F391703

General Info

Members Datasets Scaffolds Average Seq Length
293 172 586 97

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0598010|Ga0496107_0598010_414_752
Length 112
Sequence MSAVADTACRIDVWLWRARFFKTRSLAASFVEQGRVRLSRAGQDDVRLDKPSRTVRPGDGVVFAIGGRLFALRIEACGERRGPASEARDLYADLSPLGASGDADEPADRSGG

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
163 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
166 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
167 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
168 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
172 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 6.48
Rhizosphere 83.62
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0598010 3300048910 Bacteria 815
2 Ga0070658_10074994 3300005327 Bacteria 2774
3 Ga0070658_10222584 3300005327 Bacteria 1596
4 Ga0070658_10370773 3300005327 Bacteria 1227
5 Ga0070658_10620638 3300005327 Bacteria 937
6 Ga0070658_10847350 3300005327 Bacteria 794
7 Ga0068869_100024274 3300005334 Bacteria 4199
8 Ga0070680_100172302 3300005336 Bacteria 1821
9 Ga0070680_101565532 3300005336 Bacteria 571
10 Ga0070660_100083299 3300005339 Bacteria 2512
11 Ga0070660_100092013 3300005339 Bacteria 2393
12 Ga0070691_10102836 3300005341 Bacteria 1421
13 Ga0070668_100001060 3300005347 Bacteria 19339
14 Ga0070671_100009271 3300005355 Bacteria 7906
15 Ga0070671_100144296 3300005355 Bacteria 2009
16 Ga0070671_100222846 3300005355 Bacteria 1600
17 Ga0070671_100317374 3300005355 Bacteria 1328
18 Ga0070659_100004793 3300005366 Bacteria 9668
19 Ga0070659_100434216 3300005366 Bacteria 1112
20 Ga0070667_100006944 3300005367 Bacteria 9407
21 Ga0070667_100971305 3300005367 Bacteria 792
22 Ga0070711_100717284 3300005439 Bacteria 843
23 Ga0070700_101608767 3300005441 Bacteria 555
24 Ga0070678_100341638 3300005456 Bacteria 1284
25 Ga0070662_101363655 3300005457 Bacteria 611
26 Ga0070662_101620083 3300005457 Bacteria 559
27 Ga0070681_10016496 3300005458 Bacteria 7376
28 Ga0070681_10637363 3300005458 Bacteria 980
29 Ga0070679_100058479 3300005530 Bacteria 3841
30 Ga0070679_101290805 3300005530 Bacteria 676
31 Ga0070684_100631986 3300005535 Bacteria 996
32 Ga0068853_100118034 3300005539 Bacteria 2364
33 Ga0068853_100286496 3300005539 Bacteria 1519
34 Ga0070665_100000144 3300005548 Bacteria 132302
35 Ga0070665_100067629 3300005548 Bacteria 3582
36 Ga0070665_100189658 3300005548 Bacteria 2057
37 Ga0068855_100068089 3300005563 Bacteria 4145
38 Ga0068855_100395909 3300005563 Bacteria 1514
39 Ga0068855_101252139 3300005563 Bacteria 770
40 Ga0070664_100136812 3300005564 Bacteria 2155
41 Ga0070664_100832365 3300005564 Bacteria 864
42 Ga0070664_101010631 3300005564 Bacteria 782
43 Ga0068856_100172727 3300005614 Bacteria 2173
44 Ga0068856_100750933 3300005614 Bacteria 996
45 Ga0068856_101069971 3300005614 Bacteria 824
46 Ga0068856_101295542 3300005614 Bacteria 744
47 Ga0068859_100001088 3300005617 Bacteria 27740
48 Ga0068859_101150122 3300005617 Bacteria 854
49 Ga0068864_100320576 3300005618 Bacteria 1455
50 Ga0068864_100703131 3300005618 Unclassified 988
51 Ga0068864_100747711 3300005618 Bacteria 958
52 Ga0068861_101814435 3300005719 Bacteria 605
53 Ga0068863_100006335 3300005841 Bacteria 11605
