 Ga0207707_10083622 3300025912 Unclassified 2787
154 Ga0207693_10000087 3300025915 Bacteria 82834
155 Ga0207693_10006414 3300025915 Bacteria 9750
156 Ga0207693_10013894 3300025915 Bacteria 6484
157 Ga0207693_10220520 3300025915 Bacteria 1490
158 Ga0207663_10006322 3300025916 Bacteria 6050
159 Ga0207663_10109554 3300025916 Bacteria 1872
160 Ga0207663_10241761 3300025916 Bacteria 1324
161 Ga0207663_10853015 3300025916 Unclassified 727
162 Ga0207662_10700875 3300025918 Unclassified 710
163 Ga0207652_10013414 3300025921 Bacteria 6632
164 Ga0207646_10880166 3300025922 Unclassified 795
165 Ga0207659_10000077 3300025926 Bacteria 62077
166 Ga0207687_10005315 3300025927 Bacteria 8526
167 Ga0207687_10185883 3300025927 Unclassified 1613
168 Ga0207700_10004413 3300025928 Bacteria 8293
169 Ga0207700_10063319 3300025928 Bacteria 2812
170 Ga0207700_10079726 3300025928 Bacteria 2551
171 Ga0207700_10112818 3300025928 Unclassified 2190
172 Ga0207700_10236931 3300025928 Archaea 1554
173 Ga0207700_10457270 3300025928 Unclassified 1126
174 Ga0207664_10022657 3300025929 Bacteria 4694
175 Ga0207664_10429123 3300025929 Bacteria 1178
176 Ga0207644_10290713 3300025931 Bacteria 1314
177 Ga0207686_10003438 3300025934 Bacteria 8502
178 Ga0207704_10016888 3300025938 Bacteria 3766
179 Ga0207665_10000015 3300025939 Bacteria 133147
180 Ga0207665_10262818 3300025939 Bacteria 1279
181 Ga0207711_10082468 3300025941 Bacteria 2811
182 Ga0207711_10162301 3300025941 Bacteria 2024
183 Ga0207689_10027008 3300025942 Bacteria 4806
184 Ga0207679_10827817 3300025945 Unclassified 845
185 Ga0207712_10058035 3300025961 Unclassified 2733
186 Ga0207640_10005072 3300025981 Bacteria 7166
187 Ga0207703_10025580 3300026035 Bacteria 4643
188 Ga0207703_10509234 3300026035 Bacteria 1131
189 Ga0207648_10018576 3300026089 Bacteria 6292
190 Ga0207648_10043138 3300026089 Unclassified 3960
191 Ga0207648_10153845 3300026089 Bacteria 2030
192 Ga0207683_10291627 3300026121 Unclassified 1492
193 Ga0207698_10387508 3300026142 Unclassified 1331
194 Ga0209588_1113940 3300027671 Bacteria 868
195 Ga0209588_1129744 3300027671 Bacteria 805
196 Ga0265354_1000540 3300028016 Bacteria 6496
197 Ga0265354_1000550 3300028016 Bacteria 6420
198 Ga0268266_10003695 3300028379 Bacteria 15088
199 Ga0268266_10057830 3300028379 Bacteria 3337
200 Ga0268266_10182809 3300028379 Unclassified 1910
201 Ga0268265_10454766 3300028380 Unclassified 1197
202 Ga0268265_10544065 3300028380 Unclassified 1101
203 Ga0268264_10439563 3300028381 Bacteria 1262
204 Ga0268264_10890230 3300028381 Unclassified 893
205 Ga0265319_1086886 3300028563 Unclassified 989
206 Ga0265338_10022882 3300028800 Bacteria 6448
207 Ga0265770_1001520 3300030878 Unclassified 3184
208 Ga0265770_1004096 3300030878 Unclassified 1985
209 Ga0265765_1000615 3300030879 Unclassified 2927
210 Ga0265760_10008907 3300031090 Unclassified 2867
211 Ga0265760_10011009 3300031090 Bacteria 2584
212 Ga0265332_10011006 3300031238 Bacteria 4019
213 Ga0265328_10025244 3300031239 Bacteria 2240
214 Ga0265320_10000649 3300031240 Bacteria 26564
215 Ga0265325_10032770 3300031241 Bacteria 2772
216 Ga0265329_10015332 3300031242 Bacteria 2679
217 Ga0265340_10002670 3300031247 Bacteria 10139
218 Ga0265331_10002105 3300031250 Bacteria 13715
219 Ga0265316_10006389 3300031344 Bacteria 11264
