F391960
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 294 | 181 | 294 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100180753|Ga0070698_1001807531 |
| Length | 219 |
| Sequence | MTQPIATCPNCGAKIIFRWSSSVQTVCEYCKSVLVRSDVDLKKVGQVADLPPDISPIQLNAEGNYRNKAFVVIGRILYQYDQGGWNEWHLMMNDGTSGWLSDAQEEYAISFAATGSTTGPTTSQKLPAESQVQIGQTYSWNDANYTVSVITQAHFRGVEGELPFQYWDKDDVAFADLRSSSRKFATLDYSDIEPVLYLGELVEFDDLKLKNLRQFEGWS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 130 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 131 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 132 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 133 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 134 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 137 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 148 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.3 |
| Metatranscriptomes | 1.7 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.68 |
| Nodule | 0 |
| Rhizoplane | 2.72 |
| Rhizosphere | 94.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10238831 | 3300005290 | Bacteria | 990 |
| 2 | Ga0065707_10047719 | 3300005295 | Unclassified | 859 |
| 3 | Ga0070683_100699202 | 3300005329 | Archaea | 971 |
| 4 | Ga0070690_100006879 | 3300005330 | Bacteria | 6471 |
| 5 | Ga0068869_100486755 | 3300005334 | Unclassified | 1028 |
| 6 | Ga0068869_100651749 | 3300005334 | Unclassified | 894 |
| 7 | Ga0070666_10690328 | 3300005335 | Bacteria | 748 |
| 8 | Ga0070682_100058708 | 3300005337 | Unclassified | 2427 |
| 9 | Ga0068868_100266146 | 3300005338 | Unclassified | 1447 |
| 10 | Ga0068868_100570137 | 3300005338 | Unclassified | 1000 |
| 11 | Ga0070689_100182376 | 3300005340 | Bacteria | 1706 |
| 12 | Ga0070689_100221244 | 3300005340 | Bacteria | 1553 |
| 13 | Ga0070689_100239713 | 3300005340 | Bacteria | 1493 |
| 14 | Ga0070687_100009503 | 3300005343 | Unclassified | 4170 |
| 15 | Ga0070675_100000911 | 3300005354 | Bacteria | 21029 |
| 16 | Ga0070671_100332602 | 3300005355 | Bacteria | 1295 |
| 17 | Ga0070673_100096765 | 3300005364 | Bacteria | 2423 |
| 18 | Ga0070667_100510069 | 3300005367 | Unclassified | 1103 |
| 19 | Ga0070703_10009330 | 3300005406 | Bacteria | 2768 |
| 20 | Ga0070709_10000507 | 3300005434 | Bacteria | 22990 |
| 21 | Ga0070709_10015653 | 3300005434 | Bacteria | 4319 |
| 22 | Ga0070709_10022241 | 3300005434 | Bacteria | 3706 |
| 23 | Ga0070709_10254039 | 3300005434 | Bacteria | 1267 |
| 24 | Ga0070709_10441748 | 3300005434 | Unclassified | 978 |
| 25 | Ga0070714_100003412 | 3300005435 | Bacteria | 11838 |
| 26 | Ga0070714_100034327 | 3300005435 | Bacteria | 4248 |
| 27 | Ga0070714_100089449 | 3300005435 | Archaea | 2695 |
| 28 | Ga0070714_100333523 | 3300005435 | Bacteria | 1421 |
| 29 | Ga0070714_100522780 | 3300005435 | Bacteria | 1134 |
| 30 | Ga0070713_100001370 | 3300005436 | Bacteria | 15591 |
| 31 | Ga0070713_100026542 | 3300005436 | Bacteria | 4549 |
| 32 | Ga0070713_100049435 | 3300005436 | Bacteria | 3469 |
| 33 | Ga0070710_10026213 | 3300005437 | Unclassified | 3095 |
| 34 | Ga0070710_10043366 | 3300005437 | Unclassified | 2491 |
| 35 | Ga0070711_100006665 | 3300005439 | Bacteria | 6982 |
| 36 | Ga0070711_100015030 | 3300005439 | Bacteria | 4892 |
| 37 | Ga0070711_100060080 | 3300005439 | Unclassified | 2641 |
| 38 | Ga0070711_100260426 | 3300005439 | Bacteria | 1364 |
| 39 | Ga0070711_101038997 | 3300005439 | Unclassified | 704 |
| 40 | Ga0070705_100003341 | 3300005440 | Bacteria | 7874 |
| 41 | Ga0070708_100002244 | 3300005445 | Bacteria | 14935 |
| 42 | Ga0070708_100267322 | 3300005445 | Bacteria | 1608 |
| 43 | Ga0070681_10102560 | 3300005458 | Unclassified | 2806 |
| 44 | Ga0068867_100015874 | 3300005459 | Bacteria | 5346 |
| 45 | Ga0068867_100192282 | 3300005459 | Unclassified | 1629 |
| 46 | Ga0068867_100281819 | 3300005459 | Unclassified | 1363 |
| 47 | Ga0070685_10136875 | 3300005466 | Unclassified | 1537 |
| 48 | Ga0070706_100001656 | 3300005467 | Bacteria | 23195 |
| 49 | Ga0070698_100180753 | 3300005471 | Bacteria | 2048 |
| 50 | Ga0070698_100869317 | 3300005471 | Unclassified | 847 |
| 51 | Ga0070699_100015160 | 3300005518 | Bacteria | 6621 |
| 52 | Ga0070679_100017595 | 3300005530 | Bacteria | 6918 |
| 53 | Ga0070697_100001122 | 3300005536 | Bacteria | 20239 |
| 54 | Ga0070686_100000751 | 3300005544 | Bacteria | 18805 |
| 55 | Ga0070695_100023474 | 3300005545 | Bacteria | 3791 |
| 56 | Ga0070695_100435987 | 3300005545 | Unclassified | 1001 |
| 57 | Ga0070696_100049419 | 3300005546 | Unclassified | 2922 |
| 58 | Ga0070693_100000295 | 3300005547 | Bacteria | 23286 |
| 59 | Ga0070665_100001033 | 3300005548 | Bacteria | 34868 |
| 60 | Ga0070665_100075831 | 3300005548 | Bacteria | 3370 |
| 61 | Ga0070704_100558228 | 3300005549 | Unclassified | 1001 |
| 62 | Ga0068854_100029588 | 3300005578 | Unclassified | 3793 |
| 63 | Ga0068859_100174929 | 3300005617 | Unclassified | 2228 |
| 64 | Ga0068864_100562120 | 3300005618 | Unclassified | 1104 |
| 65 | Ga0068866_10080469 | 3300005718 | Unclassified | 1748 |
| 66 | Ga0068866_10113267 | 3300005718 | Unclassified | 1517 |
| 67 | Ga0068861_100230922 | 3300005719 | Unclassified | 1569 |
| 68 | Ga0068870_10182636 | 3300005840 | Bacteria | 1260 |