54 Ga0068863_100292571 3300005841 Bacteria 1579
55 Ga0068858_100001420 3300005842 Bacteria 24630
56 Ga0068860_100000115 3300005843 Bacteria 128506
57 Ga0068860_100019462 3300005843 Bacteria 6582
58 Ga0068862_100046692 3300005844 Bacteria 3694
59 Ga0068862_100100773 3300005844 Bacteria 2526
60 Ga0068862_100633687 3300005844 Bacteria 1029
61 Ga0070717_10096464 3300006028 Bacteria 2505
62 Ga0097621_101210037 3300006237 Bacteria 712
63 Ga0097620_100001088 3300006931 Bacteria 27740
64 Ga0097620_101150142 3300006931 Bacteria 854
65 Ga0105240_10001080 3300009093 Bacteria 48123
66 Ga0105240_10098194 3300009093 Bacteria 3567
67 Ga0105240_10174817 3300009093 Bacteria 2539
68 Ga0105240_10220751 3300009093 Bacteria 2209
69 Ga0105240_10358879 3300009093 Bacteria 1651
70 Ga0105247_10429182 3300009101 Bacteria 948
71 Ga0105241_10083735 3300009174 Bacteria 2503
72 Ga0105241_10888848 3300009174 Bacteria 826
73 Ga0105241_12541671 3300009174 Bacteria 513
74 Ga0105242_10364821 3300009176 Bacteria 1338
75 Ga0105248_10007703 3300009177 Bacteria 11833
76 Ga0105248_10371929 3300009177 Bacteria 1609
77 Ga0105248_10667386 3300009177 Bacteria 1173
78 Ga0105237_11017732 3300009545 Bacteria 835
79 Ga0105238_10102499 3300009551 Bacteria 2844
80 Ga0105238_10419971 3300009551 Bacteria 1332
81 Ga0105239_10084995 3300010375 Bacteria 3486
82 Ga0105239_10770253 3300010375 Bacteria 1102
83 Ga0157373_10003642 3300013100 Bacteria 11642
84 Ga0157370_10443056 3300013104 Bacteria 1194
85 Ga0163162_10058919 3300013306 Bacteria 3871
86 Ga0157375_10310167 3300013308 Bacteria 1742
87 Ga0157375_10663110 3300013308 Bacteria 1199
88 Ga0163163_10011534 3300014325 Bacteria 8026
89 Ga0163163_10161169 3300014325 Bacteria 2288
90 Ga0163163_10194167 3300014325 Bacteria 2078
91 Ga0163163_10287851 3300014325 Bacteria 1695
92 Ga0163163_10914358 3300014325 Bacteria 941
93 Ga0157379_10000663 3300014968 Bacteria 27864
94 Ga0157379_10610758 3300014968 Bacteria 1019
95 Ga0157379_12412970 3300014968 Bacteria 525
96 Ga0157376_10185535 3300014969 Bacteria 1904
97 Ga0213872_10034426 3300021361 Bacteria 2318
98 Ga0213872_10184250 3300021361 Bacteria 901
99 Ga0213876_10000074 3300021384 Bacteria 120394
100 Ga0213875_10598775 3300021388 Bacteria 532
101 Ga0207710_10282102 3300025900 Bacteria 836
102 Ga0207705_10314148 3300025909 Bacteria 1203
103 Ga0207705_10709925 3300025909 Bacteria 781
104 Ga0207654_10900784 3300025911 Bacteria 641
105 Ga0207707_10452021 3300025912 Bacteria 1099
106 Ga0207695_10001484 3300025913 Bacteria 39241
107 Ga0207695_10015986 3300025913 Bacteria 8808
108 Ga0207695_10136129 3300025913 Bacteria 2409
109 Ga0207663_10930307 3300025916 Bacteria 696
110 Ga0207660_10697584 3300025917 Bacteria 828
111 Ga0207657_10223187 3300025919 Bacteria 1509
112 Ga0207652_10218057 3300025921 Bacteria 1719
113 Ga0207681_10037552 3300025923 Bacteria 3202
114 Ga0207644_10027716 3300025931 Bacteria 3915
115 Ga0207644_10241909 3300025931 Bacteria 1437
116 Ga0207690_10376834 3300025932 Bacteria 1127
117 Ga0207690_10534525 3300025932 Bacteria 951
118 Ga0207706_10094554 3300025933 Bacteria 2629
119 Ga0207691_10161680 3300025940 Bacteria 1964
120 Ga0207711_10014420 3300025941 Bacteria 6564
121 Ga0207711_10386949 3300025941 Bacteria 1298