220 Ga0265314_10003845 3300031711 Bacteria 14315
221 Ga0265342_10037108 3300031712 Bacteria 2973
222 Ga0265342_10338775 3300031712 Bacteria 785
223 Ga0316212_1002903 3300033547 Unclassified 2460
224 Ga0373948_0003910 3300034817 Unclassified 2326
225 Ga0373958_0001454 3300034819 Unclassified 3189
226 Ga0373938_0005922 3300034957 Bacteria 2094
227 Ga0373952_0002347 3300035092 Unclassified 3410
228 Ga0373923_0161209 3300035111 Unclassified 1023
229 Ga0373932_0000237 3300035112 Bacteria 16732
230 Ga0373939_0000699 3300035114 Bacteria 8316
231 Ga0373956_0129507 3300035119 Unclassified 1181
232 Ga0373956_0224167 3300035119 Bacteria 893
233 Ga0373943_0220924 3300035170 Bacteria 1055
234 Ga0373942_0000063 3300035207 Bacteria 22409
235 Ga0373961_0005045 3300035241 Unclassified 3175
236 Ga0373962_0000302 3300035242 Bacteria 10664
237 Ga0373931_0543020 3300035691 Unclassified 754
238 Ga0373937_0066395 3300036401 Bacteria 3322
239 Ga0373937_0394429 3300036401 Bacteria 1313
240 Ga0373925_0298199 3300037068 Bacteria 1301
241 Ga0373925_0335902 3300037068 Unclassified 1225
242 Ga0373925_0465824 3300037068 Unclassified 1036
243 Ga0436364_0472015 3300037853 Bacteria 764
244 Ga0436365_0498580 3300039437 Bacteria 5703
245 Ga0436360_1356167 3300039438 Unclassified 1153
246 Ga0436363_0460412 3300039450 Bacteria 1001
247 Ga0466963_0030553 3300044694 Bacteria 3478
248 Ga0451576_0001614 3300045051 Bacteria 37839
249 Ga0451576_0347887 3300045051 Unclassified 1552
250 Ga0466967_0696278 3300045976 Bacteria 1006
251 Ga0466967_1110312 3300045976 Unclassified 788
252 Ga0495603_0060828 3300046455 Bacteria 2231
253 Ga0495651_0218574 3300046462 Unclassified 1321
254 Ga0495580_0002472 3300046472 Bacteria 16135
255 Ga0495580_0003322 3300046472 Bacteria 13758
256 Ga0495580_0127629 3300046472 Unclassified 1765
257 Ga0495582_0207124 3300046473 Bacteria 1121
258 Ga0495639_0058475 3300046475 Bacteria 1763
259 Ga0495630_0004538 3300046517 Bacteria 9726
260 Ga0495630_0410801 3300046517 Bacteria 1037
261 Ga0495630_0533513 3300046517 Unclassified 900
262 Ga0495642_0266141 3300046528 Bacteria 750
263 Ga0495587_0004260 3300046536 Bacteria 9457
264 Ga0495633_0132431 3300046558 Bacteria 1154
265 Ga0495659_0141895 3300046664 Bacteria 959
266 Ga0495658_0038971 3300046683 Bacteria 2634
267 Ga0495658_0152695 3300046683 Bacteria 1419
268 Ga0495674_0141752 3300047319 Bacteria 2020
269 Ga0495674_0196504 3300047319 Bacteria 1675
270 Ga0495674_0386872 3300047319 Bacteria 1131
271 Ga0495674_0825174 3300047319 Unclassified 720
272 Ga0495675_0012170 3300047444 Bacteria 5413
273 Ga0495602_0248561 3300048088 Bacteria 1327
274 Ga0496102_0148782 3300048905 Unclassified 2199
275 Ga0496102_0461973 3300048905 Unclassified 1190
276 Ga0496104_0040238 3300048907 Unclassified 4381
277 Ga0496106_0031572 3300048909 Bacteria 3948
278 Ga0496107_0210768 3300048910 Viruses 1445
279 Ga0496112_0186581 3300048915 Unclassified 2037
280 Ga0496112_0292831 3300048915 Bacteria 1574
281 Ga0496115_0016399 3300048918 Bacteria 5642
282 Ga0501047_0674061 3300049581 Unclassified 852
283 nmdc:mga07m45_536337_c1 3300050496 Bacteria 677
284 nmdc:mga09592_562274_c1 3300050508 Unclassified 979
285 nmdc:mga08y16_142513_c1 3300050511 Bacteria 2491
286 nmdc:mga0n895_187_c1 3300050512 Bacteria 38298
