F391640

General Info

Members Datasets Scaffolds Average Seq Length
293 164 586 250

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0009328|Ga0453683_0009328_2304_3053
Length 249
Sequence MKIAVCIKRVADSETRVKIAADGKSLDEAGVKFILNPYDEFAVEEALQRKEKAGSGEVVVIACGSQSAQETIRTALAMGADRGVLLEAAVPADGLAVARALAAELKDGGYDLILFGKMAIDDYNHQVGPMTAELLGLPCVTCVAHLDLADGKGTAEREVEGGMEEVEFPLPAVLTADKGLNEPRYPALKGIMAAKKKPLEVKPAALGAAGLEILAMTPPPERKEGRIVGEGAAAVPELIKVLREEAKVL

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0009328 3300044673 Bacteria 6555
2 Ga0070658_10009744 3300005327 Bacteria 7715
3 Ga0070658_10076273 3300005327 Bacteria 2749
4 Ga0070683_100040932 3300005329 Bacteria 4261
5 Ga0070683_100083979 3300005329 Bacteria 2983
6 Ga0070683_100382881 3300005329 Bacteria 1340
7 Ga0070670_100043436 3300005331 Bacteria 3863
8 Ga0068869_100176649 3300005334 Bacteria 1672
9 Ga0070680_100038567 3300005336 Bacteria 3863
10 Ga0070680_100351268 3300005336 Bacteria 1254
11 Ga0070680_100656200 3300005336 Bacteria 902
12 Ga0068868_100191534 3300005338 Bacteria 1701
13 Ga0070660_100052762 3300005339 Bacteria 3135
14 Ga0070691_10051228 3300005341 Bacteria 1971
15 Ga0070661_100130644 3300005344 Bacteria 1886
16 Ga0070692_10228134 3300005345 Bacteria 1104
17 Ga0070668_100004101 3300005347 Bacteria 10787
18 Ga0070668_100301374 3300005347 Bacteria 1344
19 Ga0070669_100112953 3300005353 Bacteria 2064
20 Ga0070675_100077751 3300005354 Bacteria 2762
21 Ga0070659_100159714 3300005366 Bacteria 1842
22 Ga0070709_10010533 3300005434 Bacteria 5124
23 Ga0070714_100002683 3300005435 Bacteria 13108
24 Ga0070711_100101807 3300005439 Bacteria 2091
25 Ga0070705_100004509 3300005440 Bacteria 6782
26 Ga0070705_100005790 3300005440 Bacteria 6042
27 Ga0070700_100258950 3300005441 Bacteria 1252
28 Ga0070694_100003594 3300005444 Bacteria 9265
29 Ga0070694_100022076 3300005444 Bacteria 4076
30 Ga0070694_100026235 3300005444 Bacteria 3775
31 Ga0070694_100046030 3300005444 Bacteria 2926
32 Ga0070663_100000953 3300005455 Bacteria 15724
33 Ga0070681_10067156 3300005458 Bacteria 3555
34 Ga0070681_10096200 3300005458 Bacteria 2909
35 Ga0068867_100125738 3300005459 Bacteria 1987
36 Ga0070706_100106690 3300005467 Bacteria 2606
37 Ga0070707_100190884 3300005468 Bacteria 1997
38 Ga0070707_100695573 3300005468 Bacteria 979
39 Ga0070698_100263459 3300005471 Bacteria 1656
40 Ga0070699_100021085 3300005518 Bacteria 5617
41 Ga0070699_100042980 3300005518 Bacteria 3912
42 Ga0070699_100115685 3300005518 Bacteria 2357
43 Ga0070699_100175125 3300005518 Unclassified 1902
44 Ga0070679_100078547 3300005530 Bacteria 3289
45 Ga0070679_100143179 3300005530 Bacteria 2369
46 Ga0070684_100215096 3300005535 Bacteria 1752
47 Ga0070697_100001961 3300005536 Bacteria 15751
48 Ga0070697_100002036 3300005536 Bacteria 15480
49 Ga0070697_100020495 3300005536 Bacteria 5232
