F391898

General Info

Members Datasets Scaffolds Average Seq Length
294 134 588 214

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100393764|Ga0070683_1003937642
Length 220
Sequence MTTFKGQNTNIKVVIFEDNGHLRDGLRIMIRGSVGFECAGAFPNCDNLLMNIEDTKPDVVLMDIEMPGMSGIEAVKLLKANFPGVKVLMETIFEDDEKVFQSICNGAEGYILKSTPPTEILSSIKEVYDGGAPMTPGIASKVLTMFRKNSSIQVSESFDLTQRENEILKYLVEGMSYKLIAENCFISPETVRGHIKNIYKKLQVHSKSEAVVKAIKGRIV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.02
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 41.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100393764 3300005329 Unclassified 1321
2 SwRhRL3b_contig_248477 2162886006 Bacteria 862
3 JGI25406J46586_10003633 3300003203 Bacteria 7234
4 Ga0065712_10091784 3300005290 Unclassified 2346
5 Ga0065707_10294068 3300005295 Bacteria 1019
6 Ga0070676_10034612 3300005328 Unclassified 2901
7 Ga0070676_10485558 3300005328 Unclassified 874
8 Ga0070683_100040692 3300005329 Bacteria 4273
9 Ga0070683_100068654 3300005329 Bacteria 3303
10 Ga0070683_100101983 3300005329 Unclassified 2703
11 Ga0070690_100030665 3300005330 Bacteria 3343
12 Ga0070690_100697556 3300005330 Unclassified 779
13 Ga0070670_100484070 3300005331 Unclassified 1099
14 Ga0068869_100002274 3300005334 Bacteria 11565
15 Ga0070666_10008689 3300005335 Bacteria 6316
16 Ga0070666_10025672 3300005335 Bacteria 3842
17 Ga0070666_10181584 3300005335 Unclassified 1476
18 Ga0070680_100097802 3300005336 Unclassified 2434
19 Ga0070682_100026004 3300005337 Unclassified 3498
20 Ga0068868_100031603 3300005338 Bacteria 4068
21 Ga0068868_100202788 3300005338 Unclassified 1654
22 Ga0068868_100452408 3300005338 Unclassified 1117
23 Ga0070660_100025468 3300005339 Unclassified 4397
24 Ga0070687_100484514 3300005343 Bacteria 829
25 Ga0070661_100025829 3300005344 Bacteria 4222
26 Ga0070661_100455508 3300005344 Unclassified 1018
27 Ga0070661_100456703 3300005344 Bacteria 1017
28 Ga0070661_100676932 3300005344 Bacteria 839
29 Ga0070668_100112816 3300005347 Bacteria 2165
30 Ga0070669_100079966 3300005353 Unclassified 2432
31 Ga0070669_100130411 3300005353 Bacteria 1928
32 Ga0070669_101019432 3300005353 Bacteria 711
33 Ga0070675_100010603 3300005354 Bacteria 7205
34 Ga0070675_100157560 3300005354 Unclassified 1950
35 Ga0070675_100693254 3300005354 Unclassified 927
36 Ga0070671_100044947 3300005355 Bacteria 3670
37 Ga0070671_100120316 3300005355 Unclassified 2209
38 Ga0070671_100139984 3300005355 Unclassified 2042
39 Ga0070671_100308695 3300005355 Unclassified 1347
40 Ga0070671_100775300 3300005355 Unclassified 834
41 Ga0070673_100107681 3300005364 Bacteria 2306
42 Ga0070688_100011074 3300005365 Bacteria 5004
43 Ga0070688_100064422 3300005365 Unclassified 2326
44 Ga0070688_100109736 3300005365 Unclassified 1833
45 Ga0070659_100074907 3300005366 Unclassified 2697
46 Ga0070659_100129772 3300005366 Bacteria 2046
47 Ga0070659_100643110 3300005366 Bacteria 914
48 Ga0070667_100055827 3300005367 Unclassified 3335