| 69 | Ga0068863_101168406 | 3300005841 | Bacteria | 775 |
| 70 | Ga0068858_100035778 | 3300005842 | Bacteria | 4605 |
| 71 | Ga0068858_100552330 | 3300005842 | Bacteria | 1115 |
| 72 | Ga0068858_101131279 | 3300005842 | Bacteria | 769 |
| 73 | Ga0068860_100160295 | 3300005843 | Bacteria | 2169 |
| 74 | Ga0068860_100318611 | 3300005843 | Unclassified | 1526 |
| 75 | Ga0068860_100922518 | 3300005843 | Unclassified | 890 |
| 76 | Ga0068862_100530831 | 3300005844 | Unclassified | 1121 |
| 77 | Ga0070717_10020526 | 3300006028 | Bacteria | 5198 |
| 78 | Ga0070717_10173162 | 3300006028 | Unclassified | 1878 |
| 79 | Ga0070717_10189194 | 3300006028 | Unclassified | 1798 |
| 80 | Ga0070717_10312888 | 3300006028 | Unclassified | 1398 |
| 81 | Ga0070717_10433884 | 3300006028 | Bacteria | 1183 |
| 82 | Ga0070715_10000253 | 3300006163 | Bacteria | 12883 |
| 83 | Ga0070716_100000178 | 3300006173 | Bacteria | 24984 |
| 84 | Ga0070716_100000490 | 3300006173 | Bacteria | 16446 |
| 85 | Ga0070716_100181803 | 3300006173 | Bacteria | 1381 |
| 86 | Ga0070716_100246183 | 3300006173 | Bacteria | 1215 |
| 87 | Ga0070716_100823862 | 3300006173 | Unclassified | 720 |
| 88 | Ga0070712_100000621 | 3300006175 | Bacteria | 20835 |
| 89 | Ga0070712_100018290 | 3300006175 | Unclassified | 4549 |
| 90 | Ga0070712_100051574 | 3300006175 | Bacteria | 2866 |
| 91 | Ga0070712_100787193 | 3300006175 | Bacteria | 815 |
| 92 | Ga0097621_100082807 | 3300006237 | Bacteria | 2672 |
| 93 | Ga0097621_100133639 | 3300006237 | Bacteria | 2114 |
| 94 | Ga0075370_10229698 | 3300006353 | Bacteria | 1098 |
| 95 | Ga0068871_100018976 | 3300006358 | Bacteria | 5241 |
| 96 | Ga0068871_100079945 | 3300006358 | Unclassified | 2706 |
| 97 | Ga0068871_100203710 | 3300006358 | Unclassified | 1709 |
| 98 | Ga0075428_100166769 | 3300006844 | Unclassified | 2389 |
| 99 | Ga0075434_100003219 | 3300006871 | Bacteria | 14566 |
| 100 | Ga0075434_100341282 | 3300006871 | Bacteria | 1519 |
| 101 | Ga0068865_100000950 | 3300006881 | Bacteria | 16491 |
| 102 | Ga0068865_100054311 | 3300006881 | Bacteria | 2783 |
| 103 | Ga0068865_100896915 | 3300006881 | Unclassified | 771 |
| 104 | Ga0075436_100000734 | 3300006914 | Bacteria | 21719 |
| 105 | Ga0097620_100174930 | 3300006931 | Unclassified | 2228 |
| 106 | Ga0097620_100300950 | 3300006931 | Unclassified | 1697 |
| 107 | Ga0075435_100001354 | 3300007076 | Bacteria | 15787 |
| 108 | Ga0099794_10014819 | 3300007265 | Bacteria | 3426 |
| 109 | Ga0099794_10042570 | 3300007265 | Bacteria | 2165 |
| 110 | Ga0099794_10059690 | 3300007265 | Unclassified | 1851 |
| 111 | Ga0099794_10101846 | 3300007265 | Unclassified | 1434 |
| 112 | Ga0099795_10204156 | 3300007788 | Unclassified | 835 |
| 113 | Ga0111539_10469078 | 3300009094 | Bacteria | 1466 |
| 114 | Ga0105245_10038935 | 3300009098 | Bacteria | 4231 |
| 115 | Ga0105245_10110458 | 3300009098 | Bacteria | 2556 |
| 116 | Ga0105245_10169604 | 3300009098 | Unclassified | 2078 |
| 117 | Ga0105245_10699808 | 3300009098 | Bacteria | 1046 |
| 118 | Ga0105247_10062096 | 3300009101 | Bacteria | 2317 |
| 119 | Ga0105247_10139550 | 3300009101 | Unclassified | 1587 |
| 120 | Ga0105243_10113933 | 3300009148 | Unclassified | 2268 |
| 121 | Ga0105243_10446333 | 3300009148 | Unclassified | 1212 |
| 122 | Ga0105248_10057966 | 3300009177 | Bacteria | 4348 |
| 123 | Ga0105248_10110681 | 3300009177 | Bacteria | 3097 |
| 124 | Ga0105248_10212924 | 3300009177 | Bacteria | 2177 |
| 125 | Ga0105238_10237904 | 3300009551 | Unclassified | 1798 |
| 126 | Ga0105249_10093619 | 3300009553 | Unclassified | 2815 |
| 127 | Ga0099796_10139788 | 3300010159 | Unclassified | 945 |
| 128 | Ga0157370_10141168 | 3300013104 | Bacteria | 2244 |
| 129 | Ga0157374_10060655 | 3300013296 | Bacteria | 3540 |
| 130 | Ga0157378_10217051 | 3300013297 | Unclassified | 1817 |
| 131 | Ga0163162_10149397 | 3300013306 | Unclassified | 2453 |
| 132 | Ga0163162_10491637 | 3300013306 | Bacteria | 1358 |
| 133 | Ga0163163_10054811 | 3300014325 | Bacteria | 3940 |
| 134 | Ga0163163_10076742 | 3300014325 | Unclassified | 3337 |
| 135 | Ga0157380_10449365 | 3300014326 | Bacteria | 1237 |
| 136 | Ga0157377_10077607 | 3300014745 | Bacteria | 1934 |
| 137 | Ga0157379_10152919 | 3300014968 | Unclassified | 2081 |
| 138 | Ga0157379_10435265 | 3300014968 | Unclassified | 1209 |
| 139 | Ga0157376_10001580 | 3300014969 | Bacteria | 15053 |
| 140 | Ga0157376_10005086 | 3300014969 | Bacteria | 9165 |
| 141 | Ga0157376_10320512 | 3300014969 | Bacteria | 1473 |
| 142 | Ga0213876_10076586 | 3300021384 | Unclassified | 1767 |
| 143 | Ga0207653_10001051 | 3300025885 | Bacteria | 9083 |
| 144 | Ga0207692_10066303 | 3300025898 | Unclassified | 1887 |
| 145 | Ga0207692_10069541 | 3300025898 | Bacteria | 1850 |
| 146 | Ga0207680_10013983 | 3300025903 | Unclassified | 4138 |
| 147 | Ga0207685_10004549 | 3300025905 | Unclassified | 3544 |
| 148 | Ga0207699_10001122 | 3300025906 | Bacteria | 12669 |
| 149 | Ga0207699_10022974 | 3300025906 | Bacteria | 3388 |
| 150 | Ga0207699_10338738 | 3300025906 | Bacteria | 1059 |
| 151 | Ga0207684_10048990 | 3300025910 | Bacteria | 3584 |
| 152 | Ga0207684_10054909 | 3300025910 | Bacteria | 3380 |
| 153 | Ga0207707_10083622 | 3300025912 | Unclassified | 2787 |