287 nmdc:mga0n895_211979_c1 3300050512 Unclassified 1967
288 nmdc:mga0rr50_1623_c1 3300050513 Bacteria 12368
289 nmdc:mga0rr50_483721_c1 3300050513 Unclassified 1051
290 nmdc:mga08x19_2595_c1 3300050514 Bacteria 10966
291 nmdc:mga08x19_493296_c1 3300050514 Unclassified 864
292 nmdc:mga0a205_5879_c1 3300050515 Bacteria 11049
293 Ga0495601_0193045 3300053077 Bacteria 1331
294 Ga0495619_0021095 3300053085 Bacteria 4157

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0825174 Ga0495674_0825174_14_547 175
2 3300005843 Ga0068860_100160295 Ga0068860_1001602952 186
3 3300007788 Ga0099795_10204156 Ga0099795_102041561 186
4 3300025926 Ga0207659_10000077 Ga0207659_1000007727 186
5 3300028381 Ga0268264_10439563 Ga0268264_104395632 186
6 3300045051 Ga0451576_0347887 Ga0451576_0347887_971_1534 187
7 3300005548 Ga0070665_100075831 Ga0070665_1000758316 192
8 3300005842 Ga0068858_101131279 Ga0068858_1011312792 192
9 3300006881 Ga0068865_100896915 Ga0068865_1008969151 192
10 3300009177 Ga0105248_10212924 Ga0105248_102129242 192
11 3300025941 Ga0207711_10162301 Ga0207711_101623013 192
12 3300028379 Ga0268266_10057830 Ga0268266_100578301 192
13 3300005435 Ga0070714_100522780 Ga0070714_1005227802 207
14 3300006175 Ga0070712_100787193 Ga0070712_1007871932 207
15 3300025929 Ga0207664_10429123 Ga0207664_104291232 207
16 3300028800 Ga0265338_10022882 Ga0265338_100228822 207
17 3300031238 Ga0265332_10011006 Ga0265332_100110062 207
18 3300031239 Ga0265328_10025244 Ga0265328_100252443 207
19 3300031240 Ga0265320_10000649 Ga0265320_1000064921 207
20 3300031241 Ga0265325_10032770 Ga0265325_100327703 207
21 3300031242 Ga0265329_10015332 Ga0265329_100153322 207
22 3300031247 Ga0265340_10002670 Ga0265340_100026702 207
23 3300031250 Ga0265331_10002105 Ga0265331_100021058 207
24 3300031344 Ga0265316_10006389 Ga0265316_1000638912 207
25 3300031711 Ga0265314_10003845 Ga0265314_1000384510 207
26 3300031712 Ga0265342_10037108 Ga0265342_100371082 207
27 3300031712 Ga0265342_10338775 Ga0265342_103387752 207
28 3300046517 Ga0495630_0410801 Ga0495630_0410801_206_829 207
29 3300047319 Ga0495674_0386872 Ga0495674_0386872_228_851 207
30 3300005295 Ga0065707_10047719 Ga0065707_100477192 208
31 3300005330 Ga0070690_100006879 Ga0070690_1000068797 208
32 3300005334 Ga0068869_100486755 Ga0068869_1004867552 208
33 3300005334 Ga0068869_100651749 Ga0068869_1006517491 208
34 3300005335 Ga0070666_10690328 Ga0070666_106903281 208
35 3300005338 Ga0068868_100266146 Ga0068868_1002661462 208
36 3300005338 Ga0068868_100570137 Ga0068868_1005701372 208
37 3300005340 Ga0070689_100182376 Ga0070689_1001823762 208
38 3300005340 Ga0070689_100221244 Ga0070689_1002212442 208
39 3300005340 Ga0070689_100239713 Ga0070689_1002397132 208
40 3300005343 Ga0070687_100009503 Ga0070687_1000095035 208
41 3300005354 Ga0070675_100000911 Ga0070675_10000091119 208
42 3300005355 Ga0070671_100332602 Ga0070671_1003326022 208
43 3300005364 Ga0070673_100096765 Ga0070673_1000967654 208
44 3300005367 Ga0070667_100510069 Ga0070667_1005100692 208
45 3300005406 Ga0070703_10009330 Ga0070703_100093302 208
46 3300005434 Ga0070709_10000507 Ga0070709_100005076 208
47 3300005434 Ga0070709_10015653 Ga0070709_100156532 208
48 3300005436 Ga0070713_100001370 Ga0070713_1000013705 208
49 3300005437 Ga0070710_10026213 Ga0070710_100262133 208