49 Ga0070667_100256686 3300005367 Unclassified 1564
50 Ga0070667_100993313 3300005367 Bacteria 783
51 Ga0070700_100027191 3300005441 Bacteria 3389
52 Ga0070678_100110127 3300005456 Bacteria 2153
53 Ga0070662_100025678 3300005457 Unclassified 4071
54 Ga0070662_100028347 3300005457 Unclassified 3895
55 Ga0070662_100061184 3300005457 Unclassified 2748
56 Ga0070662_100091186 3300005457 Unclassified 2288
57 Ga0068867_100141629 3300005459 Bacteria 1880
58 Ga0070685_10018634 3300005466 Unclassified 3736
59 Ga0070707_100714110 3300005468 Unclassified 965
60 Ga0070698_100020056 3300005471 Bacteria 7009
61 Ga0070679_100133988 3300005530 Unclassified 2459
62 Ga0070684_100061155 3300005535 Unclassified 3296
63 Ga0070684_100134064 3300005535 Unclassified 2236
64 Ga0070697_100270178 3300005536 Unclassified 1457
65 Ga0068853_100114927 3300005539 Unclassified 2394
66 Ga0068853_100235493 3300005539 Unclassified 1676
67 Ga0070672_100087051 3300005543 Bacteria 2513
68 Ga0070672_100466982 3300005543 Bacteria 1088
69 Ga0070665_100261445 3300005548 Unclassified 1732
70 Ga0070665_100332423 3300005548 Unclassified 1524
71 Ga0070665_100474976 3300005548 Bacteria 1261
72 Ga0070664_100025772 3300005564 Bacteria 4875
73 Ga0070664_100031410 3300005564 Unclassified 4437
74 Ga0070664_100034483 3300005564 Bacteria 4245
75 Ga0070664_100047805 3300005564 Bacteria 3615
76 Ga0070664_100112570 3300005564 Bacteria 2377
77 Ga0070664_100219377 3300005564 Unclassified 1701
78 Ga0070664_100238837 3300005564 Bacteria 1631
79 Ga0068857_100070208 3300005577 Bacteria 3120
80 Ga0068857_100189138 3300005577 Unclassified 1875
81 Ga0068857_100280170 3300005577 Unclassified 1533
82 Ga0068856_100126725 3300005614 Unclassified 2557
83 Ga0070702_100149785 3300005615 Bacteria 1496
84 Ga0070702_100510352 3300005615 Bacteria 885
85 Ga0068852_100075637 3300005616 Unclassified 2971
86 Ga0068852_100087610 3300005616 Unclassified 2778
87 Ga0068859_100019592 3300005617 Bacteria 6796
88 Ga0068859_100085961 3300005617 Unclassified 3191
89 Ga0068859_100362757 3300005617 Bacteria 1544
90 Ga0068859_100757488 3300005617 Bacteria 1060
91 Ga0068859_100766078 3300005617 Bacteria 1054
92 Ga0068864_100046605 3300005618 Unclassified 3720
93 Ga0068864_100060288 3300005618 Bacteria 3285
94 Ga0068864_100514705 3300005618 Bacteria 1153
95 Ga0068864_100607610 3300005618 Bacteria 1062
96 Ga0068864_100637064 3300005618 Unclassified 1037
97 Ga0068866_10136146 3300005718 Unclassified 1404
98 Ga0068861_100012364 3300005719 Bacteria 5953
99 Ga0068861_100066843 3300005719 Unclassified 2772
100 Ga0068861_100809128 3300005719 Bacteria 880
101 Ga0068861_100861884 3300005719 Unclassified 855
102 Ga0068861_101280043 3300005719 Bacteria 712
103 Ga0068851_10265734 3300005834 Bacteria 977
104 Ga0068863_100001482 3300005841 Bacteria 23269
105 Ga0068863_100251428 3300005841 Bacteria 1707
106 Ga0068863_100339180 3300005841 Bacteria 1462
107 Ga0068863_100408891 3300005841 Unclassified 1328
108 Ga0068858_100049532 3300005842 Unclassified 3890
109 Ga0068858_100689178 3300005842 Bacteria 994
110 Ga0068860_100422774 3300005843 Bacteria 1321
111 Ga0068862_100015823 3300005844 Bacteria 6266
112 Ga0081539_10000377 3300005985 Bacteria 97368
113 Ga0081539_10109887 3300005985 Bacteria 1390
114 Ga0097621_100006320 3300006237 Bacteria 8406
115 Ga0097621_100078841 3300006237 Unclassified 2737
116 Ga0097621_100097808 3300006237 Unclassified 2465
117 Ga0068871_100010154 3300006358 Bacteria 6855
118 Ga0068871_100113987 3300006358 Unclassified 2277
119 Ga0068871_101151706 3300006358 Bacteria 726
120 Ga0075428_100069114 3300006844 Bacteria 3863
121 Ga0075434_100027050 3300006871 Bacteria 5629
122 Ga0097620_100019593 3300006931 Bacteria 6796
123 Ga0097620_100085967 3300006931 Unclassified 3191
124 Ga0097620_100362737 3300006931 Bacteria 1544
125 Ga0097620_100757452 3300006931 Bacteria 1060
126 Ga0097620_100766075 3300006931 Bacteria 1054
127 Ga0105240_10099857 3300009093 Bacteria 3532
128 Ga0111539_10003030 3300009094 Bacteria 22277
129 Ga0111539_10024430 3300009094 Bacteria 7415
130 Ga0105242_10004134 3300009176 Bacteria 11294
131 Ga0105242_10060278 3300009176 Bacteria 3117
132 Ga0105242_10117019 3300009176 Bacteria 2281
133 Ga0105249_10041602 3300009553 Unclassified 4178
134 Ga0105249_10109814 3300009553 Bacteria 2605
135 Ga0105249_10114433 3300009553 Bacteria 2554
136 Ga0105249_10128637 3300009553 Unclassified 2415
137 Ga0105239_10248448 3300010375 Unclassified 1998
138 Ga0157370_10065009 3300013104 Bacteria 3452
139 Ga0157370_10689001 3300013104 Bacteria 933
140 Ga0157374_10013740 3300013296 Bacteria 7073
141 Ga0157374_10040157 3300013296 Bacteria 4308
142 Ga0157374_10052380 3300013296 Unclassified 3801
143 Ga0157374_10323254 3300013296 Unclassified 1529
144 Ga0157378_10019825 3300013297 Bacteria 5912
145 Ga0157378_10031085 3300013297 Bacteria 4715
146 Ga0157378_10043132 3300013297 Bacteria 4005
147 Ga0163162_10001197 3300013306 Bacteria 24196
148 Ga0163162_10007113 3300013306 Bacteria 10858
149 Ga0163162_10034529 3300013306 Bacteria 5033
150 Ga0163162_10260442 3300013306 Bacteria 1866
151 Ga0163162_10562341 3300013306 Unclassified 1268
152 Ga0163162_11326831 3300013306 Unclassified 818
153 Ga0157372_10189084 3300013307 Unclassified 2384
154 Ga0157372_10824871 3300013307 Bacteria 1077
155 Ga0157372_11039581 3300013307 Bacteria 948
156 Ga0157375_10025791 3300013308 Bacteria 5468
157 Ga0157375_10188593 3300013308 Bacteria 2216
158 Ga0157375_10213193 3300013308 Bacteria 2089
159 Ga0157375_10221157 3300013308 Unclassified 2052
160 Ga0157375_10875817 3300013308 Bacteria 1043
161 Ga0157375_11169870 3300013308 Unclassified 902
162 Ga0157375_12119563 3300013308 Unclassified 669
163 Ga0163163_10011766 3300014325 Bacteria 7952
164 Ga0163163_10016671 3300014325 Bacteria 6832
165 Ga0163163_10025528 3300014325 Bacteria 5634
166 Ga0163163_10042894 3300014325 Bacteria 4433