| 154 | Ga0207693_10000087 | 3300025915 | Bacteria | 82834 |
| 155 | Ga0207693_10006414 | 3300025915 | Bacteria | 9750 |
| 156 | Ga0207693_10013894 | 3300025915 | Bacteria | 6484 |
| 157 | Ga0207693_10220520 | 3300025915 | Bacteria | 1490 |
| 158 | Ga0207663_10006322 | 3300025916 | Bacteria | 6050 |
| 159 | Ga0207663_10109554 | 3300025916 | Bacteria | 1872 |
| 160 | Ga0207663_10241761 | 3300025916 | Bacteria | 1324 |
| 161 | Ga0207663_10853015 | 3300025916 | Unclassified | 727 |
| 162 | Ga0207662_10700875 | 3300025918 | Unclassified | 710 |
| 163 | Ga0207652_10013414 | 3300025921 | Bacteria | 6632 |
| 164 | Ga0207646_10880166 | 3300025922 | Unclassified | 795 |
| 165 | Ga0207659_10000077 | 3300025926 | Bacteria | 62077 |
| 166 | Ga0207687_10005315 | 3300025927 | Bacteria | 8526 |
| 167 | Ga0207687_10185883 | 3300025927 | Unclassified | 1613 |
| 168 | Ga0207700_10004413 | 3300025928 | Bacteria | 8293 |
| 169 | Ga0207700_10063319 | 3300025928 | Bacteria | 2812 |
| 170 | Ga0207700_10079726 | 3300025928 | Bacteria | 2551 |
| 171 | Ga0207700_10112818 | 3300025928 | Unclassified | 2190 |
| 172 | Ga0207700_10236931 | 3300025928 | Archaea | 1554 |
| 173 | Ga0207700_10457270 | 3300025928 | Unclassified | 1126 |
| 174 | Ga0207664_10022657 | 3300025929 | Bacteria | 4694 |
| 175 | Ga0207664_10429123 | 3300025929 | Bacteria | 1178 |
| 176 | Ga0207644_10290713 | 3300025931 | Bacteria | 1314 |
| 177 | Ga0207686_10003438 | 3300025934 | Bacteria | 8502 |
| 178 | Ga0207704_10016888 | 3300025938 | Bacteria | 3766 |
| 179 | Ga0207665_10000015 | 3300025939 | Bacteria | 133147 |
| 180 | Ga0207665_10262818 | 3300025939 | Bacteria | 1279 |
| 181 | Ga0207711_10082468 | 3300025941 | Bacteria | 2811 |
| 182 | Ga0207711_10162301 | 3300025941 | Bacteria | 2024 |
| 183 | Ga0207689_10027008 | 3300025942 | Bacteria | 4806 |
| 184 | Ga0207679_10827817 | 3300025945 | Unclassified | 845 |
| 185 | Ga0207712_10058035 | 3300025961 | Unclassified | 2733 |
| 186 | Ga0207640_10005072 | 3300025981 | Bacteria | 7166 |
| 187 | Ga0207703_10025580 | 3300026035 | Bacteria | 4643 |
| 188 | Ga0207703_10509234 | 3300026035 | Bacteria | 1131 |
| 189 | Ga0207648_10018576 | 3300026089 | Bacteria | 6292 |
| 190 | Ga0207648_10043138 | 3300026089 | Unclassified | 3960 |
| 191 | Ga0207648_10153845 | 3300026089 | Bacteria | 2030 |
| 192 | Ga0207683_10291627 | 3300026121 | Unclassified | 1492 |
| 193 | Ga0207698_10387508 | 3300026142 | Unclassified | 1331 |
| 194 | Ga0209588_1113940 | 3300027671 | Bacteria | 868 |
| 195 | Ga0209588_1129744 | 3300027671 | Bacteria | 805 |
| 196 | Ga0265354_1000540 | 3300028016 | Bacteria | 6496 |
| 197 | Ga0265354_1000550 | 3300028016 | Bacteria | 6420 |
| 198 | Ga0268266_10003695 | 3300028379 | Bacteria | 15088 |
| 199 | Ga0268266_10057830 | 3300028379 | Bacteria | 3337 |
| 200 | Ga0268266_10182809 | 3300028379 | Unclassified | 1910 |
| 201 | Ga0268265_10454766 | 3300028380 | Unclassified | 1197 |
| 202 | Ga0268265_10544065 | 3300028380 | Unclassified | 1101 |
| 203 | Ga0268264_10439563 | 3300028381 | Bacteria | 1262 |
| 204 | Ga0268264_10890230 | 3300028381 | Unclassified | 893 |
| 205 | Ga0265319_1086886 | 3300028563 | Unclassified | 989 |
| 206 | Ga0265338_10022882 | 3300028800 | Bacteria | 6448 |
| 207 | Ga0265770_1001520 | 3300030878 | Unclassified | 3184 |
| 208 | Ga0265770_1004096 | 3300030878 | Unclassified | 1985 |
| 209 | Ga0265765_1000615 | 3300030879 | Unclassified | 2927 |
| 210 | Ga0265760_10008907 | 3300031090 | Unclassified | 2867 |
| 211 | Ga0265760_10011009 | 3300031090 | Bacteria | 2584 |
| 212 | Ga0265332_10011006 | 3300031238 | Bacteria | 4019 |
| 213 | Ga0265328_10025244 | 3300031239 | Bacteria | 2240 |
| 214 | Ga0265320_10000649 | 3300031240 | Bacteria | 26564 |
| 215 | Ga0265325_10032770 | 3300031241 | Bacteria | 2772 |
| 216 | Ga0265329_10015332 | 3300031242 | Bacteria | 2679 |
| 217 | Ga0265340_10002670 | 3300031247 | Bacteria | 10139 |
| 218 | Ga0265331_10002105 | 3300031250 | Bacteria | 13715 |
| 219 | Ga0265316_10006389 | 3300031344 | Bacteria | 11264 |
| 220 | Ga0265314_10003845 | 3300031711 | Bacteria | 14315 |
| 221 | Ga0265342_10037108 | 3300031712 | Bacteria | 2973 |
| 222 | Ga0265342_10338775 | 3300031712 | Bacteria | 785 |
| 223 | Ga0316212_1002903 | 3300033547 | Unclassified | 2460 |
| 224 | Ga0373948_0003910 | 3300034817 | Unclassified | 2326 |
| 225 | Ga0373958_0001454 | 3300034819 | Unclassified | 3189 |
| 226 | Ga0373938_0005922 | 3300034957 | Bacteria | 2094 |
| 227 | Ga0373952_0002347 | 3300035092 | Unclassified | 3410 |
| 228 | Ga0373923_0161209 | 3300035111 | Unclassified | 1023 |
| 229 | Ga0373932_0000237 | 3300035112 | Bacteria | 16732 |
| 230 | Ga0373939_0000699 | 3300035114 | Bacteria | 8316 |
| 231 | Ga0373956_0129507 | 3300035119 | Unclassified | 1181 |
| 232 | Ga0373956_0224167 | 3300035119 | Bacteria | 893 |
| 233 | Ga0373943_0220924 | 3300035170 | Bacteria | 1055 |
| 234 | Ga0373942_0000063 | 3300035207 | Bacteria | 22409 |
| 235 | Ga0373961_0005045 | 3300035241 | Unclassified | 3175 |
| 236 | Ga0373962_0000302 | 3300035242 | Bacteria | 10664 |
| 237 | Ga0373931_0543020 | 3300035691 | Unclassified | 754 |
| 238 | Ga0373937_0066395 | 3300036401 | Bacteria | 3322 |
| 239 | Ga0373937_0394429 | 3300036401 | Bacteria | 1313 |