50 3300005439 Ga0070711_100015030 Ga0070711_1000150301 208
51 3300005439 Ga0070711_100260426 Ga0070711_1002604262 208
52 3300005439 Ga0070711_101038997 Ga0070711_1010389971 208
53 3300005440 Ga0070705_100003341 Ga0070705_1000033416 208
54 3300005445 Ga0070708_100002244 Ga0070708_1000022444 208
55 3300005445 Ga0070708_100267322 Ga0070708_1002673222 208
56 3300005458 Ga0070681_10102560 Ga0070681_101025603 208
57 3300005459 Ga0068867_100015874 Ga0068867_1000158745 208
58 3300005459 Ga0068867_100192282 Ga0068867_1001922822 208
59 3300005459 Ga0068867_100281819 Ga0068867_1002818192 208
60 3300005466 Ga0070685_10136875 Ga0070685_101368752 208
61 3300005467 Ga0070706_100001656 Ga0070706_1000016564 208
62 3300005471 Ga0070698_100869317 Ga0070698_1008693171 208
63 3300005518 Ga0070699_100015160 Ga0070699_1000151605 208
64 3300005530 Ga0070679_100017595 Ga0070679_1000175955 208
65 3300005536 Ga0070697_100001122 Ga0070697_1000011223 208
66 3300005544 Ga0070686_100000751 Ga0070686_10000075117 208
67 3300005545 Ga0070695_100023474 Ga0070695_1000234741 208
68 3300005545 Ga0070695_100435987 Ga0070695_1004359872 208
69 3300005546 Ga0070696_100049419 Ga0070696_1000494192 208
70 3300005547 Ga0070693_100000295 Ga0070693_10000029525 208
71 3300005548 Ga0070665_100001033 Ga0070665_10000103326 208
72 3300005549 Ga0070704_100558228 Ga0070704_1005582282 208
73 3300005578 Ga0068854_100029588 Ga0068854_1000295882 208
74 3300005617 Ga0068859_100174929 Ga0068859_1001749292 208
75 3300005618 Ga0068864_100562120 Ga0068864_1005621202 208
76 3300005718 Ga0068866_10080469 Ga0068866_100804692 208
77 3300005718 Ga0068866_10113267 Ga0068866_101132672 208
78 3300005719 Ga0068861_100230922 Ga0068861_1002309221 208
79 3300005840 Ga0068870_10182636 Ga0068870_101826362 208
80 3300005841 Ga0068863_101168406 Ga0068863_1011684061 208
81 3300005842 Ga0068858_100035778 Ga0068858_1000357783 208
82 3300005842 Ga0068858_100552330 Ga0068858_1005523301 208
83 3300005843 Ga0068860_100318611 Ga0068860_1003186113 208
84 3300005843 Ga0068860_100922518 Ga0068860_1009225182 208
85 3300005844 Ga0068862_100530831 Ga0068862_1005308312 208
86 3300006173 Ga0070716_100000490 Ga0070716_10000049012 208
87 3300006173 Ga0070716_100181803 Ga0070716_1001818032 208
88 3300006173 Ga0070716_100823862 Ga0070716_1008238621 208
89 3300006175 Ga0070712_100000621 Ga0070712_10000062111 208
90 3300006237 Ga0097621_100082807 Ga0097621_1000828074 208
91 3300006353 Ga0075370_10229698 Ga0075370_102296981 208
92 3300006358 Ga0068871_100018976 Ga0068871_1000189766 208
93 3300006358 Ga0068871_100079945 Ga0068871_1000799453 208
94 3300006358 Ga0068871_100203710 Ga0068871_1002037102 208
95 3300006844 Ga0075428_100166769 Ga0075428_1001667693 208
96 3300006871 Ga0075434_100341282 Ga0075434_1003412822 208
97 3300006881 Ga0068865_100000950 Ga0068865_10000095010 208
98 3300006881 Ga0068865_100054311 Ga0068865_1000543115 208
99 3300006914 Ga0075436_100000734 Ga0075436_1000007345 208
100 3300006931 Ga0097620_100174930 Ga0097620_1001749303 208
101 3300007076 Ga0075435_100001354 Ga0075435_10000135412 208
102 3300007265 Ga0099794_10014819 Ga0099794_100148193 208
103 3300007265 Ga0099794_10042570 Ga0099794_100425702 208
104 3300007265 Ga0099794_10059690 Ga0099794_100596903 208
105 3300007265 Ga0099794_10101846 Ga0099794_101018463 208