167 Ga0163163_10101409 3300014325 Bacteria 2901
168 Ga0163163_10671762 3300014325 Unclassified 1099
169 Ga0163163_10986817 3300014325 Unclassified 905
170 Ga0157380_10000004 3300014326 Bacteria 212844
171 Ga0157380_10005709 3300014326 Bacteria 8709
172 Ga0157380_10121463 3300014326 Bacteria 2213
173 Ga0157380_10584229 3300014326 Bacteria 1102
174 Ga0157377_10032071 3300014745 Bacteria 2859
175 Ga0157377_10276181 3300014745 Bacteria 1099
176 Ga0157379_10055351 3300014968 Unclassified 3544
177 Ga0157379_10160103 3300014968 Unclassified 2032
178 Ga0157379_10347610 3300014968 Bacteria 1357
179 Ga0157379_10555302 3300014968 Bacteria 1069
180 Ga0157376_10003083 3300014969 Bacteria 11443
181 Ga0157376_10181233 3300014969 Bacteria 1925
182 Ga0163161_10020651 3300017792 Bacteria 4625
183 Ga0207680_10156176 3300025903 Unclassified 1526
184 Ga0207680_10223200 3300025903 Unclassified 1293
185 Ga0207645_10029682 3300025907 Unclassified 3524
186 Ga0207645_10127233 3300025907 Bacteria 1656
187 Ga0207643_10138046 3300025908 Unclassified 1455
188 Ga0207695_10727077 3300025913 Unclassified 873
189 Ga0207649_10022057 3300025920 Unclassified 3676
190 Ga0207649_10274156 3300025920 Unclassified 1224
191 Ga0207652_10338333 3300025921 Unclassified 1358
192 Ga0207681_10040139 3300025923 Unclassified 3112
193 Ga0207681_10081717 3300025923 Unclassified 2282
194 Ga0207650_10041948 3300025925 Bacteria 3356
195 Ga0207650_10077638 3300025925 Bacteria 2511
196 Ga0207650_10346823 3300025925 Bacteria 1220
197 Ga0207659_10041721 3300025926 Unclassified 3215
198 Ga0207659_10050682 3300025926 Unclassified 2950
199 Ga0207659_10275387 3300025926 Unclassified 1374
200 Ga0207644_10023427 3300025931 Bacteria 4229
201 Ga0207644_10099801 3300025931 Unclassified 2179
202 Ga0207644_10186521 3300025931 Unclassified 1629
203 Ga0207644_10291407 3300025931 Bacteria 1313
204 Ga0207690_10098696 3300025932 Bacteria 2081
205 Ga0207690_10368483 3300025932 Unclassified 1139
206 Ga0207706_10034783 3300025933 Unclassified 4483
207 Ga0207706_10062504 3300025933 Unclassified 3279
208 Ga0207706_10076189 3300025933 Unclassified 2950
209 Ga0207706_10350156 3300025933 Bacteria 1284
210 Ga0207706_10364534 3300025933 Unclassified 1255
211 Ga0207706_10536568 3300025933 Bacteria 1008
212 Ga0207686_10048295 3300025934 Bacteria 2636
213 Ga0207691_10411915 3300025940 Bacteria 1152
214 Ga0207711_11089083 3300025941 Bacteria 740
215 Ga0207689_10014327 3300025942 Bacteria 6749
216 Ga0207689_10222845 3300025942 Bacteria 1558
217 Ga0207661_10026820 3300025944 Bacteria 4395
218 Ga0207661_10057367 3300025944 Bacteria 3131
219 Ga0207661_10472985 3300025944 Unclassified 1143
220 Ga0207661_10547056 3300025944 Unclassified 1060
221 Ga0207679_10037704 3300025945 Bacteria 3438
222 Ga0207679_10106579 3300025945 Bacteria 2203
223 Ga0207679_10123130 3300025945 Unclassified 2068
224 Ga0207679_10139551 3300025945 Unclassified 1957
225 Ga0207679_10207150 3300025945 Bacteria 1642
226 Ga0207679_10434079 3300025945 Unclassified 1162
227 Ga0207667_10420150 3300025949 Unclassified 1360
228 Ga0207651_10085097 3300025960 Bacteria 2293
229 Ga0207651_10192708 3300025960 Bacteria 1627
230 Ga0207712_10011346 3300025961 Bacteria 5675
231 Ga0207712_10094749 3300025961 Unclassified 2206
232 Ga0207712_10321397 3300025961 Bacteria 1277
233 Ga0207712_10419324 3300025961 Bacteria 1129
234 Ga0207668_10116332 3300025972 Bacteria 2016
235 Ga0207658_10033224 3300025986 Unclassified 3679
236 Ga0207658_10062091 3300025986 Bacteria 2795
237 Ga0207658_10705399 3300025986 Bacteria 912
238 Ga0207703_10049978 3300026035 Unclassified 3382
239 Ga0207703_10062019 3300026035 Bacteria 3062
240 Ga0207639_10078717 3300026041 Unclassified 2603
241 Ga0207708_10027663 3300026075 Bacteria 4295
242 Ga0207708_10044866 3300026075 Bacteria 3369
243 Ga0207702_10077557 3300026078 Bacteria 2874
244 Ga0207641_10002126 3300026088 Bacteria 18728
245 Ga0207641_10653521 3300026088 Unclassified 1033
246 Ga0207648_10209748 3300026089 Bacteria 1729
247 Ga0207648_10591500 3300026089 Bacteria 1022
248 Ga0207676_10056720 3300026095 Unclassified 3081
249 Ga0207676_10271160 3300026095 Bacteria 1537
250 Ga0207676_10524406 3300026095 Unclassified 1128
251 Ga0207676_10791916 3300026095 Bacteria 924
252 Ga0207674_10054719 3300026116 Bacteria 4062
253 Ga0207674_10101727 3300026116 Unclassified 2854
254 Ga0207674_10172404 3300026116 Unclassified 2117
255 Ga0207674_10247864 3300026116 Unclassified 1728
256 Ga0207675_100012735 3300026118 Bacteria 7860
257 Ga0207675_100062959 3300026118 Unclassified 3466
258 Ga0207683_10026004 3300026121 Bacteria 5053
259 Ga0207683_10207867 3300026121 Bacteria 1781
260 Ga0207698_10404700 3300026142 Unclassified 1305
261 Ga0209974_10024044 3300027876 Bacteria 2016
262 Ga0207428_10102689 3300027907 Unclassified 2208
263 Ga0207428_10146371 3300027907 Bacteria 1800
264 Ga0268265_10012343 3300028380 Bacteria 5788
265 Ga0268265_10045491 3300028380 Bacteria 3276
266 Ga0307515_10000133 3300028794 Bacteria 176091
267 Ga0307515_10059088 3300028794 Bacteria 5504
268 Ga0307515_10250613 3300028794 Bacteria 1524
269 Ga0373924_0095546 3300035410 Bacteria 1275
270 Ga0373937_0024135 3300036401 Bacteria 5483
271 Ga0439453_0012491 3300041408 Bacteria 1430
272 Ga0495653_0147577 3300046463 Bacteria 1647
273 Ga0495582_0263991 3300046473 Unclassified 988
274 Ga0495594_0103002 3300046499 Unclassified 1606
275 Ga0495618_0242813 3300046514 Bacteria 1132
276 Ga0495630_0036391 3300046517 Bacteria 3680
277 Ga0495640_0166299 3300046533 Bacteria 1411
278 Ga0495621_0076011 3300046539 Unclassified 1245
279 Ga0495621_0110647 3300046539 Bacteria 1053
280 Ga0495621_0117578 3300046539 Unclassified 1025
281 Ga0495667_0106973 3300046559 Bacteria 1808
282 Ga0495668_0102293 3300046616 Unclassified 1567
283 Ga0495599_0281140 3300046678 Bacteria 1008
284 Ga0495684_0112750 3300047471 Bacteria 2050
285 Ga0495602_0478000 3300048088 Bacteria 875
286 Ga0496109_0538365 3300048912 Unclassified 1102
287 Ga0496114_0262858 3300048917 Unclassified 1520
288 Ga0496114_0784298 3300048917 Unclassified 831
289 nmdc:mga0qj67_838775_c1 3300050509 Bacteria 726
290 nmdc:mga08y16_10810_c1 3300050511 Bacteria 9582
291 nmdc:mga08y16_153884_c1 3300050511 Unclassified 2390
292 Ga0500568_0046012 3300053139 Bacteria 1734
293 Ga0500616_0003278 3300053153 Bacteria 12492
294 2522550443 2522125168 Bacteria 7376607
295 Ga0070683_100393764
296 SwRhRL3b_contig_248477
297 JGI25406J46586_10003633
298 Ga0065712_10091784
299 Ga0065707_10294068
300 Ga0070676_10034612
301 Ga0070676_10485558
302 Ga0070683_100040692
303 Ga0070683_100068654
304 Ga0070683_100101983
305 Ga0070690_100030665
306 Ga0070690_100697556
307 Ga0070670_100484070
308 Ga0068869_100002274
309 Ga0070666_10008689
310 Ga0070666_10025672
311 Ga0070666_10181584
312 Ga0070680_100097802
313 Ga0070682_100026004
314 Ga0068868_100031603
315 Ga0068868_100202788
316 Ga0068868_100452408
317 Ga0070660_100025468
318 Ga0070687_100484514
319 Ga0070661_100025829
320 Ga0070661_100455508
321 Ga0070661_100456703
322 Ga0070661_100676932
323 Ga0070668_100112816
324 Ga0070669_100079966
325 Ga0070669_100130411
326 Ga0070669_101019432
327 Ga0070675_100010603
328 Ga0070675_100157560
329 Ga0070675_100693254
330 Ga0070671_100044947
331 Ga0070671_100120316
332 Ga0070671_100139984
333 Ga0070671_100308695
334 Ga0070671_100775300
335 Ga0070673_100107681
336 Ga0070688_100011074
337 Ga0070688_100064422
338 Ga0070688_100109736
339 Ga0070659_100074907
340 Ga0070659_100129772
341 Ga0070659_100643110
342 Ga0070667_100055827
343 Ga0070667_100256686
344 Ga0070667_100993313
345 Ga0070700_100027191
346 Ga0070678_100110127
347 Ga0070662_100025678
348 Ga0070662_100028347
349 Ga0070662_100061184
350 Ga0070662_100091186
351 Ga0068867_100141629
352 Ga0070685_10018634
353 Ga0070707_100714110
354 Ga0070698_100020056
355 Ga0070679_100133988
356 Ga0070684_100061155
357 Ga0070684_100134064
358 Ga0070697_100270178
359 Ga0068853_100114927
360 Ga0068853_100235493
361 Ga0070672_100087051
362 Ga0070672_100466982
363 Ga0070665_100261445
364 Ga0070665_100332423
365 Ga0070665_100474976
366 Ga0070664_100025772
367 Ga0070664_100031410
368 Ga0070664_100034483
369 Ga0070664_100047805
370 Ga0070664_100112570
371 Ga0070664_100219377
372 Ga0070664_100238837
373 Ga0068857_100070208
374 Ga0068857_100189138
375 Ga0068857_100280170
376 Ga0068856_100126725
377 Ga0070702_100149785
378 Ga0070702_100510352
379 Ga0068852_100075637
380 Ga0068852_100087610
381 Ga0068859_100019592
382 Ga0068859_100085961
383 Ga0068859_100362757
384 Ga0068859_100757488
385 Ga0068859_100766078
386 Ga0068864_100046605
387 Ga0068864_100060288
388 Ga0068864_100514705
389 Ga0068864_100607610
390 Ga0068864_100637064
391 Ga0068866_10136146
392 Ga0068861_100012364
393 Ga0068861_100066843
394 Ga0068861_100809128
395 Ga0068861_100861884
