F391927

General Info

Members Datasets Scaffolds Average Seq Length
294 206 588 308

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100002680|Ga0070674_1000026807
Length 332
Sequence VNTNQEARSEKREHTPLGPVSGPILITGATGFAGGHLIESLAGSHRLVGWGRSTPRPEIARLIESQAVDLLDREQVRHAIANLRPATIFHLAGAPQVAESWRDTTRPLAGNVLASSHLFDAIRRAGLSCRVLVTGSAAVYAPSDTPITEEGALAPGNPYALSKLAQEQLAMRACADDGIDVVLVRPFNHTGPHQPPAFVAPSMARQIALIEKGDVEPVIRVGNLDARRDFTDVRDVVRAYVSLAGLGRSGEIYNVGSGVGRSIQSLLDALRARAHAEVRVEVDPERLRPAETSALVADTTRLRERTGWKPQIPFESMLDSLLDHWRSEVRAK

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
172 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
173 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
174 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
175 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
176 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
177 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
178 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
179 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
180 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
181 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
182 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
183 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
184 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
185 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
186 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
187 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
188 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
189 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
190 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
191 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
192 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
193 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
194 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
195 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
196 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
197 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
198 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
199 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
200 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
201 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
202 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
203 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
204 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
205 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
206 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.76
Metatranscriptomes 0
Isolates 12.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 10.88
Rhizoplane 3.4
Rhizosphere 81.29
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100002680 3300005356 Bacteria 9861
2 JGI25156J39149_1000839 3300002705 Bacteria 15512
3 JGI25157J39369_1000414 3300002741 Bacteria 28756
4 rootH2_10144561 3300003320 Bacteria 1589
5 Ga0065712_10031747 3300005290 Bacteria 1222
6 Ga0065707_10003485 3300005295 Bacteria 7336
7 Ga0070676_10018460 3300005328 Bacteria 3866
8 Ga0070690_100011413 3300005330 Bacteria 5194