106 3300009094 Ga0111539_10469078 Ga0111539_104690782 208
107 3300009098 Ga0105245_10038935 Ga0105245_100389353 208
108 3300009098 Ga0105245_10110458 Ga0105245_101104583 208
109 3300009098 Ga0105245_10169604 Ga0105245_101696042 208
110 3300009098 Ga0105245_10699808 Ga0105245_106998082 208
111 3300009101 Ga0105247_10062096 Ga0105247_100620962 208
112 3300009101 Ga0105247_10139550 Ga0105247_101395502 208
113 3300009148 Ga0105243_10113933 Ga0105243_101139332 208
114 3300009148 Ga0105243_10446333 Ga0105243_104463332 208
115 3300009177 Ga0105248_10057966 Ga0105248_100579663 208
116 3300009177 Ga0105248_10110681 Ga0105248_101106814 208
117 3300009551 Ga0105238_10237904 Ga0105238_102379042 208
118 3300009553 Ga0105249_10093619 Ga0105249_100936193 208
119 3300010159 Ga0099796_10139788 Ga0099796_101397882 208
120 3300013296 Ga0157374_10060655 Ga0157374_100606554 208
121 3300013297 Ga0157378_10217051 Ga0157378_102170512 208
122 3300013306 Ga0163162_10149397 Ga0163162_101493972 208
123 3300013306 Ga0163162_10491637 Ga0163162_104916372 208
124 3300014325 Ga0163163_10054811 Ga0163163_100548112 208
125 3300014325 Ga0163163_10076742 Ga0163163_100767422 208
126 3300014326 Ga0157380_10449365 Ga0157380_104493652 208
127 3300014745 Ga0157377_10077607 Ga0157377_100776072 208
128 3300014968 Ga0157379_10152919 Ga0157379_101529192 208
129 3300014968 Ga0157379_10435265 Ga0157379_104352652 208
130 3300014969 Ga0157376_10001580 Ga0157376_100015805 208
131 3300014969 Ga0157376_10005086 Ga0157376_100050865 208
132 3300014969 Ga0157376_10320512 Ga0157376_103205122 208
133 3300025885 Ga0207653_10001051 Ga0207653_100010519 208
134 3300025898 Ga0207692_10069541 Ga0207692_100695412 208
135 3300025903 Ga0207680_10013983 Ga0207680_100139835 208
136 3300025906 Ga0207699_10001122 Ga0207699_100011227 208
137 3300025906 Ga0207699_10022974 Ga0207699_100229742 208
138 3300025910 Ga0207684_10048990 Ga0207684_100489903 208
139 3300025910 Ga0207684_10054909 Ga0207684_100549093 208
140 3300025912 Ga0207707_10083622 Ga0207707_100836222 208
141 3300025915 Ga0207693_10000087 Ga0207693_1000008747 208
142 3300025916 Ga0207663_10109554 Ga0207663_101095542 208
143 3300025916 Ga0207663_10241761 Ga0207663_102417611 208
144 3300025916 Ga0207663_10853015 Ga0207663_108530151 208
145 3300025918 Ga0207662_10700875 Ga0207662_107008751 208
146 3300025921 Ga0207652_10013414 Ga0207652_100134146 208
147 3300025922 Ga0207646_10880166 Ga0207646_108801661 208
148 3300025927 Ga0207687_10005315 Ga0207687_100053159 208
149 3300025927 Ga0207687_10185883 Ga0207687_101858832 208
150 3300025928 Ga0207700_10004413 Ga0207700_100044136 208
151 3300025931 Ga0207644_10290713 Ga0207644_102907132 208
152 3300025934 Ga0207686_10003438 Ga0207686_1000343810 208
153 3300025938 Ga0207704_10016888 Ga0207704_100168884 208
154 3300025939 Ga0207665_10000015 Ga0207665_1000001582 208
155 3300025939 Ga0207665_10262818 Ga0207665_102628182 208
156 3300025941 Ga0207711_10082468 Ga0207711_100824684 208
157 3300025942 Ga0207689_10027008 Ga0207689_100270083 208
158 3300025945 Ga0207679_10827817 Ga0207679_108278171 208
159 3300025961 Ga0207712_10058035 Ga0207712_100580352 208
160 3300025981 Ga0207640_10005072 Ga0207640_100050724 208
161 3300026035 Ga0207703_10025580 Ga0207703_100255805 208