122 Ga0207661_10884439 3300025944 Bacteria 823
123 Ga0207661_11101668 3300025944 Bacteria 731
124 Ga0207679_10070325 3300025945 Bacteria 2637
125 Ga0207679_10266571 3300025945 Bacteria 1463
126 Ga0207667_10025769 3300025949 Bacteria 6433
127 Ga0207667_10040529 3300025949 Bacteria 4959
128 Ga0207668_10003734 3300025972 Bacteria 8959
129 Ga0207668_10189084 3300025972 Bacteria 1630
130 Ga0207658_10005254 3300025986 Bacteria 8908
131 Ga0207658_10627178 3300025986 Bacteria 967
132 Ga0207658_10680801 3300025986 Bacteria 928
133 Ga0207658_10925832 3300025986 Bacteria 794
134 Ga0207703_10011867 3300026035 Bacteria 6784
135 Ga0207703_11242660 3300026035 Bacteria 716
136 Ga0207639_10038342 3300026041 Bacteria 3564
137 Ga0207639_11462069 3300026041 Bacteria 641
138 Ga0207702_10341100 3300026078 Bacteria 1431
139 Ga0207702_10715597 3300026078 Bacteria 987
140 Ga0207702_10907756 3300026078 Bacteria 873
141 Ga0207702_11767332 3300026078 Bacteria 611
142 Ga0207641_10009728 3300026088 Bacteria 7918
143 Ga0207641_10065361 3300026088 Bacteria 3112
144 Ga0207641_10208634 3300026088 Bacteria 1805
145 Ga0207648_11396922 3300026089 Bacteria 658
146 Ga0207676_10985227 3300026095 Bacteria 830
147 Ga0207676_11886335 3300026095 Bacteria 596
148 Ga0207674_11624185 3300026116 Bacteria 615
149 Ga0207675_100184530 3300026118 Bacteria 1999
150 Ga0207675_100540381 3300026118 Bacteria 1164
151 Ga0207683_10260205 3300026121 Bacteria 1584
152 Ga0268266_10000003 3300028379 Bacteria 1701703
153 Ga0268266_10044862 3300028379 Bacteria 3780
154 Ga0268266_10158613 3300028379 Bacteria 2045
155 Ga0268266_11617011 3300028379 Bacteria 623
156 Ga0268265_10000654 3300028380 Bacteria 34397
157 Ga0268265_10044824 3300028380 Bacteria 3296
158 Ga0268265_10111741 3300028380 Bacteria 2232
159 Ga0268264_10000002 3300028381 Bacteria 1153045
160 Ga0268264_10034908 3300028381 Bacteria 4139
161 Ga0265334_10101749 3300028573 Bacteria 1040
162 Ga0307517_10000705 3300028786 Bacteria 57524
163 Ga0307515_10131386 3300028794 Bacteria 2755
164 Ga0265324_10154650 3300029957 Bacteria 779
165 Ga0265331_10363273 3300031250 Bacteria 649
166 Ga0265327_10007698 3300031251 Bacteria 8244
167 Ga0265327_10053042 3300031251 Bacteria 2107
168 Ga0307513_10000208 3300031456 Bacteria 84906
169 Ga0307513_10000764 3300031456 Bacteria 46492
170 Ga0307513_10011796 3300031456 Bacteria 10833
171 Ga0265314_10229340 3300031711 Bacteria 1078
172 Ga0307413_10413945 3300031824 Bacteria 1060
173 Ga0307415_101501814 3300032126 Bacteria 645
174 Ga0373923_0337766 3300035111 Bacteria 718
175 Ga0373936_0004819 3300035113 Bacteria 5090
176 Ga0373931_0396003 3300035691 Unclassified 873
177 Ga0373935_0072316 3300035692 Bacteria 2226
178 Ga0373947_0319162 3300035725 Bacteria 1039
179 Ga0373937_1086596 3300036401 Bacteria 749
180 Ga0373925_1159957 3300037068 Bacteria 635
181 Ga0395899_0035405 3300037312 Bacteria 3748
182 Ga0395900_0211872 3300037418 Bacteria 1956
183 Ga0395900_1376961 3300037418 Bacteria 619
184 Ga0395898_0897273 3300037466 Bacteria 825
185 Ga0395898_1749036 3300037466 Bacteria 544
186 Ga0395905_0136180 3300037471 Bacteria 2310
187 Ga0395905_0308518 3300037471 Bacteria 1471
188 Ga0436364_0034797 3300037853 Bacteria 1749
