F391652

General Info

Members Datasets Scaffolds Average Seq Length
293 194 586 305

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0152832|Ga0466967_0152832_1043_1972
Length 309
Sequence MADTPRVDGRAAVIGGGLMGHGIAQVLALAGMDVAVHDPVPAALESVPERIAANLRALRIDREAPVALEPELEHAVEGAEWVFEAAPENLELKQEIFARLDAAAGERTILATNTSVMKVGDIGARAQRRGRIVGTHWWNPPYLVRLVEVVQGPETEPATVQRTLELLEALGKTAVHVRRDVAGFVGNRLQHALWREAFDLVDKGVCDPETIDTVIKAGFGSRLPVLGPIENADLVGLDLTLAIHEYVLPELDPPSQPSPGLRRRVEQGQLGMKTGSGFRSWSSEDAAAVRERLLAHLIAVTSHQGGGGS

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 1.02
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0
Rhizoplane 9.56
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0152832 3300045976 Bacteria 2159
2 JGI25153J46596_10004936 3300003215 Bacteria 7088
3 Ga0070676_10046801 3300005328 Bacteria 2524
4 Ga0070680_100004467 3300005336 Bacteria 10538
5 Ga0070680_100378555 3300005336 Bacteria 1205
6 Ga0068868_100332455 3300005338 Bacteria 1297
7 Ga0070689_100027771 3300005340 Bacteria 4269
8 Ga0070675_100107762 3300005354 Bacteria 2353
9 Ga0070674_100006024 3300005356 Bacteria 7046
10 Ga0070659_100228716 3300005366 Bacteria 1537
11 Ga0070709_10247853 3300005434 Bacteria 1282
12 Ga0070714_100172494 3300005435 Bacteria 1964
13 Ga0070713_100147357 3300005436 Bacteria 2091
14 Ga0070700_100399340 3300005441 Bacteria 1033
15 Ga0070678_100159820 3300005456 Bacteria 1824
16 Ga0070681_10060642 3300005458 Bacteria 3758
17 Ga0070681_10071718 3300005458 Bacteria 3428
18 Ga0070681_10118389 3300005458 Bacteria 2585
19 Ga0070681_10204223 3300005458 Bacteria 1893
20 Ga0070681_10458549 3300005458 Bacteria 1187
21 Ga0070679_100015110 3300005530 Bacteria 7420
22 Ga0070679_100198327 3300005530 Bacteria 1974
23 Ga0068857_100253695 3300005577 Bacteria 1613
24 Ga0068864_100058574 3300005618 Bacteria 3330
25 Ga0068861_100263622 3300005719 Bacteria 1476
26 Ga0068861_100446412 3300005719 Bacteria 1158
27 Ga0081538_10005276 3300005981 Bacteria 11663
28 Ga0081540_1000783 3300005983 Bacteria 29165
29 Ga0081540_1012091 3300005983 Bacteria 5711
30 Ga0075365_10166792 3300006038 Bacteria 1536
31 Ga0075363_100071132 3300006048 Bacteria 1890
32 Ga0075364_10099513 3300006051 Bacteria 1935
33 Ga0070712_100166469 3300006175 Bacteria 1707
34 Ga0075367_10104956 3300006178 Bacteria 1730
35 Ga0075367_10248845 3300006178 Bacteria 1115
36 Ga0075370_10168395 3300006353 Bacteria 1287
37 Ga0075428_100031003 3300006844 Bacteria 5913
38 Ga0075433_10060250 3300006852 Bacteria 3323
39 Ga0075434_100023265 3300006871 Bacteria 6035
40 Ga0075434_100046995 3300006871 Bacteria 4283
41 Ga0075434_100200424 3300006871 Bacteria 2016
42 Ga0075429_100102549 3300006880 Bacteria 2498
43 Ga0075429_100176150 3300006880 Bacteria 1874
44 Ga0075435_100071993 3300007076 Bacteria 2823
45 Ga0105240_10022753 3300009093 Bacteria 8303
46 Ga0111539_10025601 3300009094 Bacteria 7231