| 240 | Ga0373925_0298199 | 3300037068 | Bacteria | 1301 |
| 241 | Ga0373925_0335902 | 3300037068 | Unclassified | 1225 |
| 242 | Ga0373925_0465824 | 3300037068 | Unclassified | 1036 |
| 243 | Ga0436364_0472015 | 3300037853 | Bacteria | 764 |
| 244 | Ga0436365_0498580 | 3300039437 | Bacteria | 5703 |
| 245 | Ga0436360_1356167 | 3300039438 | Unclassified | 1153 |
| 246 | Ga0436363_0460412 | 3300039450 | Bacteria | 1001 |
| 247 | Ga0466963_0030553 | 3300044694 | Bacteria | 3478 |
| 248 | Ga0451576_0001614 | 3300045051 | Bacteria | 37839 |
| 249 | Ga0451576_0347887 | 3300045051 | Unclassified | 1552 |
| 250 | Ga0466967_0696278 | 3300045976 | Bacteria | 1006 |
| 251 | Ga0466967_1110312 | 3300045976 | Unclassified | 788 |
| 252 | Ga0495603_0060828 | 3300046455 | Bacteria | 2231 |
| 253 | Ga0495651_0218574 | 3300046462 | Unclassified | 1321 |
| 254 | Ga0495580_0002472 | 3300046472 | Bacteria | 16135 |
| 255 | Ga0495580_0003322 | 3300046472 | Bacteria | 13758 |
| 256 | Ga0495580_0127629 | 3300046472 | Unclassified | 1765 |
| 257 | Ga0495582_0207124 | 3300046473 | Bacteria | 1121 |
| 258 | Ga0495639_0058475 | 3300046475 | Bacteria | 1763 |
| 259 | Ga0495630_0004538 | 3300046517 | Bacteria | 9726 |
| 260 | Ga0495630_0410801 | 3300046517 | Bacteria | 1037 |
| 261 | Ga0495630_0533513 | 3300046517 | Unclassified | 900 |
| 262 | Ga0495642_0266141 | 3300046528 | Bacteria | 750 |
| 263 | Ga0495587_0004260 | 3300046536 | Bacteria | 9457 |
| 264 | Ga0495633_0132431 | 3300046558 | Bacteria | 1154 |
| 265 | Ga0495659_0141895 | 3300046664 | Bacteria | 959 |
| 266 | Ga0495658_0038971 | 3300046683 | Bacteria | 2634 |
| 267 | Ga0495658_0152695 | 3300046683 | Bacteria | 1419 |
| 268 | Ga0495674_0141752 | 3300047319 | Bacteria | 2020 |
| 269 | Ga0495674_0196504 | 3300047319 | Bacteria | 1675 |
| 270 | Ga0495674_0386872 | 3300047319 | Bacteria | 1131 |
| 271 | Ga0495674_0825174 | 3300047319 | Unclassified | 720 |
| 272 | Ga0495675_0012170 | 3300047444 | Bacteria | 5413 |
| 273 | Ga0495602_0248561 | 3300048088 | Bacteria | 1327 |
| 274 | Ga0496102_0148782 | 3300048905 | Unclassified | 2199 |
| 275 | Ga0496102_0461973 | 3300048905 | Unclassified | 1190 |
| 276 | Ga0496104_0040238 | 3300048907 | Unclassified | 4381 |
| 277 | Ga0496106_0031572 | 3300048909 | Bacteria | 3948 |
| 278 | Ga0496107_0210768 | 3300048910 | Viruses | 1445 |
| 279 | Ga0496112_0186581 | 3300048915 | Unclassified | 2037 |
| 280 | Ga0496112_0292831 | 3300048915 | Bacteria | 1574 |
| 281 | Ga0496115_0016399 | 3300048918 | Bacteria | 5642 |
| 282 | Ga0501047_0674061 | 3300049581 | Unclassified | 852 |
| 283 | nmdc:mga07m45_536337_c1 | 3300050496 | Bacteria | 677 |
| 284 | nmdc:mga09592_562274_c1 | 3300050508 | Unclassified | 979 |
| 285 | nmdc:mga08y16_142513_c1 | 3300050511 | Bacteria | 2491 |
| 286 | nmdc:mga0n895_187_c1 | 3300050512 | Bacteria | 38298 |
| 287 | nmdc:mga0n895_211979_c1 | 3300050512 | Unclassified | 1967 |
| 288 | nmdc:mga0rr50_1623_c1 | 3300050513 | Bacteria | 12368 |
| 289 | nmdc:mga0rr50_483721_c1 | 3300050513 | Unclassified | 1051 |
| 290 | nmdc:mga08x19_2595_c1 | 3300050514 | Bacteria | 10966 |
| 291 | nmdc:mga08x19_493296_c1 | 3300050514 | Unclassified | 864 |
| 292 | nmdc:mga0a205_5879_c1 | 3300050515 | Bacteria | 11049 |
| 293 | Ga0495601_0193045 | 3300053077 | Bacteria | 1331 |
| 294 | Ga0495619_0021095 | 3300053085 | Bacteria | 4157 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047319 | Ga0495674_0825174 | Ga0495674_0825174_14_547 | 175 |
| 2 | 3300005843 | Ga0068860_100160295 | Ga0068860_1001602952 | 186 |
| 3 | 3300007788 | Ga0099795_10204156 | Ga0099795_102041561 | 186 |
| 4 | 3300025926 | Ga0207659_10000077 | Ga0207659_1000007727 | 186 |
| 5 | 3300028381 | Ga0268264_10439563 | Ga0268264_104395632 | 186 |
| 6 | 3300045051 | Ga0451576_0347887 | Ga0451576_0347887_971_1534 | 187 |
| 7 | 3300005548 | Ga0070665_100075831 | Ga0070665_1000758316 | 192 |
| 8 | 3300005842 | Ga0068858_101131279 | Ga0068858_1011312792 | 192 |
| 9 | 3300006881 | Ga0068865_100896915 | Ga0068865_1008969151 | 192 |
| 10 | 3300009177 | Ga0105248_10212924 | Ga0105248_102129242 | 192 |
| 11 | 3300025941 | Ga0207711_10162301 | Ga0207711_101623013 | 192 |
| 12 | 3300028379 | Ga0268266_10057830 | Ga0268266_100578301 | 192 |
| 13 | 3300005435 | Ga0070714_100522780 | Ga0070714_1005227802 | 207 |
| 14 | 3300006175 | Ga0070712_100787193 | Ga0070712_1007871932 | 207 |
| 15 | 3300025929 | Ga0207664_10429123 | Ga0207664_104291232 | 207 |
| 16 | 3300028800 | Ga0265338_10022882 | Ga0265338_100228822 | 207 |
| 17 | 3300031238 | Ga0265332_10011006 | Ga0265332_100110062 | 207 |
| 18 | 3300031239 | Ga0265328_10025244 | Ga0265328_100252443 | 207 |
| 19 | 3300031240 | Ga0265320_10000649 | Ga0265320_1000064921 | 207 |
| 20 | 3300031241 | Ga0265325_10032770 | Ga0265325_100327703 | 207 |
| 21 | 3300031242 | Ga0265329_10015332 | Ga0265329_100153322 | 207 |
| 22 | 3300031247 | Ga0265340_10002670 | Ga0265340_100026702 | 207 |
| 23 | 3300031250 | Ga0265331_10002105 | Ga0265331_100021058 | 207 |
| 24 | 3300031344 | Ga0265316_10006389 | Ga0265316_1000638912 | 207 |
| 25 | 3300031711 | Ga0265314_10003845 | Ga0265314_1000384510 | 207 |
| 26 | 3300031712 | Ga0265342_10037108 | Ga0265342_100371082 | 207 |
| 27 | 3300031712 | Ga0265342_10338775 | Ga0265342_103387752 | 207 |