162 3300026035 Ga0207703_10509234 Ga0207703_105092341 208
163 3300026089 Ga0207648_10018576 Ga0207648_100185765 208
164 3300026089 Ga0207648_10043138 Ga0207648_100431385 208
165 3300026089 Ga0207648_10153845 Ga0207648_101538452 208
166 3300026121 Ga0207683_10291627 Ga0207683_102916272 208
167 3300026142 Ga0207698_10387508 Ga0207698_103875082 208
168 3300027671 Ga0209588_1113940 Ga0209588_11139402 208
169 3300027671 Ga0209588_1129744 Ga0209588_11297441 208
170 3300028016 Ga0265354_1000540 Ga0265354_10005405 208
171 3300028016 Ga0265354_1000550 Ga0265354_10005506 208
172 3300028379 Ga0268266_10003695 Ga0268266_100036956 208
173 3300028379 Ga0268266_10182809 Ga0268266_101828093 208
174 3300028380 Ga0268265_10454766 Ga0268265_104547662 208
175 3300028380 Ga0268265_10544065 Ga0268265_105440651 208
176 3300028381 Ga0268264_10890230 Ga0268264_108902302 208
177 3300028563 Ga0265319_1086886 Ga0265319_10868862 208
178 3300030878 Ga0265770_1001520 Ga0265770_10015203 208
179 3300030878 Ga0265770_1004096 Ga0265770_10040962 208
180 3300030879 Ga0265765_1000615 Ga0265765_10006153 208
181 3300031090 Ga0265760_10008907 Ga0265760_100089072 208
182 3300031090 Ga0265760_10011009 Ga0265760_100110093 208
183 3300034817 Ga0373948_0003910 Ga0373948_0003910_1274_1906 208
184 3300034819 Ga0373958_0001454 Ga0373958_0001454_416_1048 208
185 3300034957 Ga0373938_0005922 Ga0373938_0005922_1446_2078 208
186 3300035092 Ga0373952_0002347 Ga0373952_0002347_1801_2433 208
187 3300035112 Ga0373932_0000237 Ga0373932_0000237_14701_15333 208
188 3300035114 Ga0373939_0000699 Ga0373939_0000699_5759_6391 208
189 3300035119 Ga0373956_0129507 Ga0373956_0129507_16_648 208
190 3300035119 Ga0373956_0224167 Ga0373956_0224167_143_775 208
191 3300035170 Ga0373943_0220924 Ga0373943_0220924_101_733 208
192 3300035207 Ga0373942_0000063 Ga0373942_0000063_13173_13805 208
193 3300035241 Ga0373961_0005045 Ga0373961_0005045_2149_2781 208
194 3300035242 Ga0373962_0000302 Ga0373962_0000302_9626_10258 208
195 3300035691 Ga0373931_0543020 Ga0373931_0543020_41_673 208
196 3300036401 Ga0373937_0066395 Ga0373937_0066395_2045_2677 208
197 3300036401 Ga0373937_0394429 Ga0373937_0394429_28_660 208
198 3300037068 Ga0373925_0298199 Ga0373925_0298199_337_969 208
199 3300037068 Ga0373925_0335902 Ga0373925_0335902_19_651 208
200 3300037068 Ga0373925_0465824 Ga0373925_0465824_361_993 208
201 3300045051 Ga0451576_0001614 Ga0451576_0001614_34560_35192 208
202 3300045976 Ga0466967_1110312 Ga0466967_1110312_112_744 208
203 3300046455 Ga0495603_0060828 Ga0495603_0060828_1124_1756 208
204 3300046462 Ga0495651_0218574 Ga0495651_0218574_384_1016 208
205 3300046473 Ga0495582_0207124 Ga0495582_0207124_345_977 208
206 3300046475 Ga0495639_0058475 Ga0495639_0058475_510_1142 208
207 3300046517 Ga0495630_0533513 Ga0495630_0533513_13_645 208
208 3300046536 Ga0495587_0004260 Ga0495587_0004260_6778_7410 208
209 3300046558 Ga0495633_0132431 Ga0495633_0132431_393_1025 208
210 3300046683 Ga0495658_0038971 Ga0495658_0038971_766_1398 208
211 3300046683 Ga0495658_0152695 Ga0495658_0152695_173_805 208
212 3300047319 Ga0495674_0141752 Ga0495674_0141752_80_712 208
213 3300048905 Ga0496102_0148782 Ga0496102_0148782_1139_1771 208
214 3300048905 Ga0496102_0461973 Ga0496102_0461973_302_934 208
215 3300048907 Ga0496104_0040238 Ga0496104_0040238_3525_4157 208