47 Ga0111539_10238126 3300009094 Bacteria 2118
48 Ga0111539_10248379 3300009094 Bacteria 2072
49 Ga0105242_10106809 3300009176 Bacteria 2380
50 Ga0157370_10007782 3300013104 Bacteria 11617
51 Ga0157370_10284034 3300013104 Bacteria 1529
52 Ga0157378_10425506 3300013297 Bacteria 1313
53 Ga0163162_10386020 3300013306 Bacteria 1534
54 Ga0157372_10382709 3300013307 Bacteria 1639
55 Ga0157375_10309606 3300013308 Bacteria 1744
56 Ga0163163_10096952 3300014325 Bacteria 2969
57 Ga0182008_10014409 3300014497 Bacteria 4140
58 Ga0224572_1000501 3300024225 Bacteria 4705
59 Ga0209758_1000669 3300025297 Bacteria 51286
60 Ga0207426_1021815 3300025302 Bacteria 2208
61 Ga0207697_10069955 3300025315 Bacteria 1470
62 Ga0207688_10141639 3300025901 Bacteria 1415
63 Ga0207645_10064680 3300025907 Bacteria 2337
64 Ga0207707_10003185 3300025912 Bacteria 14568
65 Ga0207707_10043578 3300025912 Bacteria 3913
66 Ga0207695_10143915 3300025913 Bacteria 2330
67 Ga0207693_10242119 3300025915 Bacteria 1416
68 Ga0207663_10053042 3300025916 Bacteria 2532
69 Ga0207660_10152777 3300025917 Bacteria 1775
70 Ga0207662_10046392 3300025918 Bacteria 2570
71 Ga0207652_10015640 3300025921 Bacteria 6176
72 Ga0207652_10236468 3300025921 Bacteria 1647
73 Ga0207659_10069857 3300025926 Bacteria 2560
74 Ga0207700_10058667 3300025928 Bacteria 2908
75 Ga0207700_10360552 3300025928 Bacteria 1267
76 Ga0207690_10155530 3300025932 Bacteria 1699
77 Ga0207686_10016294 3300025934 Bacteria 4170
78 Ga0207670_10006490 3300025936 Bacteria 6489
79 Ga0207670_10212352 3300025936 Bacteria 1477
80 Ga0207669_10048303 3300025937 Bacteria 2527
81 Ga0207665_10095407 3300025939 Bacteria 2067
82 Ga0207711_10023965 3300025941 Bacteria 5108
83 Ga0207676_10043073 3300026095 Bacteria 3473
84 Ga0207674_10256637 3300026116 Bacteria 1695
85 Ga0207683_10031874 3300026121 Bacteria 4577
86 Ga0265357_1002281 3300028023 Bacteria 1549
87 Ga0265338_10058319 3300028800 Bacteria 3408
88 Ga0265762_1009187 3300030760 Bacteria 1762
89 Ga0265763_1000229 3300030763 Bacteria 3091
90 Ga0265760_10015578 3300031090 Bacteria 2179
91 Ga0265332_10084441 3300031238 Bacteria 1346
92 Ga0265325_10027289 3300031241 Bacteria 3086
93 Ga0265340_10001253 3300031247 Bacteria 14589
94 Ga0265340_10005455 3300031247 Bacteria 7064
95 Ga0265339_10000091 3300031249 Bacteria 75937
96 Ga0265331_10031897 3300031250 Bacteria 2616
97 Ga0265316_10016679 3300031344 Bacteria 6366
98 Ga0265313_10000868 3300031595 Bacteria 30518
99 Ga0265313_10033536 3300031595 Bacteria 2608
100 Ga0265342_10009354 3300031712 Bacteria 6916
101 Ga0373940_0039067 3300035088 Bacteria 1298
102 Ga0373944_0002019 3300035089 Bacteria 5143
103 Ga0373923_0018492 3300035111 Bacteria 2683
104 Ga0373945_0016277 3300035116 Bacteria 2506
105 Ga0373953_0027328 3300035117 Bacteria 2192
106 Ga0373954_0037305 3300035118 Bacteria 2259
107 Ga0373954_0050962 3300035118 Bacteria 1943