189 Ga0436364_0995651 3300037853 Bacteria 943
190 Ga0436364_1383506 3300037853 Bacteria 763
191 Ga0395901_0007043 3300038443 Bacteria 11366
192 Ga0395901_0617040 3300038443 Unclassified 1092
193 Ga0436365_0980217 3300039437 Bacteria 43548
194 Ga0436365_1256094 3300039437 Bacteria 14655
195 Ga0436365_1257587 3300039437 Bacteria 1584
196 Ga0436365_1484667 3300039437 Bacteria 715
197 Ga0436360_0084587 3300039438 Bacteria 697
198 Ga0436360_0429362 3300039438 Bacteria 1968
199 Ga0436360_0536177 3300039438 Bacteria 575
200 Ga0436360_0907379 3300039438 Bacteria 1173
201 Ga0436360_0966130 3300039438 Bacteria 2355
202 Ga0436360_1286479 3300039438 Bacteria 2532
203 Ga0436360_1315782 3300039438 Bacteria 1504
204 Ga0436361_0059429 3300039447 Bacteria 2099
205 Ga0436361_0247105 3300039447 Bacteria 569
206 Ga0436361_0320838 3300039447 Bacteria 2305
207 Ga0436361_0396573 3300039447 Bacteria 2201
208 Ga0436361_0525025 3300039447 Bacteria 1491
209 Ga0436361_0649173 3300039447 Bacteria 1448
210 Ga0436361_0657565 3300039447 Bacteria 1109
211 Ga0436361_0778353 3300039447 Bacteria 558
212 Ga0436361_0847512 3300039447 Bacteria 536
213 Ga0436361_0879833 3300039447 Bacteria 2630
214 Ga0436363_1387396 3300039450 Bacteria 4266
215 Ga0436362_0258600 3300039453 Unclassified 826
216 Ga0436362_0263722 3300039453 Bacteria 503
217 Ga0436362_0378223 3300039453 Bacteria 1658
218 Ga0436362_0419428 3300039453 Bacteria 688
219 Ga0451839_1549144 3300041496 Bacteria 633
220 Ga0466972_0236303 3300044658 Bacteria 855
221 Ga0466961_0462213 3300044693 Bacteria 768
222 Ga0466970_0141231 3300044765 Bacteria 1327
223 Ga0495590_0045374 3300046457 Bacteria 1533
224 Ga0495638_0000500 3300046460 Bacteria 46497
225 Ga0495585_0470387 3300046492 Bacteria 600
226 Ga0495583_0069482 3300046506 Bacteria 1551
227 Ga0495583_0351735 3300046506 Bacteria 581
228 Ga0495606_0482728 3300046507 Bacteria 629
229 Ga0495631_0009525 3300046518 Bacteria 4849
230 Ga0495637_0171359 3300046520 Bacteria 809
231 Ga0495648_0000374 3300046524 Bacteria 49240
232 Ga0495642_0042211 3300046528 Bacteria 1857
233 Ga0495642_0223290 3300046528 Bacteria 822
234 Ga0495642_0475168 3300046528 Bacteria 553
235 Ga0495654_0106841 3300046530 Bacteria 1281
236 Ga0495668_0053529 3300046616 Bacteria 2231
237 Ga0495668_0115510 3300046616 Bacteria 1468
238 Ga0495668_0536362 3300046616 Bacteria 646
239 Ga0495611_0008410 3300046648 Bacteria 4369
240 Ga0495625_0074622 3300046660 Bacteria 2375
241 Ga0495658_0367551 3300046683 Bacteria 915
242 Ga0495669_0102373 3300046684 Bacteria 1331
243 Ga0495670_0525454 3300046691 Bacteria 643
244 Ga0495674_0908554 3300047319 Unclassified 679
245 Ga0495672_0026727 3300047320 Bacteria 3678
246 Ga0495677_0117960 3300047445 Bacteria 1011
247 Ga0495673_0000950 3300047469 Bacteria 26209
248 Ga0495686_0002846 3300047472 Bacteria 15614
249 Ga0496100_0249799 3300048903 Bacteria 1312
250 Ga0496101_0121017 3300048904 Bacteria 1979
251 Ga0496102_0406599 3300048905 Bacteria 1279
252 Ga0496104_0437164 3300048907 Bacteria 1220
253 Ga0496105_0235282 3300048908 Bacteria 1488
254 Ga0496106_0503651 3300048909 Bacteria 973
255 Ga0496106_0631315 3300048909 Bacteria 857
256 Ga0496108_0342424 3300048911 Bacteria 1304
257 Ga0496109_0040643 3300048912 Bacteria 4212
258 Ga0496110_0096996 3300048913 Bacteria 2642
259 Ga0496112_0736774 3300048915 Bacteria 912
260 Ga0496112_0776042 3300048915 Bacteria 884
261 Ga0496112_1354855 3300048915 Bacteria 627
262 Ga0496113_1269169 3300048916 Bacteria 573
263 Ga0496115_0000481 3300048918 Bacteria 31582
264 Ga0496115_0010691 3300048918 Bacteria 6865
265 Ga0496115_0061747 3300048918 Bacteria 3022
266 Ga0496115_0946763 3300048918 Bacteria 661
267 Ga0496124_0165539 3300048927 Bacteria 1719
268 Ga0496126_0132563 3300048929 Unclassified 2152
269 Ga0501032_0486065 3300049569 Bacteria 789
270 Ga0501033_0617557 3300049570 Bacteria 742
271 Ga0501034_0697055 3300049571 Bacteria 914
272 Ga0501037_0050423 3300049573 Bacteria 3046
273 Ga0501047_0001497 3300049581 Bacteria 22769
274 Ga0501047_0414911 3300049581 Bacteria 1178
275 Ga0501048_0249656 3300049582 Bacteria 1259
276 Ga0501048_0309175 3300049582 Bacteria 1125
277 Ga0501067_0515095 3300049583 Bacteria 669
278 Ga0501083_1102217 3300049744 Bacteria 517
279 Ga0501035_0530664 3300049822 Bacteria 966
280 Ga0501044_0001364 3300049823 Bacteria 28627
281 nmdc:mga07m45_742663_c1 3300050496 Bacteria 563
282 Ga0495619_0833217 3300053085 Bacteria 623
283 Ga0500578_0009669 3300053086 Bacteria 6259
284 Ga0500643_014574 3300053087 Bacteria 2726
285 Ga0500644_0000230 3300053088 Bacteria 31625
286 Ga0500562_012796 3300053108 Bacteria 2136
287 Ga0500594_0251260 3300053118 Bacteria 588
288 Ga0500655_121206 3300053133 Bacteria 555
289 Ga0500564_000107 3300053138 Bacteria 21209
290 Ga0500622_0035954 3300053156 Bacteria 2590
291 Ga0500636_0080425 3300053177 Bacteria 1878
292 2585146665 2582581279 Bacteria 4980720
293 2644000568 2643221598 Bacteria 4578346
294 Ga0496107_0598010
295 Ga0070658_10074994
296 Ga0070658_10222584
297 Ga0070658_10370773
298 Ga0070658_10620638
299 Ga0070658_10847350
300 Ga0068869_100024274
301 Ga0070680_100172302
302 Ga0070680_101565532
303 Ga0070660_100083299
304 Ga0070660_100092013
305 Ga0070691_10102836
306 Ga0070668_100001060
307 Ga0070671_100009271
308 Ga0070671_100144296
309 Ga0070671_100222846
310 Ga0070671_100317374
311 Ga0070659_100004793
312 Ga0070659_100434216
313 Ga0070667_100006944
314 Ga0070667_100971305
315 Ga0070711_100717284
316 Ga0070700_101608767
317 Ga0070678_100341638
318 Ga0070662_101363655
319 Ga0070662_101620083
320 Ga0070681_10016496
321 Ga0070681_10637363
322 Ga0070679_100058479
323 Ga0070679_101290805
324 Ga0070684_100631986
325 Ga0068853_100118034
326 Ga0068853_100286496
327 Ga0070665_100000144
328 Ga0070665_100067629
329 Ga0070665_100189658
330 Ga0068855_100068089
331 Ga0068855_100395909
332 Ga0068855_101252139
333 Ga0070664_100136812
334 Ga0070664_100832365
335 Ga0070664_101010631
336 Ga0068856_100172727
337 Ga0068856_100750933
338 Ga0068856_101069971
339 Ga0068856_101295542
340 Ga0068859_100001088
341 Ga0068859_101150122
342 Ga0068864_100320576
343 Ga0068864_100703131
344 Ga0068864_100747711
345 Ga0068861_101814435
346 Ga0068863_100006335
347 Ga0068863_100292571
348 Ga0068858_100001420
349 Ga0068860_100000115
350 Ga0068860_100019462
351 Ga0068862_100046692
352 Ga0068862_100100773
353 Ga0068862_100633687
354 Ga0070717_10096464
355 Ga0097621_101210037
356 Ga0097620_100001088
357 Ga0097620_101150142
358 Ga0105240_10001080
359 Ga0105240_10098194
360 Ga0105240_10174817
361 Ga0105240_10220751
362 Ga0105240_10358879
363 Ga0105247_10429182
364 Ga0105241_10083735
365 Ga0105241_10888848
366 Ga0105241_12541671
367 Ga0105242_10364821
368 Ga0105248_10007703
369 Ga0105248_10371929
370 Ga0105248_10667386
371 Ga0105237_11017732
372 Ga0105238_10102499
373 Ga0105238_10419971
374 Ga0105239_10084995
375 Ga0105239_10770253
376 Ga0157373_10003642
377 Ga0157370_10443056
378 Ga0163162_10058919
379 Ga0157375_10310167
380 Ga0157375_10663110
381 Ga0163163_10011534
382 Ga0163163_10161169
383 Ga0163163_10194167
384 Ga0163163_10287851
385 Ga0163163_10914358
386 Ga0157379_10000663
387 Ga0157379_10610758
388 Ga0157379_12412970
389 Ga0157376_10185535
390 Ga0213872_10034426
391 Ga0213872_10184250
392 Ga0213876_10000074
393 Ga0213875_10598775
394 Ga0207710_10282102
395 Ga0207705_10314148
396 Ga0207705_10709925
397 Ga0207654_10900784
398 Ga0207707_10452021
399 Ga0207695_10001484
400 Ga0207695_10015986
401 Ga0207695_10136129
402 Ga0207663_10930307
403 Ga0207660_10697584
404 Ga0207657_10223187
405 Ga0207652_10218057
406 Ga0207681_10037552
407 Ga0207644_10027716
408 Ga0207644_10241909
409 Ga0207690_10376834
410 Ga0207690_10534525
411 Ga0207706_10094554
412 Ga0207691_10161680
413 Ga0207711_10014420
414 Ga0207711_10386949
415 Ga0207661_10884439
416 Ga0207661_11101668
417 Ga0207679_10070325
418 Ga0207679_10266571
419 Ga0207667_10025769
420 Ga0207667_10040529
421 Ga0207668_10003734
422 Ga0207668_10189084
423 Ga0207658_10005254
424 Ga0207658_10627178
425 Ga0207658_10680801
426 Ga0207658_10925832
427 Ga0207703_10011867
428 Ga0207703_11242660
429 Ga0207639_10038342
430 Ga0207639_11462069
431 Ga0207702_10341100
432 Ga0207702_10715597
433 Ga0207702_10907756
434 Ga0207702_11767332
435 Ga0207641_10009728
436 Ga0207641_10065361
437 Ga0207641_10208634
438 Ga0207648_11396922
439 Ga0207676_10985227
440 Ga0207676_11886335
441 Ga0207674_11624185
442 Ga0207675_100184530
443 Ga0207675_100540381
444 Ga0207683_10260205
445 Ga0268266_10000003
446 Ga0268266_10044862
447 Ga0268266_10158613
448 Ga0268266_11617011
449 Ga0268265_10000654
450 Ga0268265_10044824
451 Ga0268265_10111741
452 Ga0268264_10000002
453 Ga0268264_10034908
454 Ga0265334_10101749
455 Ga0307517_10000705
456 Ga0307515_10131386
457 Ga0265324_10154650
458 Ga0265331_10363273
459 Ga0265327_10007698
460 Ga0265327_10053042
461 Ga0307513_10000208
462 Ga0307513_10000764
463 Ga0307513_10011796
464 Ga0265314_10229340
465 Ga0307413_10413945
466 Ga0307415_101501814
467 Ga0373923_0337766
468 Ga0373936_0004819
469 Ga0373931_0396003
470 Ga0373935_0072316
471 Ga0373947_0319162
472 Ga0373937_1086596
473 Ga0373925_1159957
474 Ga0395899_0035405
475 Ga0395900_0211872
476 Ga0395900_1376961
477 Ga0395898_0897273
478 Ga0395898_1749036
479 Ga0395905_0136180
480 Ga0395905_0308518
481 Ga0436364_0034797
482 Ga0436364_0995651
483 Ga0436364_1383506
484 Ga0395901_0007043
485 Ga0395901_0617040
486 Ga0436365_0980217
487 Ga0436365_1256094
488 Ga0436365_1257587
489 Ga0436365_1484667
490 Ga0436360_0084587
491 Ga0436360_0429362
492 Ga0436360_0536177
493 Ga0436360_0907379
494 Ga0436360_0966130
495 Ga0436360_1286479
496 Ga0436360_1315782
497 Ga0436361_0059429
498 Ga0436361_0247105