| 28 | 3300046517 | Ga0495630_0410801 | Ga0495630_0410801_206_829 | 207 |
| 29 | 3300047319 | Ga0495674_0386872 | Ga0495674_0386872_228_851 | 207 |
| 30 | 3300005295 | Ga0065707_10047719 | Ga0065707_100477192 | 208 |
| 31 | 3300005330 | Ga0070690_100006879 | Ga0070690_1000068797 | 208 |
| 32 | 3300005334 | Ga0068869_100486755 | Ga0068869_1004867552 | 208 |
| 33 | 3300005334 | Ga0068869_100651749 | Ga0068869_1006517491 | 208 |
| 34 | 3300005335 | Ga0070666_10690328 | Ga0070666_106903281 | 208 |
| 35 | 3300005338 | Ga0068868_100266146 | Ga0068868_1002661462 | 208 |
| 36 | 3300005338 | Ga0068868_100570137 | Ga0068868_1005701372 | 208 |
| 37 | 3300005340 | Ga0070689_100182376 | Ga0070689_1001823762 | 208 |
| 38 | 3300005340 | Ga0070689_100221244 | Ga0070689_1002212442 | 208 |
| 39 | 3300005340 | Ga0070689_100239713 | Ga0070689_1002397132 | 208 |
| 40 | 3300005343 | Ga0070687_100009503 | Ga0070687_1000095035 | 208 |
| 41 | 3300005354 | Ga0070675_100000911 | Ga0070675_10000091119 | 208 |
| 42 | 3300005355 | Ga0070671_100332602 | Ga0070671_1003326022 | 208 |
| 43 | 3300005364 | Ga0070673_100096765 | Ga0070673_1000967654 | 208 |
| 44 | 3300005367 | Ga0070667_100510069 | Ga0070667_1005100692 | 208 |
| 45 | 3300005406 | Ga0070703_10009330 | Ga0070703_100093302 | 208 |
| 46 | 3300005434 | Ga0070709_10000507 | Ga0070709_100005076 | 208 |
| 47 | 3300005434 | Ga0070709_10015653 | Ga0070709_100156532 | 208 |
| 48 | 3300005436 | Ga0070713_100001370 | Ga0070713_1000013705 | 208 |
| 49 | 3300005437 | Ga0070710_10026213 | Ga0070710_100262133 | 208 |
| 50 | 3300005439 | Ga0070711_100015030 | Ga0070711_1000150301 | 208 |
| 51 | 3300005439 | Ga0070711_100260426 | Ga0070711_1002604262 | 208 |
| 52 | 3300005439 | Ga0070711_101038997 | Ga0070711_1010389971 | 208 |
| 53 | 3300005440 | Ga0070705_100003341 | Ga0070705_1000033416 | 208 |
| 54 | 3300005445 | Ga0070708_100002244 | Ga0070708_1000022444 | 208 |
| 55 | 3300005445 | Ga0070708_100267322 | Ga0070708_1002673222 | 208 |
| 56 | 3300005458 | Ga0070681_10102560 | Ga0070681_101025603 | 208 |
| 57 | 3300005459 | Ga0068867_100015874 | Ga0068867_1000158745 | 208 |
| 58 | 3300005459 | Ga0068867_100192282 | Ga0068867_1001922822 | 208 |
| 59 | 3300005459 | Ga0068867_100281819 | Ga0068867_1002818192 | 208 |
| 60 | 3300005466 | Ga0070685_10136875 | Ga0070685_101368752 | 208 |
| 61 | 3300005467 | Ga0070706_100001656 | Ga0070706_1000016564 | 208 |
| 62 | 3300005471 | Ga0070698_100869317 | Ga0070698_1008693171 | 208 |
| 63 | 3300005518 | Ga0070699_100015160 | Ga0070699_1000151605 | 208 |
| 64 | 3300005530 | Ga0070679_100017595 | Ga0070679_1000175955 | 208 |
| 65 | 3300005536 | Ga0070697_100001122 | Ga0070697_1000011223 | 208 |
| 66 | 3300005544 | Ga0070686_100000751 | Ga0070686_10000075117 | 208 |
| 67 | 3300005545 | Ga0070695_100023474 | Ga0070695_1000234741 | 208 |
| 68 | 3300005545 | Ga0070695_100435987 | Ga0070695_1004359872 | 208 |
| 69 | 3300005546 | Ga0070696_100049419 | Ga0070696_1000494192 | 208 |
| 70 | 3300005547 | Ga0070693_100000295 | Ga0070693_10000029525 | 208 |
| 71 | 3300005548 | Ga0070665_100001033 | Ga0070665_10000103326 | 208 |
| 72 | 3300005549 | Ga0070704_100558228 | Ga0070704_1005582282 | 208 |
| 73 | 3300005578 | Ga0068854_100029588 | Ga0068854_1000295882 | 208 |
| 74 | 3300005617 | Ga0068859_100174929 | Ga0068859_1001749292 | 208 |
| 75 | 3300005618 | Ga0068864_100562120 | Ga0068864_1005621202 | 208 |
| 76 | 3300005718 | Ga0068866_10080469 | Ga0068866_100804692 | 208 |
| 77 | 3300005718 | Ga0068866_10113267 | Ga0068866_101132672 | 208 |
| 78 | 3300005719 | Ga0068861_100230922 | Ga0068861_1002309221 | 208 |
| 79 | 3300005840 | Ga0068870_10182636 | Ga0068870_101826362 | 208 |
| 80 | 3300005841 | Ga0068863_101168406 | Ga0068863_1011684061 | 208 |
| 81 | 3300005842 | Ga0068858_100035778 | Ga0068858_1000357783 | 208 |
| 82 | 3300005842 | Ga0068858_100552330 | Ga0068858_1005523301 | 208 |
| 83 | 3300005843 | Ga0068860_100318611 | Ga0068860_1003186113 | 208 |
| 84 | 3300005843 | Ga0068860_100922518 | Ga0068860_1009225182 | 208 |
| 85 | 3300005844 | Ga0068862_100530831 | Ga0068862_1005308312 | 208 |
| 86 | 3300006173 | Ga0070716_100000490 | Ga0070716_10000049012 | 208 |
| 87 | 3300006173 | Ga0070716_100181803 | Ga0070716_1001818032 | 208 |
| 88 | 3300006173 | Ga0070716_100823862 | Ga0070716_1008238621 | 208 |
| 89 | 3300006175 | Ga0070712_100000621 | Ga0070712_10000062111 | 208 |
| 90 | 3300006237 | Ga0097621_100082807 | Ga0097621_1000828074 | 208 |
| 91 | 3300006353 | Ga0075370_10229698 | Ga0075370_102296981 | 208 |
| 92 | 3300006358 | Ga0068871_100018976 | Ga0068871_1000189766 | 208 |
| 93 | 3300006358 | Ga0068871_100079945 | Ga0068871_1000799453 | 208 |
| 94 | 3300006358 | Ga0068871_100203710 | Ga0068871_1002037102 | 208 |
| 95 | 3300006844 | Ga0075428_100166769 | Ga0075428_1001667693 | 208 |
| 96 | 3300006871 | Ga0075434_100341282 | Ga0075434_1003412822 | 208 |
| 97 | 3300006881 | Ga0068865_100000950 | Ga0068865_10000095010 | 208 |
| 98 | 3300006881 | Ga0068865_100054311 | Ga0068865_1000543115 | 208 |
| 99 | 3300006914 | Ga0075436_100000734 | Ga0075436_1000007345 | 208 |
| 100 | 3300006931 | Ga0097620_100174930 | Ga0097620_1001749303 | 208 |
| 101 | 3300007076 | Ga0075435_100001354 | Ga0075435_10000135412 | 208 |