50 Ga0070697_100147652 3300005536 Bacteria 1980
51 Ga0070697_100205744 3300005536 Bacteria 1674
52 Ga0070672_100061411 3300005543 Bacteria 2962
53 Ga0070672_100246816 3300005543 Bacteria 1503
54 Ga0070695_100011223 3300005545 Bacteria 5358
55 Ga0070695_100011993 3300005545 Bacteria 5191
56 Ga0070695_100154045 3300005545 Bacteria 1607
57 Ga0070696_100005675 3300005546 Bacteria 8336
58 Ga0070696_100007175 3300005546 Bacteria 7441
59 Ga0070696_100021762 3300005546 Bacteria 4350
60 Ga0070696_100138278 3300005546 Bacteria 1777
61 Ga0070696_100156720 3300005546 Unclassified 1675
62 Ga0070696_100207131 3300005546 Bacteria 1466
63 Ga0070693_100162372 3300005547 Bacteria 1424
64 Ga0070693_100211008 3300005547 Bacteria 1267
65 Ga0070704_100000740 3300005549 Bacteria 15988
66 Ga0070704_100031676 3300005549 Bacteria 3559
67 Ga0070704_100053104 3300005549 Bacteria 2863
68 Ga0070704_100166207 3300005549 Bacteria 1750
69 Ga0070664_100063227 3300005564 Bacteria 3156
70 Ga0070664_100071132 3300005564 Bacteria 2981
71 Ga0070664_100257225 3300005564 Bacteria 1570
72 Ga0070664_100444400 3300005564 Bacteria 1190
73 Ga0068857_100114540 3300005577 Bacteria 2425
74 Ga0068854_100038839 3300005578 Bacteria 3350
75 Ga0068856_100098520 3300005614 Bacteria 2913
76 Ga0068861_100011261 3300005719 Bacteria 6210
77 Ga0068860_100147521 3300005843 Bacteria 2264
78 Ga0068862_100006115 3300005844 Bacteria 10017
79 Ga0070716_100001330 3300006173 Bacteria 10940
80 Ga0070716_100265899 3300006173 Bacteria 1176
81 Ga0070712_100232713 3300006175 Bacteria 1464
82 Ga0075428_100002328 3300006844 Bacteria 20599
83 Ga0075428_100300500 3300006844 Bacteria 1726
84 Ga0075428_100534469 3300006844 Bacteria 1254
85 Ga0075428_100703164 3300006844 Bacteria 1077
86 Ga0075430_100001969 3300006846 Bacteria 16904
87 Ga0075430_100017667 3300006846 Bacteria 6074
88 Ga0075431_100022887 3300006847 Bacteria 6388
89 Ga0075431_100064872 3300006847 Bacteria 3771
90 Ga0075431_100069960 3300006847 Bacteria 3621
91 Ga0075431_100100284 3300006847 Bacteria 2988
92 Ga0075431_100480874 3300006847 Bacteria 1235
93 Ga0075431_100688140 3300006847 Bacteria 1001
94 Ga0075433_10024358 3300006852 Bacteria 5107
95 Ga0075433_10059154 3300006852 Bacteria 3353
96 Ga0075434_100022692 3300006871 Bacteria 6112
97 Ga0075434_100033028 3300006871 Bacteria 5105
98 Ga0075434_100190296 3300006871 Bacteria 2072
99 Ga0075429_100038692 3300006880 Bacteria 4152
100 Ga0075429_100419741 3300006880 Bacteria 1172
101 Ga0075436_100029866 3300006914 Bacteria 3749
102 Ga0075436_100035617 3300006914 Bacteria 3433
103 Ga0075436_100042990 3300006914 Bacteria 3115
104 Ga0075436_100146258 3300006914 Bacteria 1662
105 Ga0075435_100060075 3300007076 Bacteria 3081
106 Ga0099794_10037883 3300007265 Bacteria 2283
107 Ga0105240_10091073 3300009093 Bacteria 3727
108 Ga0105240_10103959 3300009093 Bacteria 3449