499 Ga0436361_0320838
500 Ga0436361_0396573
501 Ga0436361_0525025
502 Ga0436361_0649173
503 Ga0436361_0657565
504 Ga0436361_0778353
505 Ga0436361_0847512
506 Ga0436361_0879833
507 Ga0436363_1387396
508 Ga0436362_0258600
509 Ga0436362_0263722
510 Ga0436362_0378223
511 Ga0436362_0419428
512 Ga0451839_1549144
513 Ga0466972_0236303
514 Ga0466961_0462213
515 Ga0466970_0141231
516 Ga0495590_0045374
517 Ga0495638_0000500
518 Ga0495585_0470387
519 Ga0495583_0069482
520 Ga0495583_0351735
521 Ga0495606_0482728
522 Ga0495631_0009525
523 Ga0495637_0171359
524 Ga0495648_0000374
525 Ga0495642_0042211
526 Ga0495642_0223290
527 Ga0495642_0475168
528 Ga0495654_0106841
529 Ga0495668_0053529
530 Ga0495668_0115510
531 Ga0495668_0536362
532 Ga0495611_0008410
533 Ga0495625_0074622
534 Ga0495658_0367551
535 Ga0495669_0102373
536 Ga0495670_0525454
537 Ga0495674_0908554
538 Ga0495672_0026727
539 Ga0495677_0117960
540 Ga0495673_0000950
541 Ga0495686_0002846
542 Ga0496100_0249799
543 Ga0496101_0121017
544 Ga0496102_0406599
545 Ga0496104_0437164
546 Ga0496105_0235282
547 Ga0496106_0503651
548 Ga0496106_0631315
549 Ga0496108_0342424
550 Ga0496109_0040643
551 Ga0496110_0096996
552 Ga0496112_0736774
553 Ga0496112_0776042
554 Ga0496112_1354855
555 Ga0496113_1269169
556 Ga0496115_0000481
557 Ga0496115_0010691
558 Ga0496115_0061747
559 Ga0496115_0946763
560 Ga0496124_0165539
561 Ga0496126_0132563
562 Ga0501032_0486065
563 Ga0501033_0617557
564 Ga0501034_0697055
565 Ga0501037_0050423
566 Ga0501047_0001497
567 Ga0501047_0414911
568 Ga0501048_0249656
569 Ga0501048_0309175
570 Ga0501067_0515095
571 Ga0501083_1102217
572 Ga0501035_0530664
573 Ga0501044_0001364
574 nmdc:mga07m45_742663_c1
575 Ga0495619_0833217
576 Ga0500578_0009669
577 Ga0500643_014574
578 Ga0500644_0000230
579 Ga0500562_012796
580 Ga0500594_0251260
581 Ga0500655_121206
582 Ga0500564_000107
583 Ga0500622_0035954
584 Ga0500636_0080425
585 2585146665
586 2644000568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

9

61

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cwo-assembly1.cif.gz_D cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.9256 7 59
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.908 4 89
2cqj-assembly1.cif.gz_A solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog 0.9064 3 52
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9062 7 51
1dm9-assembly1.cif.gz_A heat shock protein 15 kd 0.8988 5 89
ID Description Score Start End Superfamily
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9047 7 59 3.10.290.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9038 6 52 3.10.290.10
1dm9A00 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.8988 5 89 3.10.290.10
af_Q6R9N5_90_173_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.8941 7 60 3.10.290.10
af_P56799_3_142_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8898 7 60 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2D7ZH40-F1-model_v4 RNA-binding protein 0.9981 3 71 GO:0003723
AF-A0A1F8JSL7-F1-model_v4 deleted 0.997 16 90
AF-A0A0Q7U109-F1-model_v4 RNA-binding protein 0.9959 5 90 GO:0003723
AF-A0A2G2LX16-F1-model_v4 RNA-binding protein 0.9937 4 90 GO:0003723
AF-A0A2W4V7E4-F1-model_v4 deleted 0.9907 1 90

Map