| 102 | 3300007265 | Ga0099794_10014819 | Ga0099794_100148193 | 208 |
| 103 | 3300007265 | Ga0099794_10042570 | Ga0099794_100425702 | 208 |
| 104 | 3300007265 | Ga0099794_10059690 | Ga0099794_100596903 | 208 |
| 105 | 3300007265 | Ga0099794_10101846 | Ga0099794_101018463 | 208 |
| 106 | 3300009094 | Ga0111539_10469078 | Ga0111539_104690782 | 208 |
| 107 | 3300009098 | Ga0105245_10038935 | Ga0105245_100389353 | 208 |
| 108 | 3300009098 | Ga0105245_10110458 | Ga0105245_101104583 | 208 |
| 109 | 3300009098 | Ga0105245_10169604 | Ga0105245_101696042 | 208 |
| 110 | 3300009098 | Ga0105245_10699808 | Ga0105245_106998082 | 208 |
| 111 | 3300009101 | Ga0105247_10062096 | Ga0105247_100620962 | 208 |
| 112 | 3300009101 | Ga0105247_10139550 | Ga0105247_101395502 | 208 |
| 113 | 3300009148 | Ga0105243_10113933 | Ga0105243_101139332 | 208 |
| 114 | 3300009148 | Ga0105243_10446333 | Ga0105243_104463332 | 208 |
| 115 | 3300009177 | Ga0105248_10057966 | Ga0105248_100579663 | 208 |
| 116 | 3300009177 | Ga0105248_10110681 | Ga0105248_101106814 | 208 |
| 117 | 3300009551 | Ga0105238_10237904 | Ga0105238_102379042 | 208 |
| 118 | 3300009553 | Ga0105249_10093619 | Ga0105249_100936193 | 208 |
| 119 | 3300010159 | Ga0099796_10139788 | Ga0099796_101397882 | 208 |
| 120 | 3300013296 | Ga0157374_10060655 | Ga0157374_100606554 | 208 |
| 121 | 3300013297 | Ga0157378_10217051 | Ga0157378_102170512 | 208 |
| 122 | 3300013306 | Ga0163162_10149397 | Ga0163162_101493972 | 208 |
| 123 | 3300013306 | Ga0163162_10491637 | Ga0163162_104916372 | 208 |
| 124 | 3300014325 | Ga0163163_10054811 | Ga0163163_100548112 | 208 |
| 125 | 3300014325 | Ga0163163_10076742 | Ga0163163_100767422 | 208 |
| 126 | 3300014326 | Ga0157380_10449365 | Ga0157380_104493652 | 208 |
| 127 | 3300014745 | Ga0157377_10077607 | Ga0157377_100776072 | 208 |
| 128 | 3300014968 | Ga0157379_10152919 | Ga0157379_101529192 | 208 |
| 129 | 3300014968 | Ga0157379_10435265 | Ga0157379_104352652 | 208 |
| 130 | 3300014969 | Ga0157376_10001580 | Ga0157376_100015805 | 208 |
| 131 | 3300014969 | Ga0157376_10005086 | Ga0157376_100050865 | 208 |
| 132 | 3300014969 | Ga0157376_10320512 | Ga0157376_103205122 | 208 |
| 133 | 3300025885 | Ga0207653_10001051 | Ga0207653_100010519 | 208 |
| 134 | 3300025898 | Ga0207692_10069541 | Ga0207692_100695412 | 208 |
| 135 | 3300025903 | Ga0207680_10013983 | Ga0207680_100139835 | 208 |
| 136 | 3300025906 | Ga0207699_10001122 | Ga0207699_100011227 | 208 |
| 137 | 3300025906 | Ga0207699_10022974 | Ga0207699_100229742 | 208 |
| 138 | 3300025910 | Ga0207684_10048990 | Ga0207684_100489903 | 208 |
| 139 | 3300025910 | Ga0207684_10054909 | Ga0207684_100549093 | 208 |
| 140 | 3300025912 | Ga0207707_10083622 | Ga0207707_100836222 | 208 |
| 141 | 3300025915 | Ga0207693_10000087 | Ga0207693_1000008747 | 208 |
| 142 | 3300025916 | Ga0207663_10109554 | Ga0207663_101095542 | 208 |
| 143 | 3300025916 | Ga0207663_10241761 | Ga0207663_102417611 | 208 |
| 144 | 3300025916 | Ga0207663_10853015 | Ga0207663_108530151 | 208 |
| 145 | 3300025918 | Ga0207662_10700875 | Ga0207662_107008751 | 208 |
| 146 | 3300025921 | Ga0207652_10013414 | Ga0207652_100134146 | 208 |
| 147 | 3300025922 | Ga0207646_10880166 | Ga0207646_108801661 | 208 |
| 148 | 3300025927 | Ga0207687_10005315 | Ga0207687_100053159 | 208 |
| 149 | 3300025927 | Ga0207687_10185883 | Ga0207687_101858832 | 208 |
| 150 | 3300025928 | Ga0207700_10004413 | Ga0207700_100044136 | 208 |
| 151 | 3300025931 | Ga0207644_10290713 | Ga0207644_102907132 | 208 |
| 152 | 3300025934 | Ga0207686_10003438 | Ga0207686_1000343810 | 208 |
| 153 | 3300025938 | Ga0207704_10016888 | Ga0207704_100168884 | 208 |
| 154 | 3300025939 | Ga0207665_10000015 | Ga0207665_1000001582 | 208 |
| 155 | 3300025939 | Ga0207665_10262818 | Ga0207665_102628182 | 208 |
| 156 | 3300025941 | Ga0207711_10082468 | Ga0207711_100824684 | 208 |
| 157 | 3300025942 | Ga0207689_10027008 | Ga0207689_100270083 | 208 |
| 158 | 3300025945 | Ga0207679_10827817 | Ga0207679_108278171 | 208 |
| 159 | 3300025961 | Ga0207712_10058035 | Ga0207712_100580352 | 208 |
| 160 | 3300025981 | Ga0207640_10005072 | Ga0207640_100050724 | 208 |
| 161 | 3300026035 | Ga0207703_10025580 | Ga0207703_100255805 | 208 |
| 162 | 3300026035 | Ga0207703_10509234 | Ga0207703_105092341 | 208 |
| 163 | 3300026089 | Ga0207648_10018576 | Ga0207648_100185765 | 208 |
| 164 | 3300026089 | Ga0207648_10043138 | Ga0207648_100431385 | 208 |
| 165 | 3300026089 | Ga0207648_10153845 | Ga0207648_101538452 | 208 |
| 166 | 3300026121 | Ga0207683_10291627 | Ga0207683_102916272 | 208 |
| 167 | 3300026142 | Ga0207698_10387508 | Ga0207698_103875082 | 208 |
| 168 | 3300027671 | Ga0209588_1113940 | Ga0209588_11139402 | 208 |
| 169 | 3300027671 | Ga0209588_1129744 | Ga0209588_11297441 | 208 |
| 170 | 3300028016 | Ga0265354_1000540 | Ga0265354_10005405 | 208 |
| 171 | 3300028016 | Ga0265354_1000550 | Ga0265354_10005506 | 208 |
| 172 | 3300028379 | Ga0268266_10003695 | Ga0268266_100036956 | 208 |
| 173 | 3300028379 | Ga0268266_10182809 | Ga0268266_101828093 | 208 |
| 174 | 3300028380 | Ga0268265_10454766 | Ga0268265_104547662 | 208 |
| 175 | 3300028380 | Ga0268265_10544065 | Ga0268265_105440651 | 208 |
| 176 | 3300028381 | Ga0268264_10890230 | Ga0268264_108902302 | 208 |