108 Ga0373956_0005177 3300035119 Bacteria 5223
109 Ga0373957_0005882 3300035120 Bacteria 3832
110 Ga0373943_0000567 3300035170 Bacteria 16034
111 Ga0373946_0002942 3300035171 Bacteria 6038
112 Ga0373946_0012445 3300035171 Bacteria 3185
113 Ga0373955_0010170 3300035172 Bacteria 4434
114 Ga0373955_0064363 3300035172 Bacteria 2033
115 Ga0373961_0011682 3300035241 Bacteria 2183
116 Ga0373924_0015912 3300035410 Bacteria 2866
117 Ga0373924_0025131 3300035410 Bacteria 2353
118 Ga0373931_0009280 3300035691 Bacteria 4699
119 Ga0373935_0213678 3300035692 Unclassified 1337
120 Ga0373935_0217518 3300035692 Bacteria 1326
121 Ga0373927_0002426 3300035695 Bacteria 13595
122 Ga0373927_0029863 3300035695 Bacteria 3555
123 Ga0373933_0015446 3300035724 Bacteria 4255
124 Ga0373933_0247463 3300035724 Bacteria 1148
125 Ga0373947_0017391 3300035725 Bacteria 4135
126 Ga0373947_0024987 3300035725 Bacteria 3483
127 Ga0373947_0031818 3300035725 Bacteria 3107
128 Ga0373947_0091937 3300035725 Bacteria 1894
129 Ga0373937_0000414 3300036401 Bacteria 39843
130 Ga0373937_0001751 3300036401 Bacteria 18265
131 Ga0373925_0003922 3300037068 Bacteria 11355
132 Ga0373925_0177995 3300037068 Bacteria 1682
133 Ga0395899_0091663 3300037312 Bacteria 2202
134 Ga0395899_0164251 3300037312 Bacteria 1567
135 Ga0395900_0148935 3300037418 Bacteria 2392
136 Ga0395898_0008395 3300037466 Bacteria 10923
137 Ga0395898_0009499 3300037466 Bacteria 10212
138 Ga0395898_0089239 3300037466 Bacteria 2967
139 Ga0395905_0127913 3300037471 Bacteria 2389
140 Ga0395901_0008870 3300038443 Bacteria 10181
141 Ga0436363_1682763 3300039450 Bacteria 4267
142 Ga0439435_0070895 3300042436 Bacteria 1031
143 Ga0466963_0007058 3300044694 Bacteria 6687
144 Ga0466964_0023109 3300044706 Bacteria 2416
145 Ga0466957_0097508 3300044842 Bacteria 1849
146 Ga0466967_0058984 3300045976 Bacteria 3394
147 Ga0466967_0100758 3300045976 Bacteria 2639
148 Ga0495592_0001026 3300046454 Bacteria 19392
149 Ga0495629_0001949 3300046459 Bacteria 16087
150 Ga0495651_0000540 3300046462 Bacteria 29195
151 Ga0495653_0001530 3300046463 Bacteria 18079
152 Ga0495653_0016270 3300046463 Bacteria 6060
153 Ga0495653_0020295 3300046463 Bacteria 5388
154 Ga0495580_0024260 3300046472 Bacteria 4444
155 Ga0495582_0125872 3300046473 Bacteria 1446
156 Ga0495639_0039390 3300046475 Bacteria 2125
157 Ga0495662_0000280 3300046476 Bacteria 21964
158 Ga0495664_0000112 3300046477 Bacteria 40522
159 Ga0495664_0016402 3300046477 Bacteria 4218
160 Ga0495608_0000556 3300046511 Bacteria 25760
161 Ga0495618_0001016 3300046514 Bacteria 19217
162 Ga0495618_0001092 3300046514 Bacteria 18392
163 Ga0495628_0021168 3300046516 Bacteria 5354
164 Ga0495630_0050726 3300046517 Bacteria 3105
165 Ga0495666_0067186 3300046526 Bacteria 1708
166 Ga0495652_0021356 3300046529 Bacteria 5757
167 Ga0495665_0027740 3300046531 Bacteria 3038
168 Ga0495665_0058179 3300046531 Bacteria 2041
169 Ga0495640_0000871 3300046533 Bacteria 23106
170 Ga0495640_0020037 3300046533 Bacteria 4930
171 Ga0495587_0001728 3300046536 Bacteria 14579
172 Ga0495645_0004586 3300046543 Bacteria 9430
173 Ga0495645_0025896 3300046543 Bacteria 4258
174 Ga0495667_0001507 3300046559 Bacteria 15361
175 Ga0495667_0012454 3300046559 Bacteria 5767
176 Ga0495634_0002257 3300046642 Bacteria 16158
177 Ga0495634_0003493 3300046642 Bacteria 12595
178 Ga0495634_0033846 3300046642 Bacteria 3509
179 Ga0495635_0002093 3300046663 Bacteria 13548
180 Ga0495635_0002738 3300046663 Bacteria 12081
181 Ga0495599_0009199 3300046678 Bacteria 6030
182 Ga0495646_0048871 3300046680 Bacteria 2569
183 Ga0495646_0054316 3300046680 Bacteria 2410
184 Ga0495647_0065317 3300046681 Unclassified 1445
185 Ga0495658_0157092 3300046683 Bacteria 1400
186 Ga0495658_0209250 3300046683 Bacteria 1218
187 Ga0495613_0015480 3300046689 Bacteria 5672
188 Ga0495613_0087956 3300046689 Bacteria 2252
189 Ga0495624_0001093 3300046690 Bacteria 21434
190 Ga0495600_0000186 3300046809 Bacteria 36306
191 Ga0495604_0000150 3300047317 Bacteria 60582
192 Ga0495604_0156468 3300047317 Bacteria 1614
193 Ga0495674_0001513 3300047319 Bacteria 22779
194 Ga0495674_0023667 3300047319 Bacteria 5657
195 Ga0495672_0005202 3300047320 Bacteria 10370
196 Ga0495676_0183295 3300047321 Bacteria 1466
197 Ga0495676_0261109 3300047321 Unclassified 1178
198 Ga0495680_0000429 3300047322 Bacteria 47078
199 Ga0495680_0011972 3300047322 Bacteria 7656
200 Ga0495675_0001022 3300047444 Bacteria 17001
201 Ga0495684_0000264 3300047471 Bacteria 41677
202 Ga0495684_0001309 3300047471 Bacteria 20014
203 Ga0495684_0016295 3300047471 Bacteria 5722
204 Ga0495602_0005255 3300048088 Bacteria 13574
205 Ga0496100_0305313 3300048903 Bacteria 1192
206 Ga0496101_0011289 3300048904 Bacteria 5921
207 Ga0496101_0075986 3300048904 Bacteria 2474
208 Ga0496101_0492752 3300048904 Bacteria 968
209 Ga0496103_0114581 3300048906 Bacteria 1714
210 Ga0496104_0012511 3300048907 Bacteria 7630
211 Ga0496104_0019416 3300048907 Bacteria 6218
212 Ga0496104_0088980 3300048907 Bacteria 2950
213 Ga0496105_0017953 3300048908 Bacteria 5678
214 Ga0496105_0074364 3300048908 Bacteria 2807
215 Ga0496106_0077604 3300048909 Bacteria 2547
216 Ga0496106_0306101 3300048909 Bacteria 1275
217 Ga0496107_0037926 3300048910 Bacteria 3459
218 Ga0496107_0080801 3300048910 Bacteria 2371
219 Ga0496108_0039215 3300048911 Bacteria 3949
220 Ga0496108_0137027 3300048911 Bacteria 2107
221 Ga0496110_0011677 3300048913 Bacteria 7203
222 Ga0496110_0332906 3300048913 Bacteria 1383
223 Ga0496111_0072032 3300048914 Bacteria 2515
224 Ga0496112_0148862 3300048915 Bacteria 2309
225 Ga0496112_0260506 3300048915 Bacteria 1683
226 Ga0496113_0035443 3300048916 Bacteria 3649
227 Ga0496113_0056054 3300048916 Bacteria 2957
228 Ga0496114_0026104 3300048917 Bacteria 4780
229 Ga0496114_0212455 3300048917 Bacteria 1697
230 Ga0496114_0395526 3300048917 Bacteria 1224
231 Ga0496115_0003484 3300048918 Bacteria 11313
232 Ga0496115_0088277 3300048918 Bacteria 2531
233 Ga0501034_0050791 3300049571 Bacteria 4182
234 Ga0501034_0381301 3300049571 Bacteria 1335
235 Ga0501037_0096870 3300049573 Bacteria 2132
236 Ga0501043_0060814 3300049579 Bacteria 2966
237 Ga0501043_0085744 3300049579 Bacteria 2475
238 Ga0501047_0012274 3300049581 Bacteria 8107
239 Ga0501047_0047710 3300049581 Bacteria 4137
240 Ga0501047_0083951 3300049581 Bacteria 3061
241 Ga0501070_0110133 3300049586 Bacteria 2276
242 Ga0501071_0131713 3300049587 Bacteria 1858
243 Ga0501071_0152071 3300049587 Bacteria 1727
244 Ga0501072_0023939 3300049588 Bacteria 4746
245 Ga0501073_0023856 3300049589 Bacteria 4393
246 Ga0501073_0302643 3300049589 Bacteria 1103
247 Ga0501075_0130065 3300049591 Bacteria 1918
248 Ga0501075_0145790 3300049591 Bacteria 1804
249 Ga0501080_0150089 3300049742 Bacteria 2155
250 Ga0501081_0181457 3300049743 Bacteria 1523
251 Ga0501035_0192892 3300049822 Bacteria 1751
252 Ga0501035_0407403 3300049822 Bacteria 1130
253 Ga0501044_0255410 3300049823 Bacteria 1692
254 Ga0501044_0271481 3300049823 Bacteria 1631
255 Ga0501044_0293838 3300049823 Bacteria 1556
256 nmdc:mga03n38_101146_c1 3300050490 Bacteria 1390
257 nmdc:mga0yw44_122061_c1 3300050492 Bacteria 1679
258 nmdc:mga0yw44_251839_c1 3300050492 Bacteria 1175
259 nmdc:mga0k408_21453_c1 3300050493 Bacteria 3628
260 nmdc:mga06z11_119004_c1 3300050494 Bacteria 1471
261 nmdc:mga06z11_246766_c1 3300050494 Bacteria 1050
262 nmdc:mga06z11_55384_c1 3300050494 Bacteria 2047
263 nmdc:mga07m45_19679_c1 3300050496 Bacteria 2439
264 nmdc:mga07m45_57753_c1 3300050496 Bacteria 2195
265 nmdc:mga05p37_414594_c1 3300050507 Bacteria 1569
266 nmdc:mga05p37_53728_c1 3300050507 Bacteria 4955
267 nmdc:mga09592_112903_c1 3300050508 Bacteria 2331
268 nmdc:mga0qj67_130268_c1 3300050509 Bacteria 2037
269 nmdc:mga0qj67_182_c1 3300050509 Bacteria 42807
270 nmdc:mga08y16_213525_c1 3300050511 Bacteria 1998
271 nmdc:mga08y16_362545_c1 3300050511 Bacteria 1488
272 nmdc:mga08y16_39834_c1 3300050511 Bacteria 4928
273 nmdc:mga0n895_151818_c1 3300050512 Bacteria 2347
274 nmdc:mga0n895_286576_c1 3300050512 Bacteria 1670
275 nmdc:mga0n895_8778_c1 3300050512 Bacteria 8789
276 nmdc:mga0rr50_111317_c1 3300050513 Bacteria 2167
277 nmdc:mga0a205_128308_c1 3300050515 Bacteria 2436
278 nmdc:mga0a205_5777_c2 3300050515 Bacteria 10585
279 Ga0495601_0001951 3300053077 Bacteria 11535
280 Ga0495601_0044469 3300053077 Bacteria 2791
281 Ga0495601_0059964 3300053077 Bacteria 2413
282 Ga0495601_0275840 3300053077 Bacteria 1096
283 Ga0495612_0023891 3300053078 Bacteria 2454
284 Ga0495612_0059822 3300053078 Bacteria 1576
285 Ga0495595_0008639 3300053084 Bacteria 4191
286 Ga0495595_0053765 3300053084 Bacteria 1871
287 Ga0495619_0001598 3300053085 Bacteria 14888
288 Ga0495619_0055011 3300053085 Bacteria 2635
289 Ga0500595_060601 3300053119 Bacteria 1144
290 Ga0500608_012444 3300053122 Bacteria 3732
291 Ga0501084_0223581 3300054114 Bacteria 1588
292 Ga0501082_0129028 3300060353 Bacteria 2194
293 2753267116 2751185782 Bacteria 11227053
294 Ga0466967_0152832
295 JGI25153J46596_10004936
296 Ga0070676_10046801
297 Ga0070680_100004467
298 Ga0070680_100378555
299 Ga0068868_100332455
300 Ga0070689_100027771
301 Ga0070675_100107762
302 Ga0070674_100006024
303 Ga0070659_100228716
304 Ga0070709_10247853
305 Ga0070714_100172494
306 Ga0070713_100147357
307 Ga0070700_100399340
308 Ga0070678_100159820
309 Ga0070681_10060642
310 Ga0070681_10071718
311 Ga0070681_10118389
312 Ga0070681_10204223
313 Ga0070681_10458549
314 Ga0070679_100015110
315 Ga0070679_100198327
316 Ga0068857_100253695
317 Ga0068864_100058574
318 Ga0068861_100263622
319 Ga0068861_100446412
320 Ga0081538_10005276
321 Ga0081540_1000783
322 Ga0081540_1012091
323 Ga0075365_10166792
324 Ga0075363_100071132
325 Ga0075364_10099513
326 Ga0070712_100166469
327 Ga0075367_10104956
328 Ga0075367_10248845
329 Ga0075370_10168395
330 Ga0075428_100031003
331 Ga0075433_10060250
332 Ga0075434_100023265
333 Ga0075434_100046995
334 Ga0075434_100200424
335 Ga0075429_100102549
336 Ga0075429_100176150
337 Ga0075435_100071993
338 Ga0105240_10022753
339 Ga0111539_10025601
340 Ga0111539_10238126
341 Ga0111539_10248379
342 Ga0105242_10106809
343 Ga0157370_10007782
344 Ga0157370_10284034
345 Ga0157378_10425506
346 Ga0163162_10386020
347 Ga0157372_10382709
348 Ga0157375_10309606
349 Ga0163163_10096952
350 Ga0182008_10014409
351 Ga0224572_1000501
352 Ga0209758_1000669
353 Ga0207426_1021815
354 Ga0207697_10069955
355 Ga0207688_10141639
356 Ga0207645_10064680
357 Ga0207707_10003185
358 Ga0207707_10043578
359 Ga0207695_10143915
360 Ga0207693_10242119
361 Ga0207663_10053042
362 Ga0207660_10152777
363 Ga0207662_10046392
364 Ga0207652_10015640
365 Ga0207652_10236468
366 Ga0207659_10069857
367 Ga0207700_10058667
368 Ga0207700_10360552
369 Ga0207690_10155530
370 Ga0207686_10016294
371 Ga0207670_10006490
372 Ga0207670_10212352
373 Ga0207669_10048303
374 Ga0207665_10095407
375 Ga0207711_10023965
376 Ga0207676_10043073
377 Ga0207674_10256637
378 Ga0207683_10031874
379 Ga0265357_1002281
380 Ga0265338_10058319
381 Ga0265762_1009187
382 Ga0265763_1000229
383 Ga0265760_10015578
384 Ga0265332_10084441
385 Ga0265325_10027289
386 Ga0265340_10001253
387 Ga0265340_10005455
388 Ga0265339_10000091
389 Ga0265331_10031897
390 Ga0265316_10016679
391 Ga0265313_10000868
392 Ga0265313_10033536
393 Ga0265342_10009354
394 Ga0373940_0039067
395 Ga0373944_0002019
396 Ga0373923_0018492
397 Ga0373945_0016277
398 Ga0373953_0027328
399 Ga0373954_0037305
400 Ga0373954_0050962
401 Ga0373956_0005177
402 Ga0373957_0005882
403 Ga0373943_0000567
404 Ga0373946_0002942
405 Ga0373946_0012445
406 Ga0373955_0010170
407 Ga0373955_0064363
408 Ga0373961_0011682
409 Ga0373924_0015912
410 Ga0373924_0025131
411 Ga0373931_0009280
412 Ga0373935_0213678
413 Ga0373935_0217518
414 Ga0373927_0002426
415 Ga0373927_0029863
416 Ga0373933_0015446
417 Ga0373933_0247463
418 Ga0373947_0017391
419 Ga0373947_0024987
420 Ga0373947_0031818
421 Ga0373947_0091937
422 Ga0373937_0000414
423 Ga0373937_0001751
424 Ga0373925_0003922
425 Ga0373925_0177995
426 Ga0395899_0091663
427 Ga0395899_0164251
428 Ga0395900_0148935
429 Ga0395898_0008395
430 Ga0395898_0009499
431 Ga0395898_0089239
432 Ga0395905_0127913
433 Ga0395901_0008870
434 Ga0436363_1682763
435 Ga0439435_0070895
436 Ga0466963_0007058
437 Ga0466964_0023109
438 Ga0466957_0097508
439 Ga0466967_0058984
440 Ga0466967_0100758
441 Ga0495592_0001026
442 Ga0495629_0001949
443 Ga0495651_0000540
444 Ga0495653_0001530
445 Ga0495653_0016270
446 Ga0495653_0020295
447 Ga0495580_0024260
448 Ga0495582_0125872
449 Ga0495639_0039390
450 Ga0495662_0000280
451 Ga0495664_0000112
452 Ga0495664_0016402
453 Ga0495608_0000556
454 Ga0495618_0001016
455 Ga0495618_0001092
456 Ga0495628_0021168
457 Ga0495630_0050726
458 Ga0495666_0067186
459 Ga0495652_0021356
460 Ga0495665_0027740
461 Ga0495665_0058179
462 Ga0495640_0000871
463 Ga0495640_0020037
464 Ga0495587_0001728
465 Ga0495645_0004586
466 Ga0495645_0025896
467 Ga0495667_0001507
468 Ga0495667_0012454
469 Ga0495634_0002257
470 Ga0495634_0003493
471 Ga0495634_0033846
472 Ga0495635_0002093
473 Ga0495635_0002738
474 Ga0495599_0009199
475 Ga0495646_0048871
476 Ga0495646_0054316
477 Ga0495647_0065317
478 Ga0495658_0157092
479 Ga0495658_0209250
480 Ga0495613_0015480
481 Ga0495613_0087956
482 Ga0495624_0001093
483 Ga0495600_0000186
484 Ga0495604_0000150
485 Ga0495604_0156468
486 Ga0495674_0001513
487 Ga0495674_0023667
488 Ga0495672_0005202
489 Ga0495676_0183295
490 Ga0495676_0261109
491 Ga0495680_0000429
492 Ga0495680_0011972
493 Ga0495675_0001022
494 Ga0495684_0000264
495 Ga0495684_0001309
496 Ga0495684_0016295
497 Ga0495602_0005255
498 Ga0496100_0305313
499 Ga0496101_0011289
500 Ga0496101_0075986
501 Ga0496101_0492752
502 Ga0496103_0114581
503 Ga0496104_0012511
504 Ga0496104_0019416
505 Ga0496104_0088980
506 Ga0496105_0017953
507 Ga0496105_0074364
508 Ga0496106_0077604
509 Ga0496106_0306101
510 Ga0496107_0037926
511 Ga0496107_0080801
512 Ga0496108_0039215
513 Ga0496108_0137027
514 Ga0496110_0011677
515 Ga0496110_0332906
516 Ga0496111_0072032
517 Ga0496112_0148862
518 Ga0496112_0260506
519 Ga0496113_0035443
520 Ga0496113_0056054
521 Ga0496114_0026104
522 Ga0496114_0212455
523 Ga0496114_0395526
524 Ga0496115_0003484
525 Ga0496115_0088277
526 Ga0501034_0050791
527 Ga0501034_0381301
528 Ga0501037_0096870
529 Ga0501043_0060814
530 Ga0501043_0085744
531 Ga0501047_0012274
532 Ga0501047_0047710
533 Ga0501047_0083951
534 Ga0501070_0110133
535 Ga0501071_0131713
536 Ga0501071_0152071
537 Ga0501072_0023939
538 Ga0501073_0023856
539 Ga0501073_0302643
540 Ga0501075_0130065
541 Ga0501075_0145790
542 Ga0501080_0150089
543 Ga0501081_0181457
544 Ga0501035_0192892
545 Ga0501035_0407403
546 Ga0501044_0255410
547 Ga0501044_0271481
548 Ga0501044_0293838
549 nmdc:mga03n38_101146_c1
550 nmdc:mga0yw44_122061_c1
551 nmdc:mga0yw44_251839_c1
552 nmdc:mga0k408_21453_c1
553 nmdc:mga06z11_119004_c1
554 nmdc:mga06z11_246766_c1
555 nmdc:mga06z11_55384_c1
556 nmdc:mga07m45_19679_c1
557 nmdc:mga07m45_57753_c1
558 nmdc:mga05p37_414594_c1
559 nmdc:mga05p37_53728_c1
560 nmdc:mga09592_112903_c1
561 nmdc:mga0qj67_130268_c1
562 nmdc:mga0qj67_182_c1
563 nmdc:mga08y16_213525_c1
564 nmdc:mga08y16_362545_c1
565 nmdc:mga08y16_39834_c1
566 nmdc:mga0n895_151818_c1
567 nmdc:mga0n895_286576_c1
568 nmdc:mga0n895_8778_c1
569 nmdc:mga0rr50_111317_c1
570 nmdc:mga0a205_128308_c1
571 nmdc:mga0a205_5777_c2
572 Ga0495601_0001951
573 Ga0495601_0044469
574 Ga0495601_0059964
575 Ga0495601_0275840
576 Ga0495612_0023891
577 Ga0495612_0059822
578 Ga0495595_0008639
579 Ga0495595_0053765
580 Ga0495619_0001598
581 Ga0495619_0055011
582 Ga0500595_060601
583 Ga0500608_012444
584 Ga0501084_0223581
585 Ga0501082_0129028
586 2753267116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

10

181

0.95

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

183

281

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9876 4 36
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9842 4 33
4rep-assembly1.cif.gz_A crystal structure of gamma-carotenoid desaturase 0.9807 4 36
6j0z-assembly1.cif.gz_C-2 crystal structure of alpk 0.9802 6 36
3fmw-assembly1.cif.gz_A the crystal structure of mtmoiv, a baeyer-villiger monooxygenase from the mithramycin biosynthetic pathway in streptomyces argillaceus. 0.9787 6 33
ID Description Score Start End Superfamily
6j0zC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9802 6 36 3.50.50.60
af_C0VXV5_2_190_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9714 4 180 3.40.50.720
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9615 5 32 3.50.50.60
af_Q811X6_1_192_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9588 4 180 3.40.50.720
af_O06538_2_320_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9577 4 35 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A520ZUW8-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9851 58 300 GO:0006635
GO:0008691
GO:0070403
AF-A0A327KL20-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9818 61 300 GO:0006635
GO:0008691
GO:0070403
AF-A0A2S6TA22-F1-model_v4 Putative 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.977 1 252 GO:0006635
GO:0008691
GO:0070403
AF-A0A654ZEY4-F1-model_v4 deleted 0.974 80 301
AF-A0A2S6TA22-F1-model_v4 Putative 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9732 1 252 GO:0006635
GO:0008691
GO:0070403

Map