396 Ga0068861_101280043
397 Ga0068851_10265734
398 Ga0068863_100001482
399 Ga0068863_100251428
400 Ga0068863_100339180
401 Ga0068863_100408891
402 Ga0068858_100049532
403 Ga0068858_100689178
404 Ga0068860_100422774
405 Ga0068862_100015823
406 Ga0081539_10000377
407 Ga0081539_10109887
408 Ga0097621_100006320
409 Ga0097621_100078841
410 Ga0097621_100097808
411 Ga0068871_100010154
412 Ga0068871_100113987
413 Ga0068871_101151706
414 Ga0075428_100069114
415 Ga0075434_100027050
416 Ga0097620_100019593
417 Ga0097620_100085967
418 Ga0097620_100362737
419 Ga0097620_100757452
420 Ga0097620_100766075
421 Ga0105240_10099857
422 Ga0111539_10003030
423 Ga0111539_10024430
424 Ga0105242_10004134
425 Ga0105242_10060278
426 Ga0105242_10117019
427 Ga0105249_10041602
428 Ga0105249_10109814
429 Ga0105249_10114433
430 Ga0105249_10128637
431 Ga0105239_10248448
432 Ga0157370_10065009
433 Ga0157370_10689001
434 Ga0157374_10013740
435 Ga0157374_10040157
436 Ga0157374_10052380
437 Ga0157374_10323254
438 Ga0157378_10019825
439 Ga0157378_10031085
440 Ga0157378_10043132
441 Ga0163162_10001197
442 Ga0163162_10007113
443 Ga0163162_10034529
444 Ga0163162_10260442
445 Ga0163162_10562341
446 Ga0163162_11326831
447 Ga0157372_10189084
448 Ga0157372_10824871
449 Ga0157372_11039581
450 Ga0157375_10025791
451 Ga0157375_10188593
452 Ga0157375_10213193
453 Ga0157375_10221157
454 Ga0157375_10875817
455 Ga0157375_11169870
456 Ga0157375_12119563
457 Ga0163163_10011766
458 Ga0163163_10016671
459 Ga0163163_10025528
460 Ga0163163_10042894
461 Ga0163163_10101409
462 Ga0163163_10671762
463 Ga0163163_10986817
464 Ga0157380_10000004
465 Ga0157380_10005709
466 Ga0157380_10121463
467 Ga0157380_10584229
468 Ga0157377_10032071
469 Ga0157377_10276181
470 Ga0157379_10055351
471 Ga0157379_10160103
472 Ga0157379_10347610
473 Ga0157379_10555302
474 Ga0157376_10003083
475 Ga0157376_10181233
476 Ga0163161_10020651
477 Ga0207680_10156176
478 Ga0207680_10223200
479 Ga0207645_10029682
480 Ga0207645_10127233
481 Ga0207643_10138046
482 Ga0207695_10727077
483 Ga0207649_10022057
484 Ga0207649_10274156
485 Ga0207652_10338333
486 Ga0207681_10040139
487 Ga0207681_10081717
488 Ga0207650_10041948
489 Ga0207650_10077638
490 Ga0207650_10346823
491 Ga0207659_10041721
492 Ga0207659_10050682
493 Ga0207659_10275387
494 Ga0207644_10023427
495 Ga0207644_10099801
496 Ga0207644_10186521
497 Ga0207644_10291407
498 Ga0207690_10098696
499 Ga0207690_10368483
500 Ga0207706_10034783
501 Ga0207706_10062504
502 Ga0207706_10076189
503 Ga0207706_10350156
504 Ga0207706_10364534
505 Ga0207706_10536568
506 Ga0207686_10048295
507 Ga0207691_10411915
508 Ga0207711_11089083
509 Ga0207689_10014327
510 Ga0207689_10222845
511 Ga0207661_10026820
512 Ga0207661_10057367
513 Ga0207661_10472985
514 Ga0207661_10547056
515 Ga0207679_10037704
516 Ga0207679_10106579
517 Ga0207679_10123130
518 Ga0207679_10139551
519 Ga0207679_10207150
520 Ga0207679_10434079
521 Ga0207667_10420150
522 Ga0207651_10085097
523 Ga0207651_10192708
524 Ga0207712_10011346
525 Ga0207712_10094749
526 Ga0207712_10321397
527 Ga0207712_10419324
528 Ga0207668_10116332
529 Ga0207658_10033224
530 Ga0207658_10062091
531 Ga0207658_10705399
532 Ga0207703_10049978
533 Ga0207703_10062019
534 Ga0207639_10078717
535 Ga0207708_10027663
536 Ga0207708_10044866
537 Ga0207702_10077557
538 Ga0207641_10002126
539 Ga0207641_10653521
540 Ga0207648_10209748
541 Ga0207648_10591500
542 Ga0207676_10056720
543 Ga0207676_10271160
544 Ga0207676_10524406
545 Ga0207676_10791916
546 Ga0207674_10054719
547 Ga0207674_10101727
548 Ga0207674_10172404
549 Ga0207674_10247864
550 Ga0207675_100012735
551 Ga0207675_100062959
552 Ga0207683_10026004
553 Ga0207683_10207867
554 Ga0207698_10404700
555 Ga0209974_10024044
556 Ga0207428_10102689
557 Ga0207428_10146371
558 Ga0268265_10012343
559 Ga0268265_10045491
560 Ga0307515_10000133
561 Ga0307515_10059088
562 Ga0307515_10250613
563 Ga0373924_0095546
564 Ga0373937_0024135
565 Ga0439453_0012491
566 Ga0495653_0147577
567 Ga0495582_0263991
568 Ga0495594_0103002
569 Ga0495618_0242813
570 Ga0495630_0036391
571 Ga0495640_0166299
572 Ga0495621_0076011
573 Ga0495621_0110647
574 Ga0495621_0117578
575 Ga0495667_0106973
576 Ga0495668_0102293
577 Ga0495599_0281140
578 Ga0495684_0112750
579 Ga0495602_0478000
580 Ga0496109_0538365
581 Ga0496114_0262858
582 Ga0496114_0784298
583 nmdc:mga0qj67_838775_c1
584 nmdc:mga08y16_10810_c1
585 nmdc:mga08y16_153884_c1
586 Ga0500568_0046012
587 Ga0500616_0003278
588 2522550443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

159

214

0.97

PF00072

Response_reg

Response regulator receiver domain

13

125

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9869 151 212
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9839 151 211
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9829 152 206
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9803 152 212
6kju-assembly1.cif.gz_A huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.9755 152 208
ID Description Score Start End Superfamily
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9861 151 208 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9829 152 206 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9785 151 212 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9705 152 212 1.10.10.10
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9671 152 204 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Z0LHK6-F1-model_v4 Response regulator transcription factor 0.9692 1 136 GO:0000160
GO:0003677
GO:0010468
AF-A0A257VTH8-F1-model_v4 Response regulatory domain-containing protein 0.9672 2 139 GO:0000160
AF-A0A3B9HLJ7-F1-model_v4 DNA-binding response regulator 0.9656 2 141 GO:0000160
GO:0003677
AF-A0A6L3F9B9-F1-model_v4 DNA-binding response regulator 0.9563 3 136 GO:0000160
GO:0003677
AF-A0A4Q3AVB8-F1-model_v4 Response regulator transcription factor 0.9544 1 141 GO:0000160
GO:0003677

Map