| 177 | 3300028563 | Ga0265319_1086886 | Ga0265319_10868862 | 208 |
| 178 | 3300030878 | Ga0265770_1001520 | Ga0265770_10015203 | 208 |
| 179 | 3300030878 | Ga0265770_1004096 | Ga0265770_10040962 | 208 |
| 180 | 3300030879 | Ga0265765_1000615 | Ga0265765_10006153 | 208 |
| 181 | 3300031090 | Ga0265760_10008907 | Ga0265760_100089072 | 208 |
| 182 | 3300031090 | Ga0265760_10011009 | Ga0265760_100110093 | 208 |
| 183 | 3300034817 | Ga0373948_0003910 | Ga0373948_0003910_1274_1906 | 208 |
| 184 | 3300034819 | Ga0373958_0001454 | Ga0373958_0001454_416_1048 | 208 |
| 185 | 3300034957 | Ga0373938_0005922 | Ga0373938_0005922_1446_2078 | 208 |
| 186 | 3300035092 | Ga0373952_0002347 | Ga0373952_0002347_1801_2433 | 208 |
| 187 | 3300035112 | Ga0373932_0000237 | Ga0373932_0000237_14701_15333 | 208 |
| 188 | 3300035114 | Ga0373939_0000699 | Ga0373939_0000699_5759_6391 | 208 |
| 189 | 3300035119 | Ga0373956_0129507 | Ga0373956_0129507_16_648 | 208 |
| 190 | 3300035119 | Ga0373956_0224167 | Ga0373956_0224167_143_775 | 208 |
| 191 | 3300035170 | Ga0373943_0220924 | Ga0373943_0220924_101_733 | 208 |
| 192 | 3300035207 | Ga0373942_0000063 | Ga0373942_0000063_13173_13805 | 208 |
| 193 | 3300035241 | Ga0373961_0005045 | Ga0373961_0005045_2149_2781 | 208 |
| 194 | 3300035242 | Ga0373962_0000302 | Ga0373962_0000302_9626_10258 | 208 |
| 195 | 3300035691 | Ga0373931_0543020 | Ga0373931_0543020_41_673 | 208 |
| 196 | 3300036401 | Ga0373937_0066395 | Ga0373937_0066395_2045_2677 | 208 |
| 197 | 3300036401 | Ga0373937_0394429 | Ga0373937_0394429_28_660 | 208 |
| 198 | 3300037068 | Ga0373925_0298199 | Ga0373925_0298199_337_969 | 208 |
| 199 | 3300037068 | Ga0373925_0335902 | Ga0373925_0335902_19_651 | 208 |
| 200 | 3300037068 | Ga0373925_0465824 | Ga0373925_0465824_361_993 | 208 |
| 201 | 3300045051 | Ga0451576_0001614 | Ga0451576_0001614_34560_35192 | 208 |
| 202 | 3300045976 | Ga0466967_1110312 | Ga0466967_1110312_112_744 | 208 |
| 203 | 3300046455 | Ga0495603_0060828 | Ga0495603_0060828_1124_1756 | 208 |
| 204 | 3300046462 | Ga0495651_0218574 | Ga0495651_0218574_384_1016 | 208 |
| 205 | 3300046473 | Ga0495582_0207124 | Ga0495582_0207124_345_977 | 208 |
| 206 | 3300046475 | Ga0495639_0058475 | Ga0495639_0058475_510_1142 | 208 |
| 207 | 3300046517 | Ga0495630_0533513 | Ga0495630_0533513_13_645 | 208 |
| 208 | 3300046536 | Ga0495587_0004260 | Ga0495587_0004260_6778_7410 | 208 |
| 209 | 3300046558 | Ga0495633_0132431 | Ga0495633_0132431_393_1025 | 208 |
| 210 | 3300046683 | Ga0495658_0038971 | Ga0495658_0038971_766_1398 | 208 |
| 211 | 3300046683 | Ga0495658_0152695 | Ga0495658_0152695_173_805 | 208 |
| 212 | 3300047319 | Ga0495674_0141752 | Ga0495674_0141752_80_712 | 208 |
| 213 | 3300048905 | Ga0496102_0148782 | Ga0496102_0148782_1139_1771 | 208 |
| 214 | 3300048905 | Ga0496102_0461973 | Ga0496102_0461973_302_934 | 208 |
| 215 | 3300048907 | Ga0496104_0040238 | Ga0496104_0040238_3525_4157 | 208 |
| 216 | 3300048909 | Ga0496106_0031572 | Ga0496106_0031572_163_795 | 208 |
| 217 | 3300048910 | Ga0496107_0210768 | Ga0496107_0210768_136_768 | 208 |
| 218 | 3300048915 | Ga0496112_0186581 | Ga0496112_0186581_290_922 | 208 |
| 219 | 3300048915 | Ga0496112_0292831 | Ga0496112_0292831_164_796 | 208 |
| 220 | 3300048918 | Ga0496115_0016399 | Ga0496115_0016399_3933_4565 | 208 |
| 221 | 3300050496 | nmdc:mga07m45_536337_c1 | nmdc:mga07m45_536337_c1_10_642 | 208 |
| 222 | 3300050508 | nmdc:mga09592_562274_c1 | nmdc:mga09592_562274_c1_21_653 | 208 |
| 223 | 3300050511 | nmdc:mga08y16_142513_c1 | nmdc:mga08y16_142513_c1_1114_1746 | 208 |
| 224 | 3300050512 | nmdc:mga0n895_211979_c1 | nmdc:mga0n895_211979_c1_892_1524 | 208 |
| 225 | 3300050513 | nmdc:mga0rr50_1623_c1 | nmdc:mga0rr50_1623_c1_5249_5881 | 208 |
| 226 | 3300050513 | nmdc:mga0rr50_483721_c1 | nmdc:mga0rr50_483721_c1_188_820 | 208 |
| 227 | 3300050514 | nmdc:mga08x19_2595_c1 | nmdc:mga08x19_2595_c1_2503_3135 | 208 |
| 228 | 3300050514 | nmdc:mga08x19_493296_c1 | nmdc:mga08x19_493296_c1_74_706 | 208 |
| 229 | 3300053077 | Ga0495601_0193045 | Ga0495601_0193045_504_1136 | 208 |
| 230 | 3300053085 | Ga0495619_0021095 | Ga0495619_0021095_1524_2156 | 208 |
| 231 | 3300005290 | Ga0065712_10238831 | Ga0065712_102388312 | 209 |
| 232 | 3300005329 | Ga0070683_100699202 | Ga0070683_1006992021 | 209 |
| 233 | 3300005337 | Ga0070682_100058708 | Ga0070682_1000587082 | 209 |
| 234 | 3300005434 | Ga0070709_10022241 | Ga0070709_100222412 | 209 |
| 235 | 3300005434 | Ga0070709_10254039 | Ga0070709_102540392 | 209 |
| 236 | 3300005434 | Ga0070709_10441748 | Ga0070709_104417481 | 209 |
| 237 | 3300005435 | Ga0070714_100003412 | Ga0070714_1000034121 | 209 |
| 238 | 3300005435 | Ga0070714_100034327 | Ga0070714_1000343274 | 209 |
| 239 | 3300005435 | Ga0070714_100089449 | Ga0070714_1000894492 | 209 |
| 240 | 3300005435 | Ga0070714_100333523 | Ga0070714_1003335232 | 209 |
| 241 | 3300005436 | Ga0070713_100026542 | Ga0070713_1000265424 | 209 |
| 242 | 3300005436 | Ga0070713_100049435 | Ga0070713_1000494352 | 209 |
| 243 | 3300005437 | Ga0070710_10043366 | Ga0070710_100433662 | 209 |
| 244 | 3300005439 | Ga0070711_100006665 | Ga0070711_1000066652 | 209 |
| 245 | 3300005439 | Ga0070711_100060080 | Ga0070711_1000600802 | 209 |