9 Ga0070690_100011568 3300005330 Bacteria 5165
10 Ga0070670_100182796 3300005331 Unclassified 1821
11 Ga0070670_100446028 3300005331 Unclassified 1146
12 Ga0070677_10128771 3300005333 Unclassified 1153
13 Ga0068869_100026811 3300005334 Bacteria 4013
14 Ga0070680_100044463 3300005336 Bacteria 3609
15 Ga0070682_100206221 3300005337 Bacteria 1390
16 Ga0070689_100003132 3300005340 Bacteria 10937
17 Ga0070689_100003446 3300005340 Bacteria 10519
18 Ga0070689_100181949 3300005340 Unclassified 1708
19 Ga0070689_100260774 3300005340 Bacteria 1432
20 Ga0070687_100001494 3300005343 Bacteria 8254
21 Ga0070692_10047403 3300005345 Unclassified 2224
22 Ga0070669_100021505 3300005353 Bacteria 4610
23 Ga0070669_100029064 3300005353 Bacteria 3983
24 Ga0070675_100088538 3300005354 Bacteria 2591
25 Ga0070675_100372646 3300005354 Bacteria 1269
26 Ga0070673_100006927 3300005364 Bacteria 7415
27 Ga0070673_100013475 3300005364 Bacteria 5658
28 Ga0070688_100001161 3300005365 Bacteria 13117
29 Ga0070688_100217132 3300005365 Unclassified 1346
30 Ga0070667_100029244 3300005367 Bacteria 4590
31 Ga0070667_100422261 3300005367 Unclassified 1216
32 Ga0070703_10031945 3300005406 Unclassified 1596
33 Ga0070708_100004908 3300005445 Bacteria 10565
34 Ga0070708_100005475 3300005445 Bacteria 10066
35 Ga0070663_100106634 3300005455 Bacteria 2099
36 Ga0070678_100007102 3300005456 Bacteria 6623
37 Ga0070662_100071991 3300005457 Bacteria 2551
38 Ga0068867_100013545 3300005459 Bacteria 5775
39 Ga0068867_100033776 3300005459 Bacteria 3706
40 Ga0068867_100160537 3300005459 Unclassified 1772
41 Ga0070685_10003112 3300005466 Bacteria 8432
42 Ga0070685_10033175 3300005466 Unclassified 2898
43 Ga0070706_100001044 3300005467 Bacteria 30033
44 Ga0070706_100047616 3300005467 Bacteria 3956
45 Ga0070706_100128526 3300005467 Bacteria 2363
46 Ga0070707_100000068 3300005468 Bacteria 93489
47 Ga0070707_100002312 3300005468 Bacteria 18213
48 Ga0070707_100030555 3300005468 Bacteria 5130
49 Ga0070707_100109708 3300005468 Bacteria 2676
50 Ga0070707_100165303 3300005468 Bacteria 2156
51 Ga0070698_100000215 3300005471 Bacteria 56437
52 Ga0070698_100000591 3300005471 Bacteria 38984
53 Ga0070698_100072599 3300005471 Bacteria 3449
54 Ga0070698_100097982 3300005471 Bacteria 2907
55 Ga0070698_100116209 3300005471 Bacteria 2639
56 Ga0070699_100008343 3300005518 Bacteria 8980
57 Ga0070679_100208987 3300005530 Bacteria 1916
58 Ga0070697_100000267 3300005536 Bacteria 42474
59 Ga0070697_100002604 3300005536 Bacteria 13883
60 Ga0070697_100023099 3300005536 Bacteria 4945
61 Ga0070697_100053312 3300005536 Bacteria 3287
62 Ga0068853_100025527 3300005539 Bacteria 4959
63 Ga0070672_100008325 3300005543 Bacteria 7086
64 Ga0070664_100000586 3300005564 Bacteria 27743
65 Ga0068852_100061052 3300005616 Bacteria 3275
66 Ga0068859_100003819 3300005617 Bacteria 15383
67 Ga0068859_100189091 3300005617 Bacteria 2143
68 Ga0068864_100181086 3300005618 Bacteria 1927
69 Ga0068864_100236057 3300005618 Unclassified 1693
70 Ga0068861_100013019 3300005719 Bacteria 5814
71 Ga0068863_100131445 3300005841 Bacteria 2390
72 Ga0068858_100006876 3300005842 Bacteria 11055