216 3300048909 Ga0496106_0031572 Ga0496106_0031572_163_795 208
217 3300048910 Ga0496107_0210768 Ga0496107_0210768_136_768 208
218 3300048915 Ga0496112_0186581 Ga0496112_0186581_290_922 208
219 3300048915 Ga0496112_0292831 Ga0496112_0292831_164_796 208
220 3300048918 Ga0496115_0016399 Ga0496115_0016399_3933_4565 208
221 3300050496 nmdc:mga07m45_536337_c1 nmdc:mga07m45_536337_c1_10_642 208
222 3300050508 nmdc:mga09592_562274_c1 nmdc:mga09592_562274_c1_21_653 208
223 3300050511 nmdc:mga08y16_142513_c1 nmdc:mga08y16_142513_c1_1114_1746 208
224 3300050512 nmdc:mga0n895_211979_c1 nmdc:mga0n895_211979_c1_892_1524 208
225 3300050513 nmdc:mga0rr50_1623_c1 nmdc:mga0rr50_1623_c1_5249_5881 208
226 3300050513 nmdc:mga0rr50_483721_c1 nmdc:mga0rr50_483721_c1_188_820 208
227 3300050514 nmdc:mga08x19_2595_c1 nmdc:mga08x19_2595_c1_2503_3135 208
228 3300050514 nmdc:mga08x19_493296_c1 nmdc:mga08x19_493296_c1_74_706 208
229 3300053077 Ga0495601_0193045 Ga0495601_0193045_504_1136 208
230 3300053085 Ga0495619_0021095 Ga0495619_0021095_1524_2156 208
231 3300005290 Ga0065712_10238831 Ga0065712_102388312 209
232 3300005329 Ga0070683_100699202 Ga0070683_1006992021 209
233 3300005337 Ga0070682_100058708 Ga0070682_1000587082 209
234 3300005434 Ga0070709_10022241 Ga0070709_100222412 209
235 3300005434 Ga0070709_10254039 Ga0070709_102540392 209
236 3300005434 Ga0070709_10441748 Ga0070709_104417481 209
237 3300005435 Ga0070714_100003412 Ga0070714_1000034121 209
238 3300005435 Ga0070714_100034327 Ga0070714_1000343274 209
239 3300005435 Ga0070714_100089449 Ga0070714_1000894492 209
240 3300005435 Ga0070714_100333523 Ga0070714_1003335232 209
241 3300005436 Ga0070713_100026542 Ga0070713_1000265424 209
242 3300005436 Ga0070713_100049435 Ga0070713_1000494352 209
243 3300005437 Ga0070710_10043366 Ga0070710_100433662 209
244 3300005439 Ga0070711_100006665 Ga0070711_1000066652 209
245 3300005439 Ga0070711_100060080 Ga0070711_1000600802 209
246 3300005471 Ga0070698_100180753 Ga0070698_1001807531 209
247 3300006028 Ga0070717_10020526 Ga0070717_100205266 209
248 3300006028 Ga0070717_10173162 Ga0070717_101731622 209
249 3300006028 Ga0070717_10189194 Ga0070717_101891942 209
250 3300006028 Ga0070717_10312888 Ga0070717_103128882 209
251 3300006028 Ga0070717_10433884 Ga0070717_104338842 209
252 3300006163 Ga0070715_10000253 Ga0070715_100002534 209
253 3300006173 Ga0070716_100000178 Ga0070716_1000001786 209
254 3300006173 Ga0070716_100246183 Ga0070716_1002461832 209
255 3300006175 Ga0070712_100018290 Ga0070712_1000182905 209
256 3300006175 Ga0070712_100051574 Ga0070712_1000515744 209
257 3300006237 Ga0097621_100133639 Ga0097621_1001336392 209
258 3300006871 Ga0075434_100003219 Ga0075434_1000032199 209
259 3300006931 Ga0097620_100300950 Ga0097620_1003009502 209
260 3300013104 Ga0157370_10141168 Ga0157370_101411682 209
261 3300021384 Ga0213876_10076586 Ga0213876_100765862 209
262 3300025898 Ga0207692_10066303 Ga0207692_100663032 209
263 3300025905 Ga0207685_10004549 Ga0207685_100045493 209
264 3300025906 Ga0207699_10338738 Ga0207699_103387382 209
265 3300025915 Ga0207693_10006414 Ga0207693_100064146 209
266 3300025915 Ga0207693_10013894 Ga0207693_100138943 209
267 3300025915 Ga0207693_10220520 Ga0207693_102205201 209
268 3300025916 Ga0207663_10006322 Ga0207663_100063225 209