109 Ga0105240_10117516 3300009093 Bacteria 3206
110 Ga0111539_10007186 3300009094 Bacteria 14273
111 Ga0111539_10189738 3300009094 Bacteria 2398
112 Ga0105245_10110334 3300009098 Bacteria 2557
113 Ga0114129_10582933 3300009147 Bacteria 1451
114 Ga0114129_10606048 3300009147 Bacteria 1418
115 Ga0114129_10643042 3300009147 Bacteria 1370
116 Ga0114129_10832581 3300009147 Bacteria 1175
117 Ga0105241_10000115 3300009174 Bacteria 57755
118 Ga0105248_10091084 3300009177 Bacteria 3434
119 Ga0105237_10002557 3300009545 Bacteria 22478
120 Ga0105238_10082370 3300009551 Bacteria 3207
121 Ga0105249_10000863 3300009553 Bacteria 26997
122 Ga0105239_10091254 3300010375 Bacteria 3361
123 Ga0105246_10453989 3300011119 Bacteria 1078
124 Ga0157371_10006826 3300013102 Bacteria 9328
125 Ga0157370_10042729 3300013104 Bacteria 4366
126 Ga0157369_10032808 3300013105 Bacteria 5706
127 Ga0157369_10334063 3300013105 Unclassified 1574
128 Ga0157374_10106115 3300013296 Bacteria 2698
129 Ga0157372_10036116 3300013307 Bacteria 5446
130 Ga0157375_10076907 3300013308 Bacteria 3366
131 Ga0157375_10194421 3300013308 Bacteria 2184
132 Ga0157380_10039784 3300014326 Bacteria 3658
133 Ga0182007_10014063 3300015262 Bacteria 3030
134 Ga0206353_10616206 3300020082 Bacteria 1329
135 Ga0213876_10011830 3300021384 Bacteria 4653
136 Ga0207682_10133312 3300025893 Bacteria 1110
137 Ga0207705_10002191 3300025909 Bacteria 15105
138 Ga0207705_10038878 3300025909 Bacteria 3408
139 Ga0207705_10332118 3300025909 Bacteria 1169
140 Ga0207684_10046140 3300025910 Bacteria 3697
141 Ga0207654_10000390 3300025911 Bacteria 25502
142 Ga0207707_10139271 3300025912 Bacteria 2121
143 Ga0207707_10364746 3300025912 Bacteria 1243
144 Ga0207695_10002793 3300025913 Bacteria 25387
145 Ga0207695_10305041 3300025913 Bacteria 1483
146 Ga0207671_10126305 3300025914 Bacteria 1960
147 Ga0207663_10086284 3300025916 Bacteria 2070
148 Ga0207660_10018233 3300025917 Bacteria 4676
149 Ga0207660_10239049 3300025917 Bacteria 1430
150 Ga0207660_10482817 3300025917 Bacteria 1004
151 Ga0207657_10003523 3300025919 Bacteria 16715
152 Ga0207649_10335430 3300025920 Bacteria 1115
153 Ga0207652_10001835 3300025921 Bacteria 18411
154 Ga0207652_10116860 3300025921 Bacteria 2370
155 Ga0207652_10118150 3300025921 Bacteria 2356
156 Ga0207652_10139365 3300025921 Bacteria 2168
157 Ga0207646_10042318 3300025922 Bacteria 4092
158 Ga0207646_10257698 3300025922 Bacteria 1576
159 Ga0207646_10297838 3300025922 Bacteria 1457
160 Ga0207681_10011200 3300025923 Bacteria 5506
161 Ga0207681_10054081 3300025923 Bacteria 2728
162 Ga0207664_10181786 3300025929 Bacteria 1806
163 Ga0207644_10636069 3300025931 Bacteria 887
164 Ga0207690_10107992 3300025932 Bacteria 1999
165 Ga0207706_10148209 3300025933 Bacteria 2064
166 Ga0207706_10487086 3300025933 Unclassified 1065
167 Ga0207704_10078944 3300025938 Bacteria 2119