73 Ga0068860_100094509 3300005843 Bacteria 2849
74 Ga0068862_100312204 3300005844 Unclassified 1449
75 Ga0068862_100371043 3300005844 Bacteria 1332
76 Ga0070717_10004488 3300006028 Bacteria 10081
77 Ga0070716_100045757 3300006173 Bacteria 2459
78 Ga0097621_100248517 3300006237 Bacteria 1557
79 Ga0068871_100297155 3300006358 Bacteria 1417
80 Ga0075428_100001176 3300006844 Bacteria 28020
81 Ga0075428_100122874 3300006844 Bacteria 2826
82 Ga0075428_100150084 3300006844 Bacteria 2532
83 Ga0075428_100182250 3300006844 Bacteria 2273
84 Ga0075430_100003727 3300006846 Bacteria 12809
85 Ga0075431_100003423 3300006847 Bacteria 15391
86 Ga0075433_10012091 3300006852 Bacteria 6963
87 Ga0075434_100024144 3300006871 Bacteria 5941
88 Ga0075429_100001309 3300006880 Bacteria 20298
89 Ga0075429_100154262 3300006880 Bacteria 2011
90 Ga0075436_100443190 3300006914 Unclassified 945
91 Ga0097620_100003818 3300006931 Bacteria 15383
92 Ga0097620_100189101 3300006931 Bacteria 2143
93 Ga0075435_100009256 3300007076 Bacteria 7117
94 Ga0075435_100040794 3300007076 Bacteria 3708
95 Ga0105240_10072293 3300009093 Bacteria 4263
96 Ga0105240_10476340 3300009093 Bacteria 1392
97 Ga0111539_10001803 3300009094 Bacteria 28500
98 Ga0111539_10178365 3300009094 Bacteria 2482
99 Ga0114129_10004424 3300009147 Bacteria 19830
100 Ga0114129_10026658 3300009147 Bacteria 8185
101 Ga0114129_10095498 3300009147 Bacteria 4118
102 Ga0105242_10031956 3300009176 Unclassified 4208
103 Ga0105248_10492475 3300009177 Bacteria 1382
104 Ga0105237_10055218 3300009545 Bacteria 3978
105 Ga0105237_10097396 3300009545 Bacteria 2932
106 Ga0105237_10285009 3300009545 Bacteria 1654
107 Ga0105238_10004448 3300009551 Bacteria 13894
108 Ga0105238_10074885 3300009551 Bacteria 3378
109 Ga0105249_10007475 3300009553 Bacteria 9533
110 Ga0105239_10001114 3300010375 Bacteria 37064
111 Ga0105239_10227551 3300010375 Bacteria 2092
112 Ga0105239_10726312 3300010375 Bacteria 1136
113 Ga0157371_10265419 3300013102 Unclassified 1238
114 Ga0157369_10078201 3300013105 Bacteria 3545
115 Ga0157369_10615484 3300013105 Bacteria 1121
116 Ga0157374_10028436 3300013296 Bacteria 5050
117 Ga0163162_10018689 3300013306 Bacteria 6790
118 Ga0163162_10640895 3300013306 Unclassified 1187
119 Ga0157375_10015819 3300013308 Bacteria 6761
120 Ga0157375_10353850 3300013308 Bacteria 1634
121 Ga0163163_10064460 3300014325 Bacteria 3636
122 Ga0157380_10004523 3300014326 Bacteria 9647
123 Ga0182008_10029425 3300014497 Bacteria 2776
124 Ga0157377_10009798 3300014745 Bacteria 4719
125 Ga0157377_10030987 3300014745 Unclassified 2903
126 Ga0157379_10020603 3300014968 Bacteria 5834
127 Ga0182006_1014511 3300015261 Bacteria 3394
128 Ga0209646_1007270 3300025246 Bacteria 1815
129 Ga0209026_1000005 3300025250 Bacteria 731387
130 Ga0209759_1000106 3300025256 Bacteria 149959
131 Ga0207688_10009700 3300025901 Bacteria 5239
132 Ga0207688_10013100 3300025901 Bacteria 4507
133 Ga0207647_10040103 3300025904 Bacteria 2951
134 Ga0207685_10088866 3300025905 Bacteria 1296
135 Ga0207645_10004483 3300025907 Bacteria 10332
136 Ga0207645_10011778 3300025907 Bacteria 5956
137 Ga0207643_10047846 3300025908 Bacteria 2421
138 Ga0207684_10000007 3300025910 Bacteria 612969
139 Ga0207684_10000253 3300025910 Bacteria 79773
140 Ga0207684_10006872 3300025910 Bacteria 10296
141 Ga0207695_10239765 3300025913 Bacteria 1715
142 Ga0207671_10077578 3300025914 Bacteria 2487
143 Ga0207662_10002100 3300025918 Bacteria 9899
144 Ga0207657_10077366 3300025919 Bacteria 2804
145 Ga0207652_10295871 3300025921 Bacteria 1461
146 Ga0207646_10000082 3300025922 Bacteria 127736
147 Ga0207646_10000291 3300025922 Bacteria 68402
148 Ga0207646_10003096 3300025922 Bacteria 19114
149 Ga0207646_10019985 3300025922 Bacteria 6212
150 Ga0207646_10041179 3300025922 Bacteria 4154
151 Ga0207646_10123791 3300025922 Bacteria 2324
152 Ga0207659_10021607 3300025926 Bacteria 4275
153 Ga0207659_10023947 3300025926 Bacteria 4084
154 Ga0207706_10003603 3300025933 Bacteria 14786
155 Ga0207706_10011411 3300025933 Bacteria 8094
156 Ga0207670_10003021 3300025936 Bacteria 8882
157 Ga0207669_10014909 3300025937 Bacteria 3908
158 Ga0207704_10487757 3300025938 Bacteria 991
159 Ga0207665_10184935 3300025939 Bacteria 1511
160 Ga0207691_10006028 3300025940 Bacteria 11700
161 Ga0207691_10016361 3300025940 Bacteria 7041
162 Ga0207689_10004753 3300025942 Bacteria 12249
163 Ga0207689_10029517 3300025942 Bacteria 4578
164 Ga0207689_10096660 3300025942 Unclassified 2425
165 Ga0207689_10108094 3300025942 Bacteria 2286
166 Ga0207679_10050348 3300025945 Bacteria 3043
167 Ga0207667_10645883 3300025949 Bacteria 1064
168 Ga0207651_10001669 3300025960 Bacteria 10196
169 Ga0207651_10033104 3300025960 Bacteria 3329
170 Ga0207658_10051857 3300025986 Bacteria 3025
171 Ga0207677_10136820 3300026023 Unclassified 1869
172 Ga0207639_10086533 3300026041 Bacteria 2496
173 Ga0207678_10088588 3300026067 Bacteria 2645
174 Ga0207708_10151523 3300026075 Unclassified 1826
175 Ga0207641_10310017 3300026088 Bacteria 1493
176 Ga0207648_10070813 3300026089 Bacteria 3040
177 Ga0207648_10074965 3300026089 Bacteria 2950
178 Ga0207648_10151781 3300026089 Unclassified 2044
179 Ga0207676_10038353 3300026095 Bacteria 3656
180 Ga0207676_10171901 3300026095 Bacteria 1889
181 Ga0207674_10213602 3300026116 Archaea 1878
182 Ga0207675_100009826 3300026118 Bacteria 8956
183 Ga0207675_100062540 3300026118 Bacteria 3476
184 Ga0207683_10076115 3300026121 Bacteria 2971
185 Ga0207698_10067614 3300026142 Bacteria 2818
186 Ga0207428_10007388 3300027907 Bacteria 10019
187 Ga0207428_10050535 3300027907 Bacteria 3326
188 Ga0268265_10286387 3300028380 Unclassified 1477
189 Ga0268265_10537757 3300028380 Bacteria 1107
190 Ga0268264_10106044 3300028381 Bacteria 2452
191 Ga0316576_10001275 3300031727 Bacteria 13373
192 Ga0316577_10003334 3300031733 Bacteria 8097
193 Ga0307407_10270286 3300031903 Unclassified 1173
194 Ga0373949_0009052 3300035090 Bacteria 2182
195 Ga0373932_0016631 3300035112 Bacteria 1879
196 Ga0373932_0063175 3300035112 Unclassified 1131
197 Ga0373939_0020054 3300035114 Bacteria 1811
198 Ga0373924_0058914 3300035410 Bacteria 1603
199 Ga0316584_0007994 3300036712 Bacteria 7261
200 Ga0395900_0089451 3300037418 Bacteria 3165
201 Ga0395905_0084829 3300037471 Bacteria 2968
202 Ga0400483_061174 3300039062 Unclassified 1638
203 Ga0439440_0008130 3300042993 Bacteria 2148
204 Ga0453684_0265424 3300044712 Bacteria 1965
205 Ga0451576_0329119 3300045051 Bacteria 1599
206 Ga0495582_0019807 3300046473 Bacteria 3679
207 Ga0495666_0045698 3300046526 Bacteria 2112
208 Ga0495665_0089941 3300046531 Bacteria 1613
209 Ga0495586_0002868 3300046535 Bacteria 9312
210 Ga0495613_0178111 3300046689 Bacteria 1506
211 Ga0496102_0134954 3300048905 Bacteria 2312
212 Ga0496109_0164878 3300048912 Bacteria 2077
213 Ga0496109_0187661 3300048912 Bacteria 1942
214 Ga0496110_0230614 3300048913 Unclassified 1684
215 Ga0496110_0548865 3300048913 Bacteria 1050
216 Ga0496111_0174876 3300048914 Bacteria 1596
217 Ga0496111_0176516 3300048914 Bacteria 1588
218 Ga0496112_0111387 3300048915 Bacteria 2707
219 Ga0496112_0255185 3300048915 Bacteria 1704
220 Ga0496112_0498778 3300048915 Bacteria 1153
221 Ga0496117_0012639 3300048920 Bacteria 7422
222 Ga0496118_0106383 3300048921 Bacteria 1877
223 Ga0501032_0075610 3300049569 Bacteria 2243
224 Ga0501033_0009581 3300049570 Bacteria 7451
225 Ga0501036_0025085 3300049572 Bacteria 5028
226 Ga0501037_0014497 3300049573 Bacteria 5800
227 Ga0501040_0223006 3300049576 Bacteria 1341
228 Ga0501042_0218649 3300049578 Bacteria 1374
229 Ga0501043_0015986 3300049579 Bacteria 5883
230 Ga0501047_0000024 3300049581 Bacteria 230397
231 Ga0501070_0133811 3300049586 Bacteria 2047
232 Ga0501075_0003170 3300049591 Bacteria 11011
233 Ga0501076_0195928 3300049592 Bacteria 1649
234 Ga0501079_0047132 3300049741 Bacteria 3325
235 Ga0501081_0050350 3300049743 Bacteria 2869
236 Ga0501083_0097810 3300049744 Bacteria 1936
237 Ga0501035_0000005 3300049822 Bacteria 392980
238 Ga0501044_0004809 3300049823 Bacteria 15101
239 Ga0501045_0017977 3300049824 Bacteria 5021
240 nmdc:mga05p37_16052_c1 3300050507 Bacteria 9012
241 nmdc:mga05p37_476540_c1 3300050507 Bacteria 1439
242 nmdc:mga09592_16800_c1 3300050508 Bacteria 5989
243 nmdc:mga09592_953_c1 3300050508 Bacteria 22761
244 nmdc:mga0qj67_110945_c1 3300050509 Bacteria 2214
245 nmdc:mga0qj67_138634_c1 3300050509 Unclassified 1972
246 nmdc:mga0qj67_3037_c1 3300050509 Bacteria 12063
247 nmdc:mga0qj67_9808_c1 3300050509 Bacteria 7137
248 nmdc:mga06r32_162502_c1 3300050510 Bacteria 2215
249 nmdc:mga06r32_177805_c1 3300050510 Bacteria 2113
250 nmdc:mga06r32_22831_c1 3300050510 Bacteria 5787
251 nmdc:mga06r32_299594_c1 3300050510 Bacteria 1594
252 nmdc:mga08y16_14206_c1 3300050511 Bacteria 8380
253 nmdc:mga08y16_143507_c1 3300050511 Bacteria 2482
254 nmdc:mga08y16_41112_c1 3300050511 Bacteria 4844
255 nmdc:mga0n895_8364_c1 3300050512 Bacteria 8954
256 nmdc:mga0rr50_41348_c1 3300050513 Bacteria 3358
257 nmdc:mga0a205_15798_c1 3300050515 Bacteria 7059
258 nmdc:mga0a205_644_c1 3300050515 Bacteria 27689
259 2856364910 2856364286 Bacteria 6939991
260 2857354834 2857349434 Bacteria 7926032
261 2869289641 2869285874 Bacteria 6901219
262 2871431707 2871429161 Bacteria 6547891
263 2874155385 2874146452 Bacteria 7533118
264 2874162242 2874155637 Bacteria 6724144
265 2876420730 2876413966 Bacteria 6831344
266 2878748313 2878745973 Bacteria 6867388
267 2888350905 2888350351 Bacteria 7372807
268 2889013252 2889010040 Bacteria 6749192
269 2889021900 2889016732 Bacteria 6700763
270 2903505990 2903492973 Bacteria 13473544
271 2906311930 2906308376 Bacteria 6841989
272 2906323667 2906321335 Bacteria 6579571
273 2922138133 2922130491 Bacteria 7173936
274 2922191252 2922185730 Bacteria 7113964
275 2937818248 2937813078 Bacteria 7783518
276 2958053695 2958041894 Bacteria 13082850
277 2958101119 2958100919 Bacteria 6800575
278 2958134014 2958130278 Bacteria 6897202
279 2958172720 2958172287 Bacteria 6716688
280 2958183660 2958179912 Bacteria 6874908
281 2961081626 2961077736 Bacteria 7079850
282 2965124928 2965119406 Bacteria 6956431
283 2968118580 2968117919 Bacteria 6536078
284 2977851343 2977843712 Bacteria 6753583
285 2977946617 2977942078 Bacteria 7570577
286 2979710472 2979710463 Bacteria 6785254
287 2979743095 2979742915 Bacteria 7301278
288 2987643436 2987636660 Bacteria 8088555
289 3000142097 3000135777 Bacteria 6891109
290 3004206982 3004203850 Bacteria 7307914
291 3004339138 3004334049 Bacteria 8449246
292 8004391519 8004387939 Bacteria 7049250
293 8004646112 8004640170 Bacteria 6723001
294 8004716888 8004714634 Bacteria 6776161
295 Ga0070674_100002680
296 JGI25156J39149_1000839
297 JGI25157J39369_1000414
298 rootH2_10144561
299 Ga0065712_10031747
300 Ga0065707_10003485
301 Ga0070676_10018460
302 Ga0070690_100011413
303 Ga0070690_100011568
304 Ga0070670_100182796
305 Ga0070670_100446028
306 Ga0070677_10128771
307 Ga0068869_100026811
308 Ga0070680_100044463
309 Ga0070682_100206221
310 Ga0070689_100003132
311 Ga0070689_100003446
312 Ga0070689_100181949
313 Ga0070689_100260774
314 Ga0070687_100001494
315 Ga0070692_10047403
316 Ga0070669_100021505
317 Ga0070669_100029064
318 Ga0070675_100088538
319 Ga0070675_100372646
320 Ga0070673_100006927
321 Ga0070673_100013475
322 Ga0070688_100001161
323 Ga0070688_100217132
324 Ga0070667_100029244
325 Ga0070667_100422261
326 Ga0070703_10031945
327 Ga0070708_100004908
328 Ga0070708_100005475
329 Ga0070663_100106634
330 Ga0070678_100007102
331 Ga0070662_100071991
332 Ga0068867_100013545
333 Ga0068867_100033776
334 Ga0068867_100160537
335 Ga0070685_10003112
336 Ga0070685_10033175
337 Ga0070706_100001044
338 Ga0070706_100047616
339 Ga0070706_100128526
340 Ga0070707_100000068
341 Ga0070707_100002312
342 Ga0070707_100030555
343 Ga0070707_100109708
344 Ga0070707_100165303
345 Ga0070698_100000215
346 Ga0070698_100000591
347 Ga0070698_100072599
348 Ga0070698_100097982
349 Ga0070698_100116209
350 Ga0070699_100008343
351 Ga0070679_100208987
352 Ga0070697_100000267
353 Ga0070697_100002604
354 Ga0070697_100023099
355 Ga0070697_100053312
356 Ga0068853_100025527
357 Ga0070672_100008325
358 Ga0070664_100000586
359 Ga0068852_100061052
360 Ga0068859_100003819
361 Ga0068859_100189091
362 Ga0068864_100181086
363 Ga0068864_100236057
364 Ga0068861_100013019
365 Ga0068863_100131445
366 Ga0068858_100006876
367 Ga0068860_100094509
368 Ga0068862_100312204
369 Ga0068862_100371043
370 Ga0070717_10004488
371 Ga0070716_100045757
372 Ga0097621_100248517
373 Ga0068871_100297155
374 Ga0075428_100001176
375 Ga0075428_100122874
376 Ga0075428_100150084