| 246 | 3300005471 | Ga0070698_100180753 | Ga0070698_1001807531 | 209 |
| 247 | 3300006028 | Ga0070717_10020526 | Ga0070717_100205266 | 209 |
| 248 | 3300006028 | Ga0070717_10173162 | Ga0070717_101731622 | 209 |
| 249 | 3300006028 | Ga0070717_10189194 | Ga0070717_101891942 | 209 |
| 250 | 3300006028 | Ga0070717_10312888 | Ga0070717_103128882 | 209 |
| 251 | 3300006028 | Ga0070717_10433884 | Ga0070717_104338842 | 209 |
| 252 | 3300006163 | Ga0070715_10000253 | Ga0070715_100002534 | 209 |
| 253 | 3300006173 | Ga0070716_100000178 | Ga0070716_1000001786 | 209 |
| 254 | 3300006173 | Ga0070716_100246183 | Ga0070716_1002461832 | 209 |
| 255 | 3300006175 | Ga0070712_100018290 | Ga0070712_1000182905 | 209 |
| 256 | 3300006175 | Ga0070712_100051574 | Ga0070712_1000515744 | 209 |
| 257 | 3300006237 | Ga0097621_100133639 | Ga0097621_1001336392 | 209 |
| 258 | 3300006871 | Ga0075434_100003219 | Ga0075434_1000032199 | 209 |
| 259 | 3300006931 | Ga0097620_100300950 | Ga0097620_1003009502 | 209 |
| 260 | 3300013104 | Ga0157370_10141168 | Ga0157370_101411682 | 209 |
| 261 | 3300021384 | Ga0213876_10076586 | Ga0213876_100765862 | 209 |
| 262 | 3300025898 | Ga0207692_10066303 | Ga0207692_100663032 | 209 |
| 263 | 3300025905 | Ga0207685_10004549 | Ga0207685_100045493 | 209 |
| 264 | 3300025906 | Ga0207699_10338738 | Ga0207699_103387382 | 209 |
| 265 | 3300025915 | Ga0207693_10006414 | Ga0207693_100064146 | 209 |
| 266 | 3300025915 | Ga0207693_10013894 | Ga0207693_100138943 | 209 |
| 267 | 3300025915 | Ga0207693_10220520 | Ga0207693_102205201 | 209 |
| 268 | 3300025916 | Ga0207663_10006322 | Ga0207663_100063225 | 209 |
| 269 | 3300025928 | Ga0207700_10063319 | Ga0207700_100633192 | 209 |
| 270 | 3300025928 | Ga0207700_10079726 | Ga0207700_100797262 | 209 |
| 271 | 3300025928 | Ga0207700_10112818 | Ga0207700_101128181 | 209 |
| 272 | 3300025928 | Ga0207700_10236931 | Ga0207700_102369312 | 209 |
| 273 | 3300025928 | Ga0207700_10457270 | Ga0207700_104572702 | 209 |
| 274 | 3300025929 | Ga0207664_10022657 | Ga0207664_100226575 | 209 |
| 275 | 3300033547 | Ga0316212_1002903 | Ga0316212_10029032 | 209 |
| 276 | 3300035111 | Ga0373923_0161209 | Ga0373923_0161209_345_986 | 209 |
| 277 | 3300037853 | Ga0436364_0472015 | Ga0436364_0472015_83_712 | 209 |
| 278 | 3300039437 | Ga0436365_0498580 | Ga0436365_0498580_2001_2633 | 209 |
| 279 | 3300039438 | Ga0436360_1356167 | Ga0436360_1356167_426_1064 | 209 |
| 280 | 3300039450 | Ga0436363_0460412 | Ga0436363_0460412_48_677 | 209 |
| 281 | 3300044694 | Ga0466963_0030553 | Ga0466963_0030553_2835_3464 | 209 |
| 282 | 3300045976 | Ga0466967_0696278 | Ga0466967_0696278_289_918 | 209 |
| 283 | 3300046472 | Ga0495580_0002472 | Ga0495580_0002472_2503_3132 | 209 |
| 284 | 3300046472 | Ga0495580_0003322 | Ga0495580_0003322_9257_9889 | 209 |
| 285 | 3300046472 | Ga0495580_0127629 | Ga0495580_0127629_259_888 | 209 |
| 286 | 3300046517 | Ga0495630_0004538 | Ga0495630_0004538_3054_3689 | 209 |
| 287 | 3300046528 | Ga0495642_0266141 | Ga0495642_0266141_24_653 | 209 |
| 288 | 3300046664 | Ga0495659_0141895 | Ga0495659_0141895_120_749 | 209 |
| 289 | 3300047319 | Ga0495674_0196504 | Ga0495674_0196504_226_861 | 209 |
| 290 | 3300047444 | Ga0495675_0012170 | Ga0495675_0012170_2226_2861 | 209 |
| 291 | 3300048088 | Ga0495602_0248561 | Ga0495602_0248561_666_1295 | 209 |
| 292 | 3300049581 | Ga0501047_0674061 | Ga0501047_0674061_84_728 | 209 |
| 293 | 3300050512 | nmdc:mga0n895_187_c1 | nmdc:mga0n895_187_c1_21072_21707 | 209 |
| 294 | 3300050515 | nmdc:mga0a205_5879_c1 | nmdc:mga0a205_5879_c1_94_729 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4x25-assembly1.cif.gz_A | structural basis for mutation-induced destabilization of profilin 1 in als | 0.5812 | 164 | 190 |
| 6gzy-assembly1.cif.gz_A | hoip-fragment5 complex | 0.5675 | 5 | 54 |
| 6gzy-assembly2.cif.gz_B | hoip-fragment5 complex | 0.5387 | 3 | 54 |
| 4ljo-assembly1.cif.gz_A | structure of an active ligase (hoip)/ubiquitin transfer complex | 0.5365 | 2 | 53 |
| 8fw5-assembly1.cif.gz_E | chimeric hsgator1-spgtr-splam complex | 0.4863 | 152 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hzmG02 | Mainly Beta;Single Sheet;q64v53_bacfr protein fold; | 0.8324 | 72 | 111 | 2.20.140.20 |
| af_A0A1D8PQM4_197_370_3.90.1110.10 | Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 | 0.6631 | 70 | 109 | 3.90.1110.10 |
| af_Q20160_3_310_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.6283 | 120 | 178 | 1.10.510.10 |
| 4tx8A01 | Mainly Beta;Ribbon;Seminal Fluid Protein;Carbohydrate-binding module superfamily 5/12 | 0.6225 | 114 | 147 | 2.10.10.20 |
| af_P20028_190_362_3.90.1110.10 | Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 | 0.6094 | 69 | 109 | 3.90.1110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257S7I3-F1-model_v4 | DUF4178 domain-containing protein | 0.9515 | 49 | 209 |
|
| AF-A0A0K0SY97-F1-model_v4 | DUF4178 domain-containing protein | 0.917 | 47 | 206 |
GO:0016020
|
| AF-A0A800LV27-F1-model_v4 | DUF4178 domain-containing protein | 0.905 | 50 | 200 |
|
| AF-A4ENV9-F1-model_v4 | DUF4178 domain-containing protein | 0.905 | 56 | 203 |
|
| AF-A0A1X6YZZ5-F1-model_v4 | DUF4178 domain-containing protein | 0.9028 | 50 | 200 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar