F391919

General Info

Members Datasets Scaffolds Average Seq Length
294 213 588 209

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100395038|Ga0070689_1003950382
Length 201
Sequence VGVITKVHVLRHGEVHNPEGILYGRLPGYRLSDRGQAQDNDIVTVIASPLQRAQETAGPVAGLHGLPIVTDDRLIEAGNSFEGKRVSVGDGALRSPRYWWLLRDPFTPSWGEPYLEIAERMLAAVHRARELAFGHEALCVSHQLPIWTLRRYVTGRHLWHDPRRRQCALASLTSLVFDGDELVQLRYTEPAGRSDPTQTGA

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 2582580736 Prauserella sp. Am3 Isolate Unclassified
201 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
202 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
203 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
204 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
205 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
206 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
207 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
208 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
209 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
210 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
211 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
212 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
213 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0
Isolates 4.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 5.78
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100395038 3300005340 Bacteria 1168
2 Ga0070670_100315916 3300005331 Bacteria 1368
3 Ga0068868_100051984 3300005338 Bacteria 3225
4 Ga0070687_100273242 3300005343 Bacteria 1060
5 Ga0070668_100023950 3300005347 Bacteria 4623
6 Ga0070671_100025855 3300005355 Bacteria 4820
7 Ga0070674_100418952 3300005356 Bacteria 1098
8 Ga0070674_100452661 3300005356 Bacteria 1060
9 Ga0070673_100299176 3300005364 Bacteria 1416
10 Ga0070667_100003861 3300005367 Bacteria 12729
11 Ga0070714_100000010 3300005435 Bacteria 262871
12 Ga0070714_100005981 3300005435 Bacteria 9338
13 Ga0070714_100062406 3300005435 Bacteria 3203
14 Ga0070714_100186204 3300005435 Bacteria 1892
15 Ga0070714_100796632 3300005435 Bacteria 915
16 Ga0070713_100025645 3300005436 Bacteria 4613
17 Ga0070713_100157565 3300005436 Bacteria 2025
18 Ga0070711_100269751 3300005439 Bacteria 1342
19 Ga0070685_10133628 3300005466 Bacteria 1554
20 Ga0070706_100140843 3300005467 Bacteria 2251
21 Ga0068853_100177411 3300005539 Bacteria 1931
22 Ga0070686_100380926 3300005544 Bacteria 1068
23 Ga0070665_100000401 3300005548 Bacteria 63343
24 Ga0070665_100009653 3300005548 Bacteria 9759
25 Ga0068855_100571545 3300005563 Bacteria 1222
26 Ga0068855_100929435 3300005563 Bacteria 917
27 Ga0068854_100061046 3300005578 Bacteria 2729
28 Ga0068854_101025573 3300005578 Bacteria 732
29 Ga0068852_100250476 3300005616 Bacteria 1697
30 Ga0068859_100469507 3300005617 Bacteria 1354
31 Ga0068861_100277495 3300005719 Bacteria 1442
32 Ga0068863_100013165 3300005841 Bacteria 7982
33 Ga0068863_100092877 3300005841 Bacteria 2863