168 Ga0207665_10001828 3300025939 Bacteria 14321
169 Ga0207691_10019404 3300025940 Bacteria 6434
170 Ga0207691_10097114 3300025940 Unclassified 2633
171 Ga0207689_10410992 3300025942 Bacteria 1129
172 Ga0207661_10142849 3300025944 Unclassified 2061
173 Ga0207661_10167390 3300025944 Bacteria 1911
174 Ga0207679_10032082 3300025945 Bacteria 3684
175 Ga0207679_10080104 3300025945 Bacteria 2493
176 Ga0207679_10148984 3300025945 Bacteria 1902
177 Ga0207679_10748005 3300025945 Bacteria 889
178 Ga0207667_10021636 3300025949 Bacteria 7124
179 Ga0207667_10349378 3300025949 Unclassified 1508
180 Ga0207667_10563857 3300025949 Bacteria 1151
181 Ga0207712_10011938 3300025961 Bacteria 5540
182 Ga0207668_10025176 3300025972 Bacteria 3848
183 Ga0207668_10613308 3300025972 Bacteria 949
184 Ga0207640_10055782 3300025981 Bacteria 2590
185 Ga0207658_10312824 3300025986 Bacteria 1357
186 Ga0207677_10335262 3300026023 Bacteria 1262
187 Ga0207639_10434655 3300026041 Bacteria 1189
188 Ga0207639_10483058 3300026041 Bacteria 1129
189 Ga0207678_10001271 3300026067 Bacteria 23323
190 Ga0207678_10627709 3300026067 Bacteria 943
191 Ga0207708_10382501 3300026075 Bacteria 1161
192 Ga0207702_10272330 3300026078 Bacteria 1597
193 Ga0207648_10053837 3300026089 Bacteria 3516
194 Ga0207648_10143716 3300026089 Bacteria 2104
195 Ga0207675_100005889 3300026118 Bacteria 11701
196 Ga0209588_1000132 3300027671 Bacteria 21538
197 Ga0209588_1002382 3300027671 Bacteria 5091
198 Ga0209974_10038014 3300027876 Bacteria 1599
199 Ga0207428_10120129 3300027907 Bacteria 2015
200 Ga0268266_10171738 3300028379 Bacteria 1968
201 Ga0268265_10002476 3300028380 Bacteria 13880
202 Ga0268264_10211253 3300028381 Bacteria 1782
203 Ga0307408_100008873 3300031548 Bacteria 6642
204 Ga0307408_100299356 3300031548 Bacteria 1347
205 Ga0307408_100435378 3300031548 Bacteria 1134
206 Ga0307405_10035864 3300031731 Bacteria 2966
207 Ga0307405_10250632 3300031731 Bacteria 1317
208 Ga0307405_10311967 3300031731 Bacteria 1198
209 Ga0307413_10017959 3300031824 Bacteria 3698
210 Ga0307413_10201918 3300031824 Bacteria 1436
211 Ga0307410_10007965 3300031852 Bacteria 5841
212 Ga0307410_10059481 3300031852 Bacteria 2608
213 Ga0307410_10268016 3300031852 Bacteria 1335
214 Ga0307410_10303153 3300031852 Bacteria 1261
215 Ga0307410_10438486 3300031852 Bacteria 1063
216 Ga0307406_10018181 3300031901 Bacteria 4102
217 Ga0307407_10003324 3300031903 Bacteria 6571
218 Ga0307407_10035315 3300031903 Bacteria 2745
219 Ga0307412_10010833 3300031911 Archaea 5263
220 Ga0307409_100008381 3300031995 Bacteria 6269
221 Ga0307409_100089234 3300031995 Unclassified 2519
222 Ga0307409_100154048 3300031995 Bacteria 2000
223 Ga0307409_100502251 3300031995 Bacteria 1181
224 Ga0307416_100000289 3300032002 Bacteria 26280
225 Ga0307416_100032962 3300032002 Bacteria 3921
226 Ga0307416_100129996 3300032002 Bacteria 2265
227 Ga0307416_100184878 3300032002 Bacteria 1958
228 Ga0307416_100528184 3300032002 Bacteria 1249
229 Ga0307416_100540953 3300032002 Bacteria 1236
230 Ga0307416_100589692 3300032002 Bacteria 1190
231 Ga0307411_10022461 3300032005 Bacteria 3714
232 Ga0307411_10364106 3300032005 Bacteria 1183
233 Ga0307411_10530830 3300032005 Bacteria 1001
234 Ga0307415_100088941 3300032126 Unclassified 2229
235 Ga0395905_0028973 3300037471 Bacteria 5219
236 Ga0395905_0285916 3300037471 Bacteria 1536
237 Ga0436365_0443751 3300039437 Bacteria 9065
238 Ga0439446_0037820 3300042156 Bacteria 1414
239 Ga0451577_0580400 3300042876 Bacteria 1018
240 Ga0466969_0087750 3300044656 Bacteria 1477
241 Ga0453683_0417402 3300044673 Bacteria 866
242 Ga0466966_0036341 3300044684 Bacteria 3180
243 Ga0466961_0199973 3300044693 Bacteria 1236
244 Ga0466959_0008262 3300045049 Bacteria 7350
245 Ga0451576_0047489 3300045051 Bacteria 4513
246 Ga0451576_0067518 3300045051 Bacteria 3722
247 Ga0451576_0181192 3300045051 Bacteria 2199
248 Ga0451576_0344021 3300045051 Bacteria 1561
249 Ga0451576_0541305 3300045051 Bacteria 1223
250 Ga0466958_0402604 3300045836 Bacteria 884
251 Ga0495609_0098903 3300046538 Bacteria 1265
252 Ga0495667_0009139 3300046559 Bacteria 6731
253 Ga0495658_0189301 3300046683 Bacteria 1279
254 Ga0495677_0055370 3300047445 Bacteria 1464
255 Ga0496106_0492152 3300048909 Bacteria 985
256 Ga0496108_0144408 3300048911 Unclassified 2051
257 Ga0496110_0116530 3300048913 Bacteria 2405
258 Ga0496111_0079964 3300048914 Bacteria 2385
259 Ga0501039_0192331 3300049575 Bacteria 1604
260 Ga0501069_0106271 3300049585 Bacteria 1596
261 Ga0501072_0497610 3300049588 Bacteria 964
262 Ga0501249_049803 3300049679 Bacteria 961
263 Ga0501221_030089 3300049704 Bacteria 1127
264 Ga0501080_0013183 3300049742 Bacteria 7594
265 Ga0501080_0734052 3300049742 Bacteria 869
266 Ga0501273_019597 3300049770 Bacteria 908
267 nmdc:mga05p37_102856_c1 3300050507 Bacteria 3517
268 nmdc:mga05p37_147005_c1 3300050507 Bacteria 2885
269 nmdc:mga05p37_907639_c1 3300050507 Bacteria 949
270 nmdc:mga09592_35192_c1 3300050508 Bacteria 4191
271 nmdc:mga0qj67_10545_c1 3300050509 Bacteria 6903
272 nmdc:mga06r32_128150_c1 3300050510 Bacteria 2508
273 nmdc:mga06r32_60932_c1 3300050510 Bacteria 3631
274 nmdc:mga06r32_80013_c1 3300050510 Bacteria 3179
275 nmdc:mga08y16_1605_c2 3300050511 Bacteria 21111
276 nmdc:mga08y16_211546_c1 3300050511 Bacteria 2008
277 nmdc:mga08y16_91511_c1 3300050511 Bacteria 3170
278 nmdc:mga0n895_146315_c1 3300050512 Bacteria 2393
279 nmdc:mga0n895_20289_c1 3300050512 Bacteria 6195
280 nmdc:mga0n895_27340_c1 3300050512 Bacteria 5418
281 nmdc:mga08x19_270073_c1 3300050514 Bacteria 1177
282 nmdc:mga08x19_28521_c1 3300050514 Bacteria 3496
283 nmdc:mga08x19_430011_c1 3300050514 Bacteria 928
284 nmdc:mga08x19_4467_c1 3300050514 Bacteria 8286
285 nmdc:mga0a205_137453_c1 3300050515 Bacteria 2344
286 nmdc:mga0a205_149723_c1 3300050515 Bacteria 2234
287 nmdc:mga0a205_33982_c1 3300050515 Bacteria 4892
288 nmdc:mga0a205_472214_c1 3300050515 Bacteria 1113
289 nmdc:mga0a205_90539_c1 3300050515 Bacteria 2956
290 Ga0501084_0368972 3300054114 Bacteria 1213
291 Ga0501084_0452157 3300054114 Bacteria 1086
292 Ga0501082_0692784 3300060353 Bacteria 892
293 Ga0530510_0222269 3300061734 Bacteria 1404
294 Ga0453683_0009328
295 Ga0070658_10009744
296 Ga0070658_10076273
297 Ga0070683_100040932
298 Ga0070683_100083979
299 Ga0070683_100382881
300 Ga0070670_100043436
301 Ga0068869_100176649
302 Ga0070680_100038567
303 Ga0070680_100351268
304 Ga0070680_100656200
305 Ga0068868_100191534
306 Ga0070660_100052762
307 Ga0070691_10051228
308 Ga0070661_100130644
309 Ga0070692_10228134
310 Ga0070668_100004101
311 Ga0070668_100301374
312 Ga0070669_100112953
313 Ga0070675_100077751
314 Ga0070659_100159714
315 Ga0070709_10010533
316 Ga0070714_100002683
317 Ga0070711_100101807
318 Ga0070705_100004509
319 Ga0070705_100005790
320 Ga0070700_100258950
321 Ga0070694_100003594
322 Ga0070694_100022076
323 Ga0070694_100026235
324 Ga0070694_100046030
325 Ga0070663_100000953
326 Ga0070681_10067156
327 Ga0070681_10096200
328 Ga0068867_100125738
329 Ga0070706_100106690
330 Ga0070707_100190884
331 Ga0070707_100695573
332 Ga0070698_100263459
333 Ga0070699_100021085
334 Ga0070699_100042980
335 Ga0070699_100115685
336 Ga0070699_100175125
337 Ga0070679_100078547
338 Ga0070679_100143179
339 Ga0070684_100215096
340 Ga0070697_100001961
341 Ga0070697_100002036
342 Ga0070697_100020495
343 Ga0070697_100147652
344 Ga0070697_100205744
345 Ga0070672_100061411
346 Ga0070672_100246816
347 Ga0070695_100011223
348 Ga0070695_100011993
349 Ga0070695_100154045
350 Ga0070696_100005675
351 Ga0070696_100007175
352 Ga0070696_100021762
353 Ga0070696_100138278
354 Ga0070696_100156720
355 Ga0070696_100207131
356 Ga0070693_100162372
357 Ga0070693_100211008
358 Ga0070704_100000740
359 Ga0070704_100031676
360 Ga0070704_100053104
361 Ga0070704_100166207
362 Ga0070664_100063227
363 Ga0070664_100071132
364 Ga0070664_100257225
365 Ga0070664_100444400
366 Ga0068857_100114540
367 Ga0068854_100038839
368 Ga0068856_100098520
369 Ga0068861_100011261
370 Ga0068860_100147521
371 Ga0068862_100006115
372 Ga0070716_100001330
373 Ga0070716_100265899
374 Ga0070712_100232713
375 Ga0075428_100002328
376 Ga0075428_100300500
377 Ga0075428_100534469
378 Ga0075428_100703164
379 Ga0075430_100001969
380 Ga0075430_100017667
381 Ga0075431_100022887
382 Ga0075431_100064872
383 Ga0075431_100069960
384 Ga0075431_100100284
385 Ga0075431_100480874
386 Ga0075431_100688140
387 Ga0075433_10024358
388 Ga0075433_10059154
389 Ga0075434_100022692
390 Ga0075434_100033028
391 Ga0075434_100190296
392 Ga0075429_100038692
393 Ga0075429_100419741
394 Ga0075436_100029866
395 Ga0075436_100035617
396 Ga0075436_100042990
397 Ga0075436_100146258
398 Ga0075435_100060075
399 Ga0099794_10037883
400 Ga0105240_10091073
401 Ga0105240_10103959
402 Ga0105240_10117516
403 Ga0111539_10007186
404 Ga0111539_10189738
405 Ga0105245_10110334
406 Ga0114129_10582933
407 Ga0114129_10606048
408 Ga0114129_10643042
409 Ga0114129_10832581
410 Ga0105241_10000115
411 Ga0105248_10091084
412 Ga0105237_10002557
413 Ga0105238_10082370
414 Ga0105249_10000863
415 Ga0105239_10091254
416 Ga0105246_10453989
417 Ga0157371_10006826
418 Ga0157370_10042729
419 Ga0157369_10032808
420 Ga0157369_10334063
421 Ga0157374_10106115
422 Ga0157372_10036116
423 Ga0157375_10076907
424 Ga0157375_10194421
425 Ga0157380_10039784
426 Ga0182007_10014063
427 Ga0206353_10616206
428 Ga0213876_10011830
429 Ga0207682_10133312
430 Ga0207705_10002191
431 Ga0207705_10038878
432 Ga0207705_10332118
433 Ga0207684_10046140
434 Ga0207654_10000390
435 Ga0207707_10139271
436 Ga0207707_10364746
437 Ga0207695_10002793
438 Ga0207695_10305041
439 Ga0207671_10126305
440 Ga0207663_10086284
441 Ga0207660_10018233
442 Ga0207660_10239049
443 Ga0207660_10482817
444 Ga0207657_10003523
445 Ga0207649_10335430
446 Ga0207652_10001835
447 Ga0207652_10116860
448 Ga0207652_10118150
449 Ga0207652_10139365
450 Ga0207646_10042318
451 Ga0207646_10257698
452 Ga0207646_10297838
453 Ga0207681_10011200
454 Ga0207681_10054081
455 Ga0207664_10181786
456 Ga0207644_10636069
457 Ga0207690_10107992
458 Ga0207706_10148209
459 Ga0207706_10487086
460 Ga0207704_10078944
461 Ga0207665_10001828
462 Ga0207691_10019404
463 Ga0207691_10097114
464 Ga0207689_10410992
465 Ga0207661_10142849
466 Ga0207661_10167390
467 Ga0207679_10032082
468 Ga0207679_10080104
469 Ga0207679_10148984
470 Ga0207679_10748005
471 Ga0207667_10021636
472 Ga0207667_10349378
473 Ga0207667_10563857
474 Ga0207712_10011938
475 Ga0207668_10025176
476 Ga0207668_10613308
477 Ga0207640_10055782
478 Ga0207658_10312824
479 Ga0207677_10335262
480 Ga0207639_10434655
481 Ga0207639_10483058
482 Ga0207678_10001271
483 Ga0207678_10627709
484 Ga0207708_10382501
485 Ga0207702_10272330
486 Ga0207648_10053837
487 Ga0207648_10143716
488 Ga0207675_100005889
489 Ga0209588_1000132
490 Ga0209588_1002382
491 Ga0209974_10038014
492 Ga0207428_10120129
493 Ga0268266_10171738
494 Ga0268265_10002476
495 Ga0268264_10211253
496 Ga0307408_100008873
497 Ga0307408_100299356
498 Ga0307408_100435378
499 Ga0307405_10035864
500 Ga0307405_10250632
501 Ga0307405_10311967
502 Ga0307413_10017959
503 Ga0307413_10201918
504 Ga0307410_10007965
505 Ga0307410_10059481
506 Ga0307410_10268016
507 Ga0307410_10303153
508 Ga0307410_10438486
509 Ga0307406_10018181
510 Ga0307407_10003324
511 Ga0307407_10035315
512 Ga0307412_10010833
513 Ga0307409_100008381
514 Ga0307409_100089234
515 Ga0307409_100154048
