F391793

General Info

Members Datasets Scaffolds Average Seq Length
293 241 234 334

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0002593|Ga0500622_0002593_5640_6641
Length 333
Sequence MKTLILKKYGDPDQIVFADIPEPVLKPDEILVRVHAVGLNPIDNAIAKGSFKPIIRLQLPATMGSDLAGVVIETGSRVTRFKPGDAVFASIFDLGTGSLAEFAVVPESAAALKPSNLDFVQAASIPMVGLTAWQALKERTRLRPGQKVFIPAGSGGIGTFAIQLAKHLGAKVGTTTSTGNVDLVRGLGADEVIDYKKQEFETVLRDYDAVLGTVRGDALNKSVGILKPNSNIVSLVGPPDVAFARARGMNFFMRFVFSLLSGKIIRQAHKKGASYSFHWVRPDGAQLAEIGKLLTAGKIRPVIDRVFPFDQAKEALAYLDQGRAKGKVVVQMR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
8 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
9 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
10 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
11 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
12 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
13 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
16 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
17 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
18 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
19 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
20 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
21 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
22 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
23 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
24 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
25 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
26 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
27 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
28 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
29 2904699407
30 2922425934
31 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
32 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
33 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
34 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
35 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
36 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
37 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
38 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
39 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
40 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
41 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
42 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
43 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
44 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
45 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
46 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
47 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
48 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
49 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
50 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
51 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
52 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
235 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
236 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
237 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
238 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
239 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
240 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
241 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.41
Metatranscriptomes 0
Isolates 19.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.53
Nodule 13.31
Rhizoplane 6.83
Rhizosphere 49.49
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10001982 3300002244 Bacteria 3263
2 JGI25151J46595_10015123 3300003187 Bacteria 3417
3 JGI25153J46596_10000188 3300003215 Bacteria 59827
4 JGI25153J46596_10000525 3300003215 Bacteria 24072
5 Ga0055540_1000058 3300003792 Bacteria 136015
6 Ga0055531_10000453 3300003794 Bacteria 38105
7 Ga0055531_10002582 3300003794 Bacteria 11991
8 Ga0070670_100081813 3300005331 Bacteria 2774
9 Ga0070671_100136340 3300005355 Bacteria 2069
10 Ga0070659_100090912 3300005366 Bacteria 2446
11 Ga0070659_100224614 3300005366 Bacteria 1551
12 Ga0070667_100154492 3300005367 Bacteria 2018
13 Ga0070709_10000418 3300005434 Bacteria 25779