34 Ga0068858_100011913 3300005842 Bacteria 8196
35 Ga0068860_100000114 3300005843 Bacteria 128789
36 Ga0068860_100577072 3300005843 Bacteria 1128
37 Ga0070717_10037923 3300006028 Bacteria 3915
38 Ga0070717_10477742 3300006028 Bacteria 1125
39 Ga0075365_10253477 3300006038 Bacteria 1237
40 Ga0075365_10284464 3300006038 Bacteria 1164
41 Ga0075368_10038603 3300006042 Bacteria 1870
42 Ga0075363_100088292 3300006048 Bacteria 1704
43 Ga0075364_10009677 3300006051 Bacteria 5792
44 Ga0070712_100261789 3300006175 Bacteria 1386
45 Ga0075362_10269170 3300006177 Bacteria 841
46 Ga0075369_10042063 3300006186 Bacteria 1958
47 Ga0075369_10096286 3300006186 Bacteria 1325
48 Ga0097620_100469439 3300006931 Bacteria 1354
49 Ga0099795_10082193 3300007788 Bacteria 1234
50 Ga0105240_10655765 3300009093 Bacteria 1150
51 Ga0105245_10026260 3300009098 Bacteria 5125
52 Ga0105243_10017022 3300009148 Bacteria 5496
53 Ga0105248_10000889 3300009177 Bacteria 33435
54 Ga0105237_10229507 3300009545 Bacteria 1857
55 Ga0105238_10057780 3300009551 Bacteria 3889
56 Ga0099796_10068453 3300010159 Bacteria 1276
57 Ga0105239_11508328 3300010375 Bacteria 777
58 Ga0157374_10067285 3300013296 Bacteria 3368
59 Ga0163162_10373939 3300013306 Bacteria 1558
60 Ga0157372_11286301 3300013307 Bacteria 844
61 Ga0157375_10382596 3300013308 Bacteria 1574
62 Ga0163163_10031191 3300014325 Bacteria 5143
63 Ga0163163_10048524 3300014325 Bacteria 4175
64 Ga0163163_10803010 3300014325 Bacteria 1004
65 Ga0157380_10062044 3300014326 Bacteria 2993
66 Ga0157380_10401116 3300014326 Bacteria 1301
67 Ga0157377_10154471 3300014745 Bacteria 1422
68 Ga0157379_10001031 3300014968 Bacteria 22615
69 Ga0213873_10000034 3300021358 Bacteria 35843
70 Ga0213876_10037919 3300021384 Bacteria 2542
71 Ga0213876_10050381 3300021384 Bacteria 2200
72 Ga0213875_10001286 3300021388 Bacteria 16762
73 Ga0207642_10225549 3300025899 Bacteria 1049
74 Ga0207647_10198543 3300025904 Bacteria 1161
75 Ga0207695_10063682 3300025913 Bacteria 3800
76 Ga0207662_10177268 3300025918 Bacteria 1370
77 Ga0207650_10329234 3300025925 Bacteria 1252
78 Ga0207700_10016772 3300025928 Bacteria 4876
79 Ga0207700_10065705 3300025928 Bacteria 2769
80 Ga0207664_10000009 3300025929 Bacteria 299246
81 Ga0207664_10054432 3300025929 Bacteria 3170
82 Ga0207664_10127120 3300025929 Bacteria 2141
83 Ga0207644_10059347 3300025931 Bacteria 2767
84 Ga0207669_10057003 3300025937 Bacteria 2376
85 Ga0207665_10217539 3300025939 Bacteria 1398
86 Ga0207711_10001041 3300025941 Bacteria 26508
87 Ga0207667_10427624 3300025949 Bacteria 1347
88 Ga0207667_10673202 3300025949 Bacteria 1039
89 Ga0207668_10091189 3300025972 Bacteria 2239
90 Ga0207640_10463046 3300025981 Bacteria 1048
91 Ga0207658_10018143 3300025986 Bacteria 4854
92 Ga0207658_10036114 3300025986 Bacteria 3542
93 Ga0207658_10472174 3300025986 Bacteria 1113
94 Ga0207677_10235709 3300026023 Bacteria 1477
95 Ga0207703_10000089 3300026035 Bacteria 105959
96 Ga0207703_10011875 3300026035 Bacteria 6781
97 Ga0207639_10129791 3300026041 Bacteria 2085
98 Ga0207639_10349760 3300026041 Bacteria 1320
99 Ga0207678_10147021 3300026067 Bacteria 2012
100 Ga0207702_10732224 3300026078 Bacteria 976
101 Ga0207641_10009537 3300026088 Bacteria 7997
102 Ga0207676_10154230 3300026095 Bacteria 1982
103 Ga0207683_10020508 3300026121 Bacteria 5653
104 Ga0207698_10120139 3300026142 Bacteria 2222
105 Ga0207698_10264388 3300026142 Bacteria 1582
106 Ga0268266_10001585 3300028379 Bacteria 26567
107 Ga0268266_10012908 3300028379 Bacteria 7208
108 Ga0307511_10011503 3300030521 Bacteria 8723
109 Ga0265327_10000624 3300031251 Bacteria 58153
110 Ga0265327_10034455 3300031251 Bacteria 2809
111 Ga0316576_10431997 3300031727 Bacteria 974
112 Ga0316578_10054142 3300031728 Bacteria 2353
113 Ga0307413_10011436 3300031824 Bacteria 4365
114 Ga0307413_10013305 3300031824 Bacteria 4132
115 Ga0307518_10080358 3300031838 Bacteria 2354
116 Ga0307410_10119385 3300031852 Bacteria 1920
117 Ga0307412_10249344 3300031911 Bacteria 1378
118 Ga0307409_100007792 3300031995 Bacteria 6441
119 Ga0307416_101527846 3300032002 Bacteria 773
120 Ga0307415_100753801 3300032126 Bacteria 884
121 Ga0373954_0079707 3300035118 Bacteria 1563
122 Ga0373943_0104097 3300035170 Bacteria 1488
123 Ga0373946_0278916 3300035171 Bacteria 821
124 Ga0316574_0095658 3300035398 Bacteria 1898
125 Ga0373924_0092151 3300035410 Bacteria 1297
126 Ga0373947_0165171 3300035725 Bacteria 1433
127 Ga0373947_0453615 3300035725 Bacteria 869
128 Ga0316584_0044306 3300036712 Bacteria 3318
129 Ga0436364_0512751 3300037853 Bacteria 53348
130 Ga0436364_1345366 3300037853 Bacteria 13884
131 Ga0436365_0492555 3300039437 Bacteria 5021
132 Ga0436365_0739565 3300039437 Bacteria 50915
133 Ga0436365_1823049 3300039437 Bacteria 2383
134 Ga0436362_0499321 3300039453 Bacteria 55143
135 Ga0439465_0005194 3300041413 Bacteria 4175
136 Ga0451841_0155974 3300041498 Bacteria 758
137 Ga0451853_3235816 3300041512 Bacteria 1609
138 Ga0439449_0047639 3300042007 Bacteria 1587
139 Ga0439449_0160535 3300042007 Bacteria 839
140 Ga0466969_0004839 3300044656 Bacteria 7167
141 Ga0466972_0160872 3300044658 Bacteria 1055
142 Ga0466965_0017945 3300044683 Bacteria 3386
143 Ga0466965_0238189 3300044683 Bacteria 974
144 Ga0466966_0001859 3300044684 Bacteria 13697
145 Ga0466966_0004214 3300044684 Bacteria 9490
146 Ga0466961_0002770 3300044693 Bacteria 10909
147 Ga0466963_0001299 3300044694 Bacteria 13271
148 Ga0466971_0001862 3300044719 Bacteria 8980
149 Ga0466968_0000508 3300044735 Bacteria 13208
150 Ga0466968_0127771 3300044735 Bacteria 1154
151 Ga0466970_0014201 3300044765 Bacteria 4085
152 Ga0466970_0122253 3300044765 Bacteria 1426
153 Ga0466970_0368904 3300044765 Bacteria 816
154 Ga0466957_0007701 3300044842 Bacteria 6090
155 Ga0466957_0090633 3300044842 Bacteria 1915
156 Ga0466960_0000218 3300044901 Bacteria 19846
157 Ga0466959_0007060 3300045049 Bacteria 7850
158 Ga0466958_0000116 3300045836 Bacteria 25851
159 Ga0466958_0485698 3300045836 Bacteria 801
160 Ga0466967_0002704 3300045976 Bacteria 11204
161 Ga0466967_0007673 3300045976 Bacteria 7812
162 Ga0466967_0121203 3300045976 Bacteria 2416
163 Ga0466967_0121486 3300045976 Bacteria 2414
164 Ga0466967_0556658 3300045976 Bacteria 1129
165 Ga0466967_0804969 3300045976 Bacteria 933
166 Ga0495603_0127473 3300046455 Bacteria 1483
167 Ga0495629_0007904 3300046459 Bacteria 7825
168 Ga0495641_0144279 3300046461 Bacteria 1064
169 Ga0495641_0191628 3300046461 Bacteria 916
170 Ga0495651_0003435 3300046462 Bacteria 12152
171 Ga0495653_0003712 3300046463 Bacteria 12345
172 Ga0495653_0158213 3300046463 Bacteria 1576
173 Ga0495580_0050020 3300046472 Bacteria 2956
174 Ga0495662_0023863 3300046476 Bacteria 2953
175 Ga0495664_0003682 3300046477 Bacteria 8351
176 Ga0495608_0008759 3300046511 Bacteria 7077
177 Ga0495608_0049791 3300046511 Bacteria 2781
178 Ga0495628_0027738 3300046516 Bacteria 4602
179 Ga0495630_0183581 3300046517 Bacteria 1595
180 Ga0495666_0003132 3300046526 Bacteria 8313
181 Ga0495652_0119846 3300046529 Bacteria 2100
182 Ga0495665_0003885 3300046531 Bacteria 8081
183 Ga0495665_0095617 3300046531 Bacteria 1560
184 Ga0495665_0148423 3300046531 Bacteria 1224
185 Ga0495640_0027821 3300046533 Bacteria 4073
186 Ga0495640_0215722 3300046533 Bacteria 1211
187 Ga0495586_0023210 3300046535 Bacteria 3312
188 Ga0495586_0059478 3300046535 Bacteria 2076
189 Ga0495587_0108517 3300046536 Bacteria 1595
190 Ga0495645_0076157 3300046543 Bacteria 2414
191 Ga0495667_0010350 3300046559 Bacteria 6310
192 Ga0495634_0044176 3300046642 Bacteria 3016
193 Ga0495657_0010002 3300046675 Bacteria 7155
194 Ga0495657_0033497 3300046675 Bacteria 3576
195 Ga0495599_0056229 3300046678 Bacteria 2462
196 Ga0495623_0118612 3300046679 Bacteria 1595
197 Ga0495623_0177203 3300046679 Bacteria 1241
198 Ga0495646_0089125 3300046680 Bacteria 1785
199 Ga0495646_0248562 3300046680 Bacteria 953
200 Ga0495647_0089134 3300046681 Bacteria 1262
201 Ga0495658_0014166 3300046683 Bacteria 4068
202 Ga0495613_0009072 3300046689 Bacteria 7377
203 Ga0495649_0077487 3300046694 Bacteria 1779
204 Ga0495600_0056887 3300046809 Bacteria 2555
205 Ga0495581_0391028 3300047315 Bacteria 811
206 Ga0495604_0009645 3300047317 Bacteria 7633
207 Ga0495604_0015848 3300047317 Bacteria 6017
208 Ga0495674_0026209 3300047319 Bacteria 5336
209 Ga0495674_0103130 3300047319 Bacteria 2425
210 Ga0495674_0237527 3300047319 Bacteria 1503
211 Ga0495676_0169582 3300047321 Bacteria 1537
212 Ga0495676_0443050 3300047321 Bacteria 857
213 Ga0495680_0465630 3300047322 Bacteria 863
214 Ga0495675_0002957 3300047444 Bacteria 10205
215 Ga0495675_0043781 3300047444 Bacteria 2852
216 Ga0495675_0101087 3300047444 Bacteria 1804
217 Ga0495684_0080034 3300047471 Bacteria 2480
218 Ga0495593_0023107 3300047673 Bacteria 3459
219 Ga0495602_0047229 3300048088 Bacteria 3881
220 Ga0496100_0095424 3300048903 Bacteria 2039
221 Ga0496101_0104863 3300048904 Bacteria 2121
222 Ga0496101_0376852 3300048904 Bacteria 1116
223 Ga0496102_1001972 3300048905 Bacteria 756
224 Ga0496104_0529563 3300048907 Bacteria 1089
225 Ga0496105_0300181 3300048908 Bacteria 1291
226 Ga0496106_0674712 3300048909 Bacteria 825
227 Ga0496107_0011240 3300048910 Bacteria 6231
228 Ga0496107_0276576 3300048910 Bacteria 1250
229 Ga0496107_0373770 3300048910 Bacteria 1060
230 Ga0496108_0173552 3300048911 Bacteria 1866
231 Ga0496109_0450322 3300048912 Bacteria 1216
232 Ga0496109_0710085 3300048912 Bacteria 943
233 Ga0496110_0903341 3300048913 Bacteria 789
234 Ga0496110_0922774 3300048913 Bacteria 779
235 Ga0496113_0500322 3300048916 Bacteria 976
236 Ga0496114_0002107 3300048917 Bacteria 15111
237 Ga0496123_0030331 3300048926 Bacteria 3960
238 Ga0501032_0079701 3300049569 Bacteria 2180
239 Ga0501033_0017409 3300049570 Bacteria 5429
240 Ga0501034_0022894 3300049571 Bacteria 6365
241 Ga0501034_0221384 3300049571 Bacteria 1845
242 Ga0501034_1068460 3300049571 Bacteria 689
243 Ga0501037_0090226 3300049573 Bacteria 2217
244 Ga0501038_0027011 3300049574 Bacteria 5109
245 Ga0501043_0045767 3300049579 Bacteria 3441
246 Ga0501043_0460959 3300049579 Bacteria 954
247 Ga0501046_0099174 3300049580 Bacteria 2236
248 Ga0501047_0000216 3300049581 Bacteria 69275
249 Ga0501047_0046413 3300049581 Bacteria 4198
250 Ga0501047_0153048 3300049581 Bacteria 2181
251 Ga0501048_0155752 3300049582 Bacteria 1616
252 Ga0501048_0468781 3300049582 Bacteria 902
253 Ga0501070_0320463 3300049586 Bacteria 1261
254 Ga0501073_0250338 3300049589 Bacteria 1223
255 Ga0501074_0173711 3300049590 Bacteria 1538
256 Ga0501035_0000602 3300049822 Bacteria 39639
257 Ga0501035_0414994 3300049822 Bacteria 1118
258 Ga0501044_0424832 3300049823 Bacteria 1239
259 nmdc:mga03683_192293_c1 3300050489 Bacteria 934
260 nmdc:mga03n38_27234_c1 3300050490 Bacteria 2369
261 nmdc:mga00v17_15368_c1 3300050491 Bacteria 4296
262 nmdc:mga00v17_289437_c1 3300050491 Bacteria 1064
263 nmdc:mga0yw44_353737_c1 3300050492 Bacteria 989
264 nmdc:mga0yw44_49040_c1 3300050492 Bacteria 2547
265 nmdc:mga04h51_126687_c1 3300050495 Bacteria 956
266 nmdc:mga09592_183675_c1 3300050508 Bacteria 1809
267 nmdc:mga0qj67_50923_c1 3300050509 Bacteria 3274
268 nmdc:mga06r32_219935_c1 3300050510 Bacteria 1888
269 nmdc:mga06r32_510424_c1 3300050510 Bacteria 1179
270 nmdc:mga0sz30_18341_c1 3300050516 Bacteria 2800
271 nmdc:mga0sz30_77096_c1 3300050516 Bacteria 1439
272 Ga0495601_0007642 3300053077 Bacteria 6351
273 Ga0495595_0316163 3300053084 Bacteria 786
274 Ga0495619_0020675 3300053085 Bacteria 4196
275 Ga0495619_0082655 3300053085 Bacteria 2165
276 Ga0500643_033320 3300053087 Bacteria 1558
277 Ga0500627_0030306 3300053158 Bacteria 2264
278 Ga0500645_031996 3300053730 Bacteria 1579
279 Ga0466962_0000566 3300061719 Bacteria 16241
280 Ga0466962_0011231 3300061719 Bacteria 4312
281 2583148867 2582580736 Bacteria 5325865
282 2644014597 2643221601 Bacteria 7493239
283 2644176032 2643221631 Bacteria 8168043
284 2644455784 2643221681 Bacteria 3707866
285 2776371603 2775506925 Bacteria 7237746
286 2819742151 2818991472 Bacteria 10089953
287 2862706456 2862705112 Bacteria 6563286
288 2863070183 2863067949 Bacteria 8541735
289 2866555712 2866552031 Bacteria 5824618
290 2870788413 2870782633 Bacteria 9624083
291 8008488719 8008485437 Bacteria 7198341
292 8025529478 8025524527 Bacteria 7197316
293 8047718430 8047710418 Bacteria 11023148
294 8056210975 8056207758 Bacteria 8639239
295 Ga0070689_100395038
296 Ga0070670_100315916
297 Ga0068868_100051984
298 Ga0070687_100273242
299 Ga0070668_100023950
300 Ga0070671_100025855
301 Ga0070674_100418952
302 Ga0070674_100452661
303 Ga0070673_100299176
304 Ga0070667_100003861
305 Ga0070714_100000010
306 Ga0070714_100005981
307 Ga0070714_100062406
308 Ga0070714_100186204
309 Ga0070714_100796632
310 Ga0070713_100025645
311 Ga0070713_100157565
312 Ga0070711_100269751
313 Ga0070685_10133628
314 Ga0070706_100140843
315 Ga0068853_100177411
316 Ga0070686_100380926
317 Ga0070665_100000401
318 Ga0070665_100009653
319 Ga0068855_100571545
320 Ga0068855_100929435
321 Ga0068854_100061046
322 Ga0068854_101025573
323 Ga0068852_100250476
324 Ga0068859_100469507
325 Ga0068861_100277495
326 Ga0068863_100013165
327 Ga0068863_100092877
328 Ga0068858_100011913
329 Ga0068860_100000114
330 Ga0068860_100577072
331 Ga0070717_10037923
332 Ga0070717_10477742
333 Ga0075365_10253477
334 Ga0075365_10284464
335 Ga0075368_10038603
336 Ga0075363_100088292
337 Ga0075364_10009677
338 Ga0070712_100261789
339 Ga0075362_10269170
340 Ga0075369_10042063
341 Ga0075369_10096286
342 Ga0097620_100469439
343 Ga0099795_10082193
344 Ga0105240_10655765
345 Ga0105245_10026260
346 Ga0105243_10017022
347 Ga0105248_10000889
348 Ga0105237_10229507
349 Ga0105238_10057780
350 Ga0099796_10068453
351 Ga0105239_11508328
352 Ga0157374_10067285
353 Ga0163162_10373939
354 Ga0157372_11286301
355 Ga0157375_10382596
356 Ga0163163_10031191
357 Ga0163163_10048524
358 Ga0163163_10803010
359 Ga0157380_10062044
360 Ga0157380_10401116
361 Ga0157377_10154471
362 Ga0157379_10001031
363 Ga0213873_10000034
364 Ga0213876_10037919
365 Ga0213876_10050381
366 Ga0213875_10001286
367 Ga0207642_10225549
368 Ga0207647_10198543
369 Ga0207695_10063682
370 Ga0207662_10177268
371 Ga0207650_10329234
372 Ga0207700_10016772
373 Ga0207700_10065705
374 Ga0207664_10000009
375 Ga0207664_10054432
376 Ga0207664_10127120
377 Ga0207644_10059347
378 Ga0207669_10057003
379 Ga0207665_10217539
380 Ga0207711_10001041
381 Ga0207667_10427624
382 Ga0207667_10673202
383 Ga0207668_10091189
384 Ga0207640_10463046
385 Ga0207658_10018143
386 Ga0207658_10036114
387 Ga0207658_10472174
388 Ga0207677_10235709
389 Ga0207703_10000089
390 Ga0207703_10011875
391 Ga0207639_10129791
392 Ga0207639_10349760
393 Ga0207678_10147021
394 Ga0207702_10732224
395 Ga0207641_10009537
396 Ga0207676_10154230
397 Ga0207683_10020508
398 Ga0207698_10120139
399 Ga0207698_10264388
400 Ga0268266_10001585
401 Ga0268266_10012908
402 Ga0307511_10011503
403 Ga0265327_10000624
404 Ga0265327_10034455
405 Ga0316576_10431997
406 Ga0316578_10054142
407 Ga0307413_10011436
408 Ga0307413_10013305
409 Ga0307518_10080358
410 Ga0307410_10119385
411 Ga0307412_10249344
412 Ga0307409_100007792
413 Ga0307416_101527846
414 Ga0307415_100753801
415 Ga0373954_0079707
416 Ga0373943_0104097
417 Ga0373946_0278916
418 Ga0316574_0095658
419 Ga0373924_0092151
420 Ga0373947_0165171
421 Ga0373947_0453615
422 Ga0316584_0044306
423 Ga0436364_0512751
424 Ga0436364_1345366
425 Ga0436365_0492555
426 Ga0436365_0739565
427 Ga0436365_1823049
428 Ga0436362_0499321
429 Ga0439465_0005194
430 Ga0451841_0155974
431 Ga0451853_3235816
432 Ga0439449_0047639
433 Ga0439449_0160535
434 Ga0466969_0004839
435 Ga0466972_0160872
436 Ga0466965_0017945
437 Ga0466965_0238189
438 Ga0466966_0001859
439 Ga0466966_0004214
440 Ga0466961_0002770
441 Ga0466963_0001299
442 Ga0466971_0001862
443 Ga0466968_0000508
444 Ga0466968_0127771
445 Ga0466970_0014201
446 Ga0466970_0122253
447 Ga0466970_0368904
448 Ga0466957_0007701
449 Ga0466957_0090633
450 Ga0466960_0000218
451 Ga0466959_0007060
452 Ga0466958_0000116
453 Ga0466958_0485698
454 Ga0466967_0002704
455 Ga0466967_0007673
456 Ga0466967_0121203
457 Ga0466967_0121486
458 Ga0466967_0556658
459 Ga0466967_0804969
460 Ga0495603_0127473
461 Ga0495629_0007904
462 Ga0495641_0144279
463 Ga0495641_0191628
464 Ga0495651_0003435
465 Ga0495653_0003712
466 Ga0495653_0158213
467 Ga0495580_0050020
468 Ga0495662_0023863
469 Ga0495664_0003682
470 Ga0495608_0008759
471 Ga0495608_0049791
472 Ga0495628_0027738
473 Ga0495630_0183581
474 Ga0495666_0003132
475 Ga0495652_0119846
476 Ga0495665_0003885
477 Ga0495665_0095617
478 Ga0495665_0148423
479 Ga0495640_0027821
480 Ga0495640_0215722
481 Ga0495586_0023210
482 Ga0495586_0059478
483 Ga0495587_0108517
484 Ga0495645_0076157
485 Ga0495667_0010350
486 Ga0495634_0044176
487 Ga0495657_0010002
488 Ga0495657_0033497
489 Ga0495599_0056229
490 Ga0495623_0118612
491 Ga0495623_0177203
492 Ga0495646_0089125
493 Ga0495646_0248562
494 Ga0495647_0089134
495 Ga0495658_0014166
496 Ga0495613_0009072
497 Ga0495649_0077487
498 Ga0495600_0056887
499 Ga0495581_0391028
500 Ga0495604_0009645
501 Ga0495604_0015848
502 Ga0495674_0026209
503 Ga0495674_0103130
504 Ga0495674_0237527
505 Ga0495676_0169582
506 Ga0495676_0443050
507 Ga0495680_0465630
508 Ga0495675_0002957
509 Ga0495675_0043781
510 Ga0495675_0101087
511 Ga0495684_0080034
512 Ga0495593_0023107
513 Ga0495602_0047229
514 Ga0496100_0095424
515 Ga0496101_0104863
516 Ga0496101_0376852
517 Ga0496102_1001972
518 Ga0496104_0529563
519 Ga0496105_0300181
520 Ga0496106_0674712
521 Ga0496107_0011240
522 Ga0496107_0276576
523 Ga0496107_0373770
524 Ga0496108_0173552
525 Ga0496109_0450322
526 Ga0496109_0710085
527 Ga0496110_0903341
528 Ga0496110_0922774
529 Ga0496113_0500322
530 Ga0496114_0002107
531 Ga0496123_0030331
532 Ga0501032_0079701
533 Ga0501033_0017409
534 Ga0501034_0022894
535 Ga0501034_0221384
536 Ga0501034_1068460
537 Ga0501037_0090226
538 Ga0501038_0027011
539 Ga0501043_0045767
540 Ga0501043_0460959
541 Ga0501046_0099174
542 Ga0501047_0000216
543 Ga0501047_0046413
544 Ga0501047_0153048
545 Ga0501048_0155752
546 Ga0501048_0468781
547 Ga0501070_0320463
548 Ga0501073_0250338
549 Ga0501074_0173711
550 Ga0501035_0000602
551 Ga0501035_0414994
552 Ga0501044_0424832
553 nmdc:mga03683_192293_c1
554 nmdc:mga03n38_27234_c1
555 nmdc:mga00v17_15368_c1
556 nmdc:mga00v17_289437_c1
557 nmdc:mga0yw44_353737_c1
558 nmdc:mga0yw44_49040_c1
559 nmdc:mga04h51_126687_c1
560 nmdc:mga09592_183675_c1
561 nmdc:mga0qj67_50923_c1
562 nmdc:mga06r32_219935_c1
563 nmdc:mga06r32_510424_c1
564 nmdc:mga0sz30_18341_c1
565 nmdc:mga0sz30_77096_c1
566 Ga0495601_0007642
567 Ga0495595_0316163
568 Ga0495619_0020675
569 Ga0495619_0082655
570 Ga0500643_033320
571 Ga0500627_0030306
572 Ga0500645_031996
573 Ga0466962_0000566
574 Ga0466962_0011231
575 2583148867
576 2644014597
577 2644176032
578 2644455784
579 2776371603
580 2819742151
581 2862706456
582 2863070183
583 2866555712
584 2870788413
585 8008488719
586 8025529478
587 8047718430
588 8056210975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

7

190

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8365 5 192
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.8309 5 184
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.8202 5 184
6e4b-assembly2.cif.gz_D the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8108 5 192
6m1x-assembly1.cif.gz_B crystal structure of phosphoserine phosphatase in complex with 3-phosphoglyceric acid from entamoeba histolytica 0.7975 5 200
ID Description Score Start End Superfamily
af_O06391_3_198_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9797 3 198 3.40.50.1240
af_O06391_3_198_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9748 3 198 3.40.50.1240
af_O44899_1_131_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9058 28 85 3.40.50.1240
af_P9WH03_159_229_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8609 180 197 3.30.160.20
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8365 5 192 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A850DJQ2-F1-model_v4 Histidine phosphatase family protein 0.9962 10 92
AF-A0A7K0NY52-F1-model_v4 Histidine phosphatase family protein 0.9948 11 94 GO:0005737
GO:0016791
AF-A0A829PXA7-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (EC 5.4.3.8) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) 0.9862 2 201 GO:0005737
GO:0006782
GO:0008483
GO:0030170
GO:0042286
AF-A0A5J6V2W2-F1-model_v4 Histidine phosphatase family protein 0.986 2 200 GO:0005737
GO:0016791
AF-A0A1I9YX99-F1-model_v4 deleted 0.9836 2 201

Map