269 3300025928 Ga0207700_10063319 Ga0207700_100633192 209
270 3300025928 Ga0207700_10079726 Ga0207700_100797262 209
271 3300025928 Ga0207700_10112818 Ga0207700_101128181 209
272 3300025928 Ga0207700_10236931 Ga0207700_102369312 209
273 3300025928 Ga0207700_10457270 Ga0207700_104572702 209
274 3300025929 Ga0207664_10022657 Ga0207664_100226575 209
275 3300033547 Ga0316212_1002903 Ga0316212_10029032 209
276 3300035111 Ga0373923_0161209 Ga0373923_0161209_345_986 209
277 3300037853 Ga0436364_0472015 Ga0436364_0472015_83_712 209
278 3300039437 Ga0436365_0498580 Ga0436365_0498580_2001_2633 209
279 3300039438 Ga0436360_1356167 Ga0436360_1356167_426_1064 209
280 3300039450 Ga0436363_0460412 Ga0436363_0460412_48_677 209
281 3300044694 Ga0466963_0030553 Ga0466963_0030553_2835_3464 209
282 3300045976 Ga0466967_0696278 Ga0466967_0696278_289_918 209
283 3300046472 Ga0495580_0002472 Ga0495580_0002472_2503_3132 209
284 3300046472 Ga0495580_0003322 Ga0495580_0003322_9257_9889 209
285 3300046472 Ga0495580_0127629 Ga0495580_0127629_259_888 209
286 3300046517 Ga0495630_0004538 Ga0495630_0004538_3054_3689 209
287 3300046528 Ga0495642_0266141 Ga0495642_0266141_24_653 209
288 3300046664 Ga0495659_0141895 Ga0495659_0141895_120_749 209
289 3300047319 Ga0495674_0196504 Ga0495674_0196504_226_861 209
290 3300047444 Ga0495675_0012170 Ga0495675_0012170_2226_2861 209
291 3300048088 Ga0495602_0248561 Ga0495602_0248561_666_1295 209
292 3300049581 Ga0501047_0674061 Ga0501047_0674061_84_728 209
293 3300050512 nmdc:mga0n895_187_c1 nmdc:mga0n895_187_c1_21072_21707 209
294 3300050515 nmdc:mga0a205_5879_c1 nmdc:mga0a205_5879_c1_94_729 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13785

DUF4178

Domain of unknown function (DUF4178)

58

204

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x25-assembly1.cif.gz_A structural basis for mutation-induced destabilization of profilin 1 in als 0.5812 164 190
6gzy-assembly1.cif.gz_A hoip-fragment5 complex 0.5675 5 54
6gzy-assembly2.cif.gz_B hoip-fragment5 complex 0.5387 3 54
4ljo-assembly1.cif.gz_A structure of an active ligase (hoip)/ubiquitin transfer complex 0.5365 2 53
8fw5-assembly1.cif.gz_E chimeric hsgator1-spgtr-splam complex 0.4863 152 196
ID Description Score Start End Superfamily
2hzmG02 Mainly Beta;Single Sheet;q64v53_bacfr protein fold; 0.8324 72 111 2.20.140.20
af_A0A1D8PQM4_197_370_3.90.1110.10 Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 0.6631 70 109 3.90.1110.10
af_Q20160_3_310_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6283 120 178 1.10.510.10
4tx8A01 Mainly Beta;Ribbon;Seminal Fluid Protein;Carbohydrate-binding module superfamily 5/12 0.6225 114 147 2.10.10.20
af_P20028_190_362_3.90.1110.10 Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 0.6094 69 109 3.90.1110.10
ID Description Score Start End GO Terms
AF-A0A257S7I3-F1-model_v4 DUF4178 domain-containing protein 0.9515 49 209
AF-A0A0K0SY97-F1-model_v4 DUF4178 domain-containing protein 0.917 47 206 GO:0016020
AF-A0A800LV27-F1-model_v4 DUF4178 domain-containing protein 0.905 50 200
AF-A4ENV9-F1-model_v4 DUF4178 domain-containing protein 0.905 56 203
AF-A0A1X6YZZ5-F1-model_v4 DUF4178 domain-containing protein 0.9028 50 200

Feature Viewer

pLDDT pTM Quality
81.69 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map