14 Ga0070714_100055063 3300005435 Bacteria 3399
15 Ga0070713_100083236 3300005436 Bacteria 2735
16 Ga0070711_100006912 3300005439 Bacteria 6878
17 Ga0070663_100124817 3300005455 Bacteria 1949
18 Ga0070662_100114376 3300005457 Bacteria 2060
19 Ga0070698_100127593 3300005471 Bacteria 2500
20 Ga0068856_100039350 3300005614 Bacteria 4642
21 Ga0068856_100254511 3300005614 Bacteria 1771
22 Ga0070702_100060658 3300005615 Bacteria 2200
23 Ga0068864_100216172 3300005618 Bacteria 1767
24 Ga0068863_100166657 3300005841 Bacteria 2113
25 Ga0068863_100261864 3300005841 Bacteria 1672
26 Ga0068860_100052783 3300005843 Bacteria 3866
27 Ga0068860_100088883 3300005843 Bacteria 2941
28 Ga0070717_10072984 3300006028 Bacteria 2867
29 Ga0070717_10116357 3300006028 Bacteria 2286
30 Ga0070717_10317333 3300006028 Bacteria 1388
31 Ga0075365_10044098 3300006038 Bacteria 2921
32 Ga0075365_10058700 3300006038 Bacteria 2562
33 Ga0075363_100025737 3300006048 Bacteria 3004
34 Ga0075363_100120935 3300006048 Bacteria 1462
35 Ga0075364_10022385 3300006051 Bacteria 3991
36 Ga0075364_10098322 3300006051 Bacteria 1947
37 Ga0075362_10024268 3300006177 Bacteria 2571
38 Ga0075367_10035194 3300006178 Bacteria 2897
39 Ga0075366_10005933 3300006195 Bacteria 6645
40 Ga0075366_10018421 3300006195 Bacteria 4030
41 Ga0075366_10030913 3300006195 Bacteria 3149
42 Ga0075428_100058687 3300006844 Bacteria 4213
43 Ga0105251_10106787 3300009011 Bacteria 1278
44 Ga0105240_10002438 3300009093 Bacteria 29910
45 Ga0105245_10072788 3300009098 Bacteria 3123
46 Ga0105247_10039755 3300009101 Bacteria 2874
47 Ga0105247_10051593 3300009101 Bacteria 2534
48 Ga0114129_10104339 3300009147 Bacteria 3917
49 Ga0105242_10380144 3300009176 Bacteria 1312
50 Ga0105237_10006022 3300009545 Bacteria 13569
51 Ga0105238_10085005 3300009551 Bacteria 3153
52 Ga0105249_10161694 3300009553 Bacteria 2164
53 Ga0105239_10031513 3300010375 Bacteria 5829
54 Ga0105239_10271504 3300010375 Bacteria 1907
55 Ga0105246_10014245 3300011119 Bacteria 4998
56 Ga0157326_1002277 3300012513 Bacteria 2069
57 Ga0157374_10072347 3300013296 Bacteria 3253
58 Ga0157378_10188153 3300013297 Bacteria 1945
59 Ga0163162_10027168 3300013306 Bacteria 5659
60 Ga0157376_10178833 3300014969 Bacteria 1937
61 Ga0182006_1000019 3300015261 Bacteria 294192
62 Ga0182007_10026421 3300015262 Bacteria 2012
63 Ga0182005_1000005 3300015265 Bacteria 537378
64 Ga0163161_10004279 3300017792 Bacteria 9955
65 Ga0209563_100011 3300025230 Bacteria 1187808
66 Ga0207425_1001668 3300025245 Bacteria 8884
67 Ga0209677_103240 3300025253 Bacteria 5425
68 Ga0209233_1002454 3300025261 Bacteria 6816
69 Ga0209455_1010373 3300025272 Bacteria 2372
70 Ga0209130_1000276 3300025284 Bacteria 63841
71 Ga0209676_1000023 3300025292 Bacteria 589732
72 Ga0209025_1008532 3300025294 Bacteria 7359
73 Ga0209025_1019067 3300025294 Bacteria 3838
74 Ga0209564_1003426 3300025295 Bacteria 10875
75 Ga0209758_1000117 3300025297 Bacteria 198325
76 Ga0209050_1000022 3300025298 Bacteria 565239
77 Ga0207426_1001594 3300025302 Bacteria 18119
78 Ga0209051_1000013 3300025303 Bacteria 565239
79 Ga0209257_1000042 3300025304 Bacteria 537149
80 Ga0209257_1001342 3300025304 Bacteria 29838
81 Ga0209257_1011573 3300025304 Bacteria 4225
82 Ga0207692_10028829 3300025898 Bacteria 2631
83 Ga0207647_10002342 3300025904 Bacteria 14401
84 Ga0207699_10001353 3300025906 Bacteria 11652
85 Ga0207654_10029952 3300025911 Bacteria 2984
86 Ga0207695_10000157 3300025913 Bacteria 204140
87 Ga0207695_10155012 3300025913 Bacteria 2226
88 Ga0207671_10004425 3300025914 Bacteria 13458
89 Ga0207657_10014161 3300025919 Bacteria 7802
90 Ga0207687_10200233 3300025927 Bacteria 1560
91 Ga0207700_10018958 3300025928 Bacteria 4637
92 Ga0207664_10027737 3300025929 Bacteria 4298
93 Ga0207690_10085591 3300025932 Bacteria 2213
94 Ga0207706_10110252 3300025933 Bacteria 2421
95 Ga0207711_10038252 3300025941 Bacteria 4078
96 Ga0207679_10142375 3300025945 Bacteria 1940
97 Ga0207678_10030737 3300026067 Bacteria 4689
98 Ga0207702_10057175 3300026078 Bacteria 3315
99 Ga0207674_10078699 3300026116 Bacteria 3302
100 Ga0209281_1002325 3300027111 Bacteria 7914
101 Ga0209813_10005368 3300027866 Bacteria 3106
102 Ga0268265_10070047 3300028380 Bacteria 2726
103 Ga0307515_10077004 3300028794 Bacteria 4412
104 Ga0316177_1112397 3300030731 Bacteria 2742
105 Ga0265328_10000445 3300031239 Bacteria 19251
106 Ga0265331_10000082 3300031250 Bacteria 133041
107 Ga0265316_10022440 3300031344 Bacteria 5322
108 Ga0307508_10000116 3300031616 Bacteria 94844
109 Ga0307516_10001248 3300031730 Bacteria 35383
110 Ga0307407_10000111 3300031903 Bacteria 26379
111 Ga0307416_100033201 3300032002 Bacteria 3909
112 Ga0307416_100085799 3300032002 Bacteria 2681
113 Ga0307414_10000015 3300032004 Bacteria 268602
114 Ga0307510_10008288 3300033180 Bacteria 12388
115 Ga0395899_0006273 3300037312 Bacteria 9203
116 Ga0395900_0000715 3300037418 Bacteria 44112
117 Ga0450905_010763 3300042142 Bacteria 1271
118 Ga0453684_0048409 3300044712 Bacteria 5623
119 Ga0453684_0062053 3300044712 Bacteria 4791
120 Ga0451576_0153526 3300045051 Bacteria 2401
121 Ga0495617_009909 3300046452 Bacteria 3267
122 Ga0495603_0083933 3300046455 Bacteria 1865
123 Ga0495638_0003348 3300046460 Bacteria 12648
124 Ga0495638_0004099 3300046460 Bacteria 11148
125 Ga0495580_0250939 3300046472 Bacteria 1212
126 Ga0495605_0052740 3300046474 Bacteria 1975
127 Ga0495605_0059079 3300046474 Bacteria 1842
128 Ga0495584_0010518 3300046491 Bacteria 4753
129 Ga0495584_0011867 3300046491 Bacteria 4456
130 Ga0495584_0131805 3300046491 Bacteria 1268
131 Ga0495585_0132240 3300046492 Bacteria 1312
132 Ga0495607_0001440 3300046501 Bacteria 21201
133 Ga0495583_0029755 3300046506 Bacteria 2668
134 Ga0495606_0005644 3300046507 Bacteria 11865
135 Ga0495606_0011622 3300046507 Bacteria 7156
136 Ga0495606_0048212 3300046507 Bacteria 2803
137 Ga0495606_0140652 3300046507 Bacteria 1426
138 Ga0495610_0135016 3300046512 Bacteria 1068
139 Ga0495616_0026305 3300046513 Bacteria 3099
140 Ga0495618_0092425 3300046514 Bacteria 1935
141 Ga0495620_0093925 3300046515 Bacteria 1201
142 Ga0495631_0012348 3300046518 Bacteria 4175
143 Ga0495632_0022422 3300046519 Bacteria 3384
144 Ga0495643_0072277 3300046522 Bacteria 1809
145 Ga0495644_0032832 3300046523 Bacteria 1962
146 Ga0495648_0038524 3300046524 Bacteria 3056
147 Ga0495648_0128475 3300046524 Bacteria 1351
148 Ga0495609_0000163 3300046538 Bacteria 69578
149 Ga0495622_0046937 3300046557 Bacteria 2007
150 Ga0495622_0079132 3300046557 Bacteria 1513
151 Ga0495633_0003871 3300046558 Bacteria 9775
152 Ga0495668_0035952 3300046616 Bacteria 2776
153 Ga0495668_0093921 3300046616 Unclassified 1642
154 Ga0495625_0021631 3300046660 Bacteria 4947
155 Ga0495625_0034690 3300046660 Bacteria 3722
156 Ga0495625_0095573 3300046660 Bacteria 2048
157 Ga0495635_0032072 3300046663 Bacteria 3646
158 Ga0495657_0013474 3300046675 Bacteria 6031
159 Ga0495669_0003937 3300046684 Bacteria 6115
160 Ga0495613_0026120 3300046689 Bacteria 4352
161 Ga0495624_0148109 3300046690 Bacteria 1436
162 Ga0495671_0019318 3300046692 Bacteria 3605
163 Ga0495649_0010896 3300046694 Bacteria 5355
164 Ga0495649_0013602 3300046694 Bacteria 4691
165 Ga0495649_0068384 3300046694 Bacteria 1906
166 Ga0495600_0091435 3300046809 Bacteria 1985
167 Ga0495604_0020860 3300047317 Bacteria 5231
168 Ga0495636_0007145 3300047318 Bacteria 4395
169 Ga0495683_0042380 3300047323 Bacteria 2295
170 Ga0495683_0091908 3300047323 Bacteria 1469
171 Ga0495687_007130 3300047443 Bacteria 6663
172 Ga0495677_0005424 3300047445 Bacteria 4833
173 Ga0495679_047723 3300047446 Bacteria 1298
174 Ga0495681_0033634 3300047470 Bacteria 2564
175 Ga0495686_0066197 3300047472 Bacteria 2233
176 Ga0496102_0006800 3300048905 Bacteria 9758
177 Ga0496102_0050647 3300048905 Bacteria 3782
178 Ga0496103_0026237 3300048906 Bacteria 3527
179 Ga0496104_0010574 3300048907 Bacteria 8242
180 Ga0496104_0059365 3300048907 Bacteria 3621
181 Ga0496105_0009308 3300048908 Bacteria 7677
182 Ga0496105_0027913 3300048908 Bacteria 4615
183 Ga0496108_0101625 3300048911 Bacteria 2453
184 Ga0496109_0105777 3300048912 Bacteria 2614
185 Ga0496110_0055490 3300048913 Bacteria 3486
186 Ga0496111_0052422 3300048914 Bacteria 2946
187 Ga0496112_0157943 3300048915 Bacteria 2234
188 Ga0496117_0085790 3300048920 Bacteria 2048
189 Ga0496119_0006875 3300048922 Bacteria 10389
190 Ga0496119_0113133 3300048922 Bacteria 1503
191 Ga0496120_0054229 3300048923 Bacteria 2273
192 Ga0496121_0000901 3300048924 Bacteria 53579
193 Ga0496121_0019369 3300048924 Bacteria 6807
194 Ga0496121_0026416 3300048924 Bacteria 5473
195 Ga0496125_0070987 3300048928 Bacteria 2723
196 Ga0496126_0066563 3300048929 Bacteria 3221
197 Ga0495682_0002871 3300049460 Bacteria 7928
198 Ga0495682_0005537 3300049460 Bacteria 5230
199 Ga0495682_0006499 3300049460 Bacteria 4722
200 Ga0501303_001203 3300049526 Bacteria 1932
201 Ga0501257_010404 3300049686 Bacteria 2110
202 Ga0501265_003785 3300049762 Bacteria 1717
203 nmdc:mga03683_22549_c1 3300050489 Bacteria 2442
204 nmdc:mga03683_40523_c1 3300050489 Bacteria 1910
205 nmdc:mga03683_9309_c1 3300050489 Bacteria 3486
206 nmdc:mga03n38_45388_c1 3300050490 Bacteria 1935
207 nmdc:mga00v17_20209_c1 3300050491 Bacteria 3812
208 nmdc:mga0yw44_12805_c1 3300050492 Bacteria 4388
209 nmdc:mga0yw44_67137_c1 3300050492 Bacteria 2216
210 nmdc:mga0k408_15908_c1 3300050493 Bacteria 4166
211 nmdc:mga0k408_78866_c1 3300050493 Bacteria 1927
212 nmdc:mga04h51_93694_c1 3300050495 Bacteria 1085
213 nmdc:mga07m45_19442_c1 3300050496 Bacteria 3681
214 nmdc:mga05p37_205286_c1 3300050507 Bacteria 2384
215 nmdc:mga0sz30_58128_c1 3300050516 Bacteria 1648
216 nmdc:mga0sz30_97180_c1 3300050516 Bacteria 1285
217 Ga0500635_0077219 3300053080 Bacteria 1191
218 Ga0500583_0013492 3300053092 Bacteria 3163
219 Ga0500566_0038498 3300053094 Bacteria 2767
220 Ga0500557_000147 3300053105 Bacteria 16461
221 Ga0500562_005475 3300053108 Bacteria 3187
222 Ga0500562_048307 3300053108 Bacteria 1137
223 Ga0500608_128249 3300053122 Bacteria 1141
224 Ga0500559_0017313 3300053136 Bacteria 3042
225 Ga0500559_0020698 3300053136 Bacteria 2783
226 Ga0500577_0063644 3300053142 Bacteria 1426
227 Ga0500616_0023969 3300053153 Bacteria 3396
228 Ga0500622_0002593 3300053156 Bacteria 12880
229 Ga0500622_0038376 3300053156 Bacteria 2498
230 Ga0500638_050561 3300053162 Bacteria 2010
231 Ga0500636_0001033 3300053177 Bacteria 14911
232 Ga0500637_0106759 3300053178 Bacteria 1624
233 Ga0500625_005596 3300053729 Bacteria 5272
234 Ga0500645_024263 3300053730 Bacteria 1854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2935926038 2935932426 292
2 iso_pu_bacteria 2935934488 2935941024 292
3 iso_pu_bacteria 2935942939 2935949083 292
4 iso_pu_bacteria 2935951376 2935957778 292
5 iso_pu_bacteria 2935967501 2935974101 292
6 3300047446 Ga0495679_047723 Ga0495679_047723_12_914 300
7 3300013297 Ga0157378_10188153 Ga0157378_101881532 304
8 3300009147 Ga0114129_10104339 Ga0114129_101043392 310
9 3300046512 Ga0495610_0135016 Ga0495610_0135016_72_1007 310
10 3300050489 nmdc:mga03683_22549_c1 nmdc:mga03683_22549_c1_1015_1950 310
11 3300050493 nmdc:mga0k408_78866_c1 nmdc:mga0k408_78866_c1_690_1625 310
12 3300050507 nmdc:mga05p37_205286_c1 nmdc:mga05p37_205286_c1_563_1498 310
13 3300050516 nmdc:mga0sz30_97180_c1 nmdc:mga0sz30_97180_c1_277_1212 310
14 3300053092 Ga0500583_0013492 Ga0500583_0013492_1160_2095 310
15 3300053142 Ga0500577_0063644 Ga0500577_0063644_434_1369 310
16 3300046694 Ga0495649_0068384 Ga0495649_0068384_927_1874 314
17 iso_pu_bacteria 2885080285 2885083120 315
18 iso_pu_bacteria 2904699407 2904703222 323
19 iso_pu_bacteria 8006933436 8006941279 328
20 iso_pu_bacteria 8006973647 8006980514 328
21 iso_pu_bacteria 2507262055 2507506830 329
22 iso_pu_bacteria 2508501009 2508540847 329
23 iso_pu_bacteria 2513237094 2513637248 329
24 iso_pu_bacteria 2513237139 2513875211 329
25 iso_pu_bacteria 2515154112 2515629544 329
26 iso_pu_bacteria 2517093001 2517107848 329
27 iso_pu_bacteria 2599185302 2599945189 329
28 iso_pu_bacteria 2599185304 2599955459 329
29 iso_pu_bacteria 2599185309 2599984364 329
30 iso_pu_bacteria 2599185310 2599990465 329
31 iso_pu_bacteria 2599185312 2600001593 329
32 iso_pu_bacteria 2599185320 2600049172 329
33 iso_pu_bacteria 2600255292 2601668525 329
34 iso_pu_bacteria 2667528175 2671118204 329
35 iso_pu_bacteria 2687453341 2688391920 329
36 iso_pu_bacteria 2802429603 2805919581 329
37 iso_pu_bacteria 2824671348 2824675207 329
38 iso_pu_bacteria 2824687955 2824690045 329
39 iso_pu_bacteria 2824773399 2824777924 329
40 iso_pu_bacteria 2847939898 2847943629 329
41 iso_pu_bacteria 2857547612 2857550749 329
42 iso_pu_bacteria 2874590934 2874594067 329
43 iso_pu_bacteria 2876771140 2876774067 329
44 iso_pu_bacteria 2876818435 2876821019 329
45 iso_pu_bacteria 2879074833 2879078844 329
46 iso_pu_bacteria 2879127579 2879128969 329
47 iso_pu_bacteria 2879142872 2879144323 329
48 iso_pu_bacteria 2922425934 2922433499 329
49 iso_pu_bacteria 2932410948 2932416607 329
50 iso_pu_bacteria 2932416698 2932418158 329
51 iso_pu_bacteria 2935608549 2935615886 329
52 iso_pu_bacteria 2935648319 2935653928 329
53 iso_pu_bacteria 2935656913 2935662677 329
54 iso_pu_bacteria 2935819856 2935826833 329
55 iso_pu_bacteria 2935847175 2935854013 329
56 iso_pu_bacteria 2935916978 2935923214 329
57 iso_pu_bacteria 2935975950 2935981402 329
58 iso_pu_bacteria 2935984226 2935990244 329
59 iso_pu_bacteria 2936011229 2936015322 329
60 iso_pu_bacteria 2936019824 2936023956 329
61 iso_pu_bacteria 2936028420 2936032971 329
62 iso_pu_bacteria 2936046547 2936051064 329
63 iso_pu_bacteria 2936055302 2936058464 329
64 iso_pu_bacteria 3005710791 3005715621 329
65 iso_pu_bacteria 8016630954 8016634029 329
66 iso_pu_bacteria 8019629233 8019632430 329
67 iso_pu_bacteria 8019638758 8019647451 329
68 iso_pu_bacteria 8019678201 8019686314 329
69 iso_pu_bacteria 8055266321 8055273877 329
70 iso_pu_bacteria 8056967851 8056974850 329
71 3300031344 Ga0265316_10022440 Ga0265316_100224407 332
72 3300042142 Ga0450905_010763 Ga0450905_010763_106_1104 332
73 3300044712 Ga0453684_0062053 Ga0453684_0062053_952_1950 332
74 3300045051 Ga0451576_0153526 Ga0451576_0153526_820_1818 332
75 3300002244 JGI24742J22300_10001982 JGI24742J22300_100019822 333
76 3300003187 JGI25151J46595_10015123 JGI25151J46595_100151232 333
77 3300003215 JGI25153J46596_10000188 JGI25153J46596_1000018838 333
78 3300003215 JGI25153J46596_10000525 JGI25153J46596_1000052518 333
79 3300003792 Ga0055540_1000058 Ga0055540_100005844 333
80 3300003794 Ga0055531_10000453 Ga0055531_1000045331 333
81 3300003794 Ga0055531_10002582 Ga0055531_100025823 333
82 3300005331 Ga0070670_100081813 Ga0070670_1000818133 333
83 3300005355 Ga0070671_100136340 Ga0070671_1001363402 333
84 3300005366 Ga0070659_100090912 Ga0070659_1000909122 333
85 3300005366 Ga0070659_100224614 Ga0070659_1002246141 333
86 3300005367 Ga0070667_100154492 Ga0070667_1001544922 333
87 3300005434 Ga0070709_10000418 Ga0070709_1000041818 333
88 3300005435 Ga0070714_100055063 Ga0070714_1000550633 333
89 3300005436 Ga0070713_100083236 Ga0070713_1000832363 333
90 3300005439 Ga0070711_100006912 Ga0070711_1000069127 333
91 3300005455 Ga0070663_100124817 Ga0070663_1001248172 333
92 3300005457 Ga0070662_100114376 Ga0070662_1001143762 333
93 3300005471 Ga0070698_100127593 Ga0070698_1001275933 333
94 3300005614 Ga0068856_100039350 Ga0068856_1000393503 333
95 3300005614 Ga0068856_100254511 Ga0068856_1002545112 333
96 3300005615 Ga0070702_100060658 Ga0070702_1000606583 333
97 3300005618 Ga0068864_100216172 Ga0068864_1002161721 333
98 3300005841 Ga0068863_100166657 Ga0068863_1001666572 333
99 3300005841 Ga0068863_100261864 Ga0068863_1002618642 333
100 3300005843 Ga0068860_100052783 Ga0068860_1000527832 333
101 3300005843 Ga0068860_100088883 Ga0068860_1000888832 333
102 3300006028 Ga0070717_10072984 Ga0070717_100729843 333
103 3300006028 Ga0070717_10116357 Ga0070717_101163572 333
104 3300006028 Ga0070717_10317333 Ga0070717_103173332 333
105 3300006038 Ga0075365_10044098 Ga0075365_100440982 333
106 3300006038 Ga0075365_10058700 Ga0075365_100587002 333
107 3300006048 Ga0075363_100025737 Ga0075363_1000257374 333
108 3300006048 Ga0075363_100120935 Ga0075363_1001209352 333
109 3300006051 Ga0075364_10022385 Ga0075364_100223853 333
110 3300006051 Ga0075364_10098322 Ga0075364_100983222 333
111 3300006177 Ga0075362_10024268 Ga0075362_100242682 333
112 3300006178 Ga0075367_10035194 Ga0075367_100351942 333
113 3300006195 Ga0075366_10005933 Ga0075366_100059333 333
114 3300006195 Ga0075366_10018421 Ga0075366_100184214 333
115 3300006195 Ga0075366_10030913 Ga0075366_100309133 333
116 3300006844 Ga0075428_100058687 Ga0075428_1000586873 333
117 3300009011 Ga0105251_10106787 Ga0105251_101067871 333
118 3300009093 Ga0105240_10002438 Ga0105240_1000243831 333
119 3300009098 Ga0105245_10072788 Ga0105245_100727883 333
120 3300009101 Ga0105247_10039755 Ga0105247_100397553 333
121 3300009101 Ga0105247_10051593 Ga0105247_100515932 333
122 3300009176 Ga0105242_10380144 Ga0105242_103801441 333
123 3300009545 Ga0105237_10006022 Ga0105237_100060229 333
124 3300009551 Ga0105238_10085005 Ga0105238_100850053 333
125 3300009553 Ga0105249_10161694 Ga0105249_101616942 333
126 3300010375 Ga0105239_10031513 Ga0105239_100315135 333
127 3300010375 Ga0105239_10271504 Ga0105239_102715042 333
128 3300011119 Ga0105246_10014245 Ga0105246_100142454 333
129 3300012513 Ga0157326_1002277 Ga0157326_10022772 333
130 3300013296 Ga0157374_10072347 Ga0157374_100723472 333
131 3300013306 Ga0163162_10027168 Ga0163162_100271685 333
132 3300014969 Ga0157376_10178833 Ga0157376_101788332 333
133 3300015261 Ga0182006_1000019 Ga0182006_1000019183 333
134 3300015262 Ga0182007_10026421 Ga0182007_100264212 333
135 3300015265 Ga0182005_1000005 Ga0182005_100000526 333
136 3300017792 Ga0163161_10004279 Ga0163161_100042794 333
137 3300025230 Ga0209563_100011 Ga0209563_100011871 333
138 3300025245 Ga0207425_1001668 Ga0207425_10016685 333
139 3300025253 Ga0209677_103240 Ga0209677_1032403 333
140 3300025261 Ga0209233_1002454 Ga0209233_10024547 333
141 3300025272 Ga0209455_1010373 Ga0209455_10103731 333
142 3300025284 Ga0209130_1000276 Ga0209130_100027644 333
143 3300025292 Ga0209676_1000023 Ga0209676_1000023167 333
144 3300025294 Ga0209025_1008532 Ga0209025_10085322 333
145 3300025294 Ga0209025_1019067 Ga0209025_10190673 333
146 3300025295 Ga0209564_1003426 Ga0209564_10034265 333
147 3300025297 Ga0209758_1000117 Ga0209758_1000117119 333
148 3300025298 Ga0209050_1000022 Ga0209050_1000022149 333
149 3300025302 Ga0207426_1001594 Ga0207426_100159411 333
150 3300025303 Ga0209051_1000013 Ga0209051_1000013149 333
151 3300025304 Ga0209257_1000042 Ga0209257_1000042337 333
152 3300025304 Ga0209257_1001342 Ga0209257_100134213 333
153 3300025304 Ga0209257_1011573 Ga0209257_10115732 333
154 3300025898 Ga0207692_10028829 Ga0207692_100288291 333
155 3300025904 Ga0207647_10002342 Ga0207647_100023428 333
156 3300025906 Ga0207699_10001353 Ga0207699_100013539 333
157 3300025911 Ga0207654_10029952 Ga0207654_100299522 333
158 3300025913 Ga0207695_10000157 Ga0207695_1000015786 333
159 3300025913 Ga0207695_10155012 Ga0207695_101550122 333
160 3300025914 Ga0207671_10004425 Ga0207671_100044259 333
161 3300025919 Ga0207657_10014161 Ga0207657_100141614 333
162 3300025927 Ga0207687_10200233 Ga0207687_102002332 333
163 3300025928 Ga0207700_10018958 Ga0207700_100189581 333
164 3300025929 Ga0207664_10027737 Ga0207664_100277375 333
165 3300025932 Ga0207690_10085591 Ga0207690_100855913 333
166 3300025933 Ga0207706_10110252 Ga0207706_101102522 333
167 3300025941 Ga0207711_10038252 Ga0207711_100382524 333
168 3300025945 Ga0207679_10142375 Ga0207679_101423752 333
169 3300026067 Ga0207678_10030737 Ga0207678_100307372 333
170 3300026078 Ga0207702_10057175 Ga0207702_100571752 333
171 3300026116 Ga0207674_10078699 Ga0207674_100786992 333
172 3300027111 Ga0209281_1002325 Ga0209281_10023255 333
173 3300027866 Ga0209813_10005368 Ga0209813_100053682 333
174 3300028380 Ga0268265_10070047 Ga0268265_100700472 333
175 3300028794 Ga0307515_10077004 Ga0307515_100770043 333
176 3300030731 Ga0316177_1112397 Ga0316177_11123972 333
177 3300031239 Ga0265328_10000445 Ga0265328_1000044511 333
178 3300031250 Ga0265331_10000082 Ga0265331_1000008247 333
179 3300031616 Ga0307508_10000116 Ga0307508_1000011618 333
180 3300031730 Ga0307516_10001248 Ga0307516_100012483 333
181 3300031903 Ga0307407_10000111 Ga0307407_1000011121 333
182 3300032002 Ga0307416_100033201 Ga0307416_1000332013 333
183 3300032002 Ga0307416_100085799 Ga0307416_1000857991 333
184 3300032004 Ga0307414_10000015 Ga0307414_10000015221 333
185 3300033180 Ga0307510_10008288 Ga0307510_1000828811 333
186 3300037312 Ga0395899_0006273 Ga0395899_0006273_5345_6352 333
187 3300037418 Ga0395900_0000715 Ga0395900_0000715_39228_40235 333
188 3300044712 Ga0453684_0048409 Ga0453684_0048409_3488_4489 333
189 3300046452 Ga0495617_009909 Ga0495617_009909_1505_2509 333
190 3300046455 Ga0495603_0083933 Ga0495603_0083933_644_1648 333
191 3300046460 Ga0495638_0003348 Ga0495638_0003348_11349_12350 333
192 3300046460 Ga0495638_0004099 Ga0495638_0004099_6345_7349 333
193 3300046472 Ga0495580_0250939 Ga0495580_0250939_28_1032 333
194 3300046474 Ga0495605_0052740 Ga0495605_0052740_649_1653 333
195 3300046474 Ga0495605_0059079 Ga0495605_0059079_751_1755 333
196 3300046491 Ga0495584_0010518 Ga0495584_0010518_1710_2717 333
197 3300046491 Ga0495584_0011867 Ga0495584_0011867_1781_2812 333
198 3300046491 Ga0495584_0131805 Ga0495584_0131805_196_1197 333
199 3300046492 Ga0495585_0132240 Ga0495585_0132240_249_1253 333
200 3300046501 Ga0495607_0001440 Ga0495607_0001440_19115_20116 333
201 3300046506 Ga0495583_0029755 Ga0495583_0029755_845_1852 333
202 3300046507 Ga0495606_0005644 Ga0495606_0005644_10261_11262 333
203 3300046507 Ga0495606_0011622 Ga0495606_0011622_3667_4722 333
204 3300046507 Ga0495606_0048212 Ga0495606_0048212_1116_2120 333
205 3300046507 Ga0495606_0140652 Ga0495606_0140652_406_1410 333
206 3300046513 Ga0495616_0026305 Ga0495616_0026305_942_1952 333
207 3300046514 Ga0495618_0092425 Ga0495618_0092425_763_1767 333
208 3300046515 Ga0495620_0093925 Ga0495620_0093925_165_1169 333
209 3300046518 Ga0495631_0012348 Ga0495631_0012348_1831_2835 333
210 3300046519 Ga0495632_0022422 Ga0495632_0022422_1825_2829 333
211 3300046522 Ga0495643_0072277 Ga0495643_0072277_735_1739 333
212 3300046523 Ga0495644_0032832 Ga0495644_0032832_879_1883 333
213 3300046524 Ga0495648_0038524 Ga0495648_0038524_73_1077 333
214 3300046524 Ga0495648_0128475 Ga0495648_0128475_260_1264 333
215 3300046538 Ga0495609_0000163 Ga0495609_0000163_32602_33612 333
216 3300046557 Ga0495622_0046937 Ga0495622_0046937_878_1885 333
217 3300046557 Ga0495622_0079132 Ga0495622_0079132_387_1391 333
218 3300046558 Ga0495633_0003871 Ga0495633_0003871_7465_8472 333
219 3300046616 Ga0495668_0035952 Ga0495668_0035952_1221_2225 333
220 3300046616 Ga0495668_0093921 Ga0495668_0093921_150_1157 333
221 3300046660 Ga0495625_0021631 Ga0495625_0021631_2272_3279 333
222 3300046660 Ga0495625_0034690 Ga0495625_0034690_1738_2742 333
223 3300046660 Ga0495625_0095573 Ga0495625_0095573_627_1631 333
224 3300046663 Ga0495635_0032072 Ga0495635_0032072_2254_3258 333
225 3300046675 Ga0495657_0013474 Ga0495657_0013474_1970_2974 333
226 3300046684 Ga0495669_0003937 Ga0495669_0003937_3955_4962 333
227 3300046689 Ga0495613_0026120 Ga0495613_0026120_2943_3947 333
228 3300046690 Ga0495624_0148109 Ga0495624_0148109_25_1029 333
229 3300046692 Ga0495671_0019318 Ga0495671_0019318_1867_2871 333
230 3300046694 Ga0495649_0010896 Ga0495649_0010896_3969_4979 333
231 3300046694 Ga0495649_0013602 Ga0495649_0013602_2400_3404 333
232 3300046809 Ga0495600_0091435 Ga0495600_0091435_758_1762 333
233 3300047317 Ga0495604_0020860 Ga0495604_0020860_2635_3639 333
234 3300047318 Ga0495636_0007145 Ga0495636_0007145_946_1953 333
235 3300047323 Ga0495683_0042380 Ga0495683_0042380_993_1997 333
236 3300047323 Ga0495683_0091908 Ga0495683_0091908_39_1043 333
237 3300047443 Ga0495687_007130 Ga0495687_007130_2051_3061 333
238 3300047445 Ga0495677_0005424 Ga0495677_0005424_359_1369 333
239 3300047470 Ga0495681_0033634 Ga0495681_0033634_555_1565 333
240 3300047472 Ga0495686_0066197 Ga0495686_0066197_952_1956 333
241 3300048905 Ga0496102_0006800 Ga0496102_0006800_495_1610 333
242 3300048905 Ga0496102_0050647 Ga0496102_0050647_54_1061 333
243 3300048906 Ga0496103_0026237 Ga0496103_0026237_2357_3502 333
244 3300048907 Ga0496104_0010574 Ga0496104_0010574_6571_7575 333
245 3300048907 Ga0496104_0059365 Ga0496104_0059365_2455_3600 333
246 3300048908 Ga0496105_0009308 Ga0496105_0009308_3917_4921 333
247 3300048908 Ga0496105_0027913 Ga0496105_0027913_482_1486 333
248 3300048911 Ga0496108_0101625 Ga0496108_0101625_955_1959 333
249 3300048912 Ga0496109_0105777 Ga0496109_0105777_1041_2045 333
250 3300048913 Ga0496110_0055490 Ga0496110_0055490_303_1307 333
251 3300048914 Ga0496111_0052422 Ga0496111_0052422_1168_2283 333
252 3300048915 Ga0496112_0157943 Ga0496112_0157943_281_1396 333
253 3300048920 Ga0496117_0085790 Ga0496117_0085790_665_1780 333
254 3300048922 Ga0496119_0006875 Ga0496119_0006875_8607_9611 333
255 3300048922 Ga0496119_0113133 Ga0496119_0113133_363_1478 333
256 3300048923 Ga0496120_0054229 Ga0496120_0054229_660_1664 333
257 3300048924 Ga0496121_0000901 Ga0496121_0000901_3907_4914 333
258 3300048924 Ga0496121_0019369 Ga0496121_0019369_1218_2219 333
259 3300048924 Ga0496121_0026416 Ga0496121_0026416_3056_4060 333
260 3300048928 Ga0496125_0070987 Ga0496125_0070987_568_1623 333
261 3300048929 Ga0496126_0066563 Ga0496126_0066563_1950_2951 333
262 3300049460 Ga0495682_0002871 Ga0495682_0002871_3887_4894 333
263 3300049460 Ga0495682_0005537 Ga0495682_0005537_3265_4269 333
264 3300049460 Ga0495682_0006499 Ga0495682_0006499_1005_2006 333
265 3300049526 Ga0501303_001203 Ga0501303_001203_232_1233 333
266 3300049686 Ga0501257_010404 Ga0501257_010404_484_1485 333
267 3300049762 Ga0501265_003785 Ga0501265_003785_687_1688 333
268 3300050489 nmdc:mga03683_40523_c1 nmdc:mga03683_40523_c1_698_1843 333
269 3300050489 nmdc:mga03683_9309_c1 nmdc:mga03683_9309_c1_1121_2122 333
270 3300050490 nmdc:mga03n38_45388_c1 nmdc:mga03n38_45388_c1_332_1447 333
271 3300050491 nmdc:mga00v17_20209_c1 nmdc:mga00v17_20209_c1_1107_2108 333
272 3300050492 nmdc:mga0yw44_12805_c1 nmdc:mga0yw44_12805_c1_2636_3751 333
273 3300050492 nmdc:mga0yw44_67137_c1 nmdc:mga0yw44_67137_c1_929_1933 333
274 3300050493 nmdc:mga0k408_15908_c1 nmdc:mga0k408_15908_c1_2012_3013 333
275 3300050495 nmdc:mga04h51_93694_c1 nmdc:mga04h51_93694_c1_29_1033 333
276 3300050496 nmdc:mga07m45_19442_c1 nmdc:mga07m45_19442_c1_2010_3155 333
277 3300050516 nmdc:mga0sz30_58128_c1 nmdc:mga0sz30_58128_c1_500_1501 333
278 3300053080 Ga0500635_0077219 Ga0500635_0077219_136_1137 333
279 3300053094 Ga0500566_0038498 Ga0500566_0038498_88_1089 333
280 3300053105 Ga0500557_000147 Ga0500557_000147_5238_6239 333
281 3300053108 Ga0500562_005475 Ga0500562_005475_1636_2640 333
282 3300053108 Ga0500562_048307 Ga0500562_048307_107_1111 333
283 3300053122 Ga0500608_128249 Ga0500608_128249_92_1093 333
284 3300053136 Ga0500559_0017313 Ga0500559_0017313_758_1759 333
285 3300053136 Ga0500559_0020698 Ga0500559_0020698_173_1177 333
286 3300053153 Ga0500616_0023969 Ga0500616_0023969_1527_2531 333
287 3300053156 Ga0500622_0002593 Ga0500622_0002593_5640_6641 333
288 3300053156 Ga0500622_0038376 Ga0500622_0038376_815_1819 333
289 3300053162 Ga0500638_050561 Ga0500638_050561_337_1338 333
290 3300053177 Ga0500636_0001033 Ga0500636_0001033_7937_8938 333
291 3300053178 Ga0500637_0106759 Ga0500637_0106759_135_1136 333
292 3300053729 Ga0500625_005596 Ga0500625_005596_2896_3897 333
293 3300053730 Ga0500645_024263 Ga0500645_024263_661_1665 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

187

330

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

26

115

0.89

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

156

254

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9008 1 333
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9006 2 331
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8986 1 331
2vn8-assembly2.cif.gz_B crystal structure of human reticulon 4 interacting protein 1 in complex with nadph 0.8965 2 331
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8927 1 333
ID Description Score Start End Superfamily
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9563 16 114 3.90.180.10
af_Q0JDV3_9_115_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9484 1 93 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.947 16 114 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9461 15 136 3.90.180.10
af_A0A1D6J5A6_4_169_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9439 1 119 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A1H9KD53-F1-model_v4 NADPH:quinone reductase 0.9922 1 333 GO:0016491
AF-A0A0P9PCY9-F1-model_v4 Oxidoreductase zinc-binding protein 0.991 1 333 GO:0016491
AF-A0A1H9KD53-F1-model_v4 NADPH:quinone reductase 0.9892 1 333 GO:0016491
AF-A0A2V7NA27-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9856 1 333 GO:0008270
GO:0016491
AF-A0A2V7NA27-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9827 1 333 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.59 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map