377 Ga0075428_100182250
378 Ga0075430_100003727
379 Ga0075431_100003423
380 Ga0075433_10012091
381 Ga0075434_100024144
382 Ga0075429_100001309
383 Ga0075429_100154262
384 Ga0075436_100443190
385 Ga0097620_100003818
386 Ga0097620_100189101
387 Ga0075435_100009256
388 Ga0075435_100040794
389 Ga0105240_10072293
390 Ga0105240_10476340
391 Ga0111539_10001803
392 Ga0111539_10178365
393 Ga0114129_10004424
394 Ga0114129_10026658
395 Ga0114129_10095498
396 Ga0105242_10031956
397 Ga0105248_10492475
398 Ga0105237_10055218
399 Ga0105237_10097396
400 Ga0105237_10285009
401 Ga0105238_10004448
402 Ga0105238_10074885
403 Ga0105249_10007475
404 Ga0105239_10001114
405 Ga0105239_10227551
406 Ga0105239_10726312
407 Ga0157371_10265419
408 Ga0157369_10078201
409 Ga0157369_10615484
410 Ga0157374_10028436
411 Ga0163162_10018689
412 Ga0163162_10640895
413 Ga0157375_10015819
414 Ga0157375_10353850
415 Ga0163163_10064460
416 Ga0157380_10004523
417 Ga0182008_10029425
418 Ga0157377_10009798
419 Ga0157377_10030987
420 Ga0157379_10020603
421 Ga0182006_1014511
422 Ga0209646_1007270
423 Ga0209026_1000005
424 Ga0209759_1000106
425 Ga0207688_10009700
426 Ga0207688_10013100
427 Ga0207647_10040103
428 Ga0207685_10088866
429 Ga0207645_10004483
430 Ga0207645_10011778
431 Ga0207643_10047846
432 Ga0207684_10000007
433 Ga0207684_10000253
434 Ga0207684_10006872
435 Ga0207695_10239765
436 Ga0207671_10077578
437 Ga0207662_10002100
438 Ga0207657_10077366
439 Ga0207652_10295871
440 Ga0207646_10000082
441 Ga0207646_10000291
442 Ga0207646_10003096
443 Ga0207646_10019985
444 Ga0207646_10041179
445 Ga0207646_10123791
446 Ga0207659_10021607
447 Ga0207659_10023947
448 Ga0207706_10003603
449 Ga0207706_10011411
450 Ga0207670_10003021
451 Ga0207669_10014909
452 Ga0207704_10487757
453 Ga0207665_10184935
454 Ga0207691_10006028
455 Ga0207691_10016361
456 Ga0207689_10004753
457 Ga0207689_10029517
458 Ga0207689_10096660
459 Ga0207689_10108094
460 Ga0207679_10050348
461 Ga0207667_10645883
462 Ga0207651_10001669
463 Ga0207651_10033104
464 Ga0207658_10051857
465 Ga0207677_10136820
466 Ga0207639_10086533
467 Ga0207678_10088588
468 Ga0207708_10151523
469 Ga0207641_10310017
470 Ga0207648_10070813
471 Ga0207648_10074965
472 Ga0207648_10151781
473 Ga0207676_10038353
474 Ga0207676_10171901
475 Ga0207674_10213602
476 Ga0207675_100009826
477 Ga0207675_100062540
478 Ga0207683_10076115
479 Ga0207698_10067614
480 Ga0207428_10007388
481 Ga0207428_10050535
482 Ga0268265_10286387
483 Ga0268265_10537757
484 Ga0268264_10106044
485 Ga0316576_10001275
486 Ga0316577_10003334
487 Ga0307407_10270286
488 Ga0373949_0009052
489 Ga0373932_0016631
490 Ga0373932_0063175
491 Ga0373939_0020054
492 Ga0373924_0058914
493 Ga0316584_0007994
494 Ga0395900_0089451
495 Ga0395905_0084829
496 Ga0400483_061174
497 Ga0439440_0008130
498 Ga0453684_0265424
499 Ga0451576_0329119
500 Ga0495582_0019807
501 Ga0495666_0045698
502 Ga0495665_0089941
503 Ga0495586_0002868
504 Ga0495613_0178111
505 Ga0496102_0134954
506 Ga0496109_0164878
507 Ga0496109_0187661
508 Ga0496110_0230614
509 Ga0496110_0548865
510 Ga0496111_0174876
511 Ga0496111_0176516
512 Ga0496112_0111387
513 Ga0496112_0255185
514 Ga0496112_0498778
515 Ga0496117_0012639
516 Ga0496118_0106383
517 Ga0501032_0075610
518 Ga0501033_0009581
519 Ga0501036_0025085
520 Ga0501037_0014497
521 Ga0501040_0223006
522 Ga0501042_0218649
523 Ga0501043_0015986
524 Ga0501047_0000024
525 Ga0501070_0133811
526 Ga0501075_0003170
527 Ga0501076_0195928
528 Ga0501079_0047132
529 Ga0501081_0050350
530 Ga0501083_0097810
531 Ga0501035_0000005
532 Ga0501044_0004809
533 Ga0501045_0017977
534 nmdc:mga05p37_16052_c1
535 nmdc:mga05p37_476540_c1
536 nmdc:mga09592_16800_c1
537 nmdc:mga09592_953_c1
538 nmdc:mga0qj67_110945_c1
539 nmdc:mga0qj67_138634_c1
540 nmdc:mga0qj67_3037_c1
541 nmdc:mga0qj67_9808_c1
542 nmdc:mga06r32_162502_c1
543 nmdc:mga06r32_177805_c1
544 nmdc:mga06r32_22831_c1
545 nmdc:mga06r32_299594_c1
546 nmdc:mga08y16_14206_c1
547 nmdc:mga08y16_143507_c1
548 nmdc:mga08y16_41112_c1
549 nmdc:mga0n895_8364_c1
550 nmdc:mga0rr50_41348_c1
551 nmdc:mga0a205_15798_c1
552 nmdc:mga0a205_644_c1
553 2856364910
554 2857354834
555 2869289641
556 2871431707
557 2874155385
558 2874162242
559 2876420730
560 2878748313
561 2888350905
562 2889013252
563 2889021900
564 2903505990
565 2906311930
566 2906323667
567 2922138133
568 2922191252
569 2937818248
570 2958053695
571 2958101119
572 2958134014
573 2958172720
574 2958183660
575 2961081626
576 2965124928
577 2968118580
578 2977851343
579 2977946617
580 2979710472
581 2979743095
582 2987643436
583 3000142097
584 3004206982
585 3004339138
586 8004391519
587 8004646112
588 8004716888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

24

256

0.95

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

25

321

0.92

PF04321

RmlD_sub_bind

RmlD substrate binding domain

22

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kj9-assembly1.cif.gz_B crystal structure of purt-encoded glycinamide ribonucleotide transformylase complexed with mg-atp 0.804 1 72
1kjj-assembly1.cif.gz_B crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s 0.8028 1 72
1kji-assembly1.cif.gz_B crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp 0.8025 1 72
1kj8-assembly1.cif.gz_B crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar 0.8012 1 71
1kjj-assembly1.cif.gz_A crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s 0.7961 1 71
ID Description Score Start End Superfamily
2pk3B02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9318 167 302 3.90.25.10
2pk3B02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9116 167 302 3.90.25.10
af_Q8C7K6_26_328_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.888 2 35 3.50.50.60
1rpnA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8693 167 307 3.90.25.10
1rpnA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8605 167 307 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A3S3TB33-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9899 1 108 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A3S1PW90-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9892 142 307
AF-A0A4S0LJF8-F1-model_v4 deleted 0.9844 1 78
AF-A0A537VEM8-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9836 153 303
AF-A0A2H9QFL6-F1-model_v4 GDP-mannose 4,6-dehydratase 0.9821 170 305

Map