516 Ga0307409_100502251
517 Ga0307416_100000289
518 Ga0307416_100032962
519 Ga0307416_100129996
520 Ga0307416_100184878
521 Ga0307416_100528184
522 Ga0307416_100540953
523 Ga0307416_100589692
524 Ga0307411_10022461
525 Ga0307411_10364106
526 Ga0307411_10530830
527 Ga0307415_100088941
528 Ga0395905_0028973
529 Ga0395905_0285916
530 Ga0436365_0443751
531 Ga0439446_0037820
532 Ga0451577_0580400
533 Ga0466969_0087750
534 Ga0453683_0417402
535 Ga0466966_0036341
536 Ga0466961_0199973
537 Ga0466959_0008262
538 Ga0451576_0047489
539 Ga0451576_0067518
540 Ga0451576_0181192
541 Ga0451576_0344021
542 Ga0451576_0541305
543 Ga0466958_0402604
544 Ga0495609_0098903
545 Ga0495667_0009139
546 Ga0495658_0189301
547 Ga0495677_0055370
548 Ga0496106_0492152
549 Ga0496108_0144408
550 Ga0496110_0116530
551 Ga0496111_0079964
552 Ga0501039_0192331
553 Ga0501069_0106271
554 Ga0501072_0497610
555 Ga0501249_049803
556 Ga0501221_030089
557 Ga0501080_0013183
558 Ga0501080_0734052
559 Ga0501273_019597
560 nmdc:mga05p37_102856_c1
561 nmdc:mga05p37_147005_c1
562 nmdc:mga05p37_907639_c1
563 nmdc:mga09592_35192_c1
564 nmdc:mga0qj67_10545_c1
565 nmdc:mga06r32_128150_c1
566 nmdc:mga06r32_60932_c1
567 nmdc:mga06r32_80013_c1
568 nmdc:mga08y16_1605_c2
569 nmdc:mga08y16_211546_c1
570 nmdc:mga08y16_91511_c1
571 nmdc:mga0n895_146315_c1
572 nmdc:mga0n895_20289_c1
573 nmdc:mga0n895_27340_c1
574 nmdc:mga08x19_270073_c1
575 nmdc:mga08x19_28521_c1
576 nmdc:mga08x19_430011_c1
577 nmdc:mga08x19_4467_c1
578 nmdc:mga0a205_137453_c1
579 nmdc:mga0a205_149723_c1
580 nmdc:mga0a205_33982_c1
581 nmdc:mga0a205_472214_c1
582 nmdc:mga0a205_90539_c1
583 Ga0501084_0368972
584 Ga0501084_0452157
585 Ga0501082_0692784
586 Ga0530510_0222269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

24

206

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9247 1 220
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9237 1 220
1o95-assembly1.cif.gz_C ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9186 1 220
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.8899 1 220
1o96-assembly3.cif.gz_E structure of electron transferring flavoprotein for methylophilus methylotrophus. 0.8822 1 244
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9247 1 220 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9198 1 220 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8899 1 220 3.40.50.620
af_F1LYQ6_543_686_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.873 144 170 2.130.10.10
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8673 1 220 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7X5VRZ0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9741 32 175 GO:0009055
AF-A0A800K6X5-F1-model_v4 Electron transfer flavoprotein beta subunit/FixA family protein 0.965 1 220 GO:0009055
AF-A0A365VPY6-F1-model_v4 deleted 0.9639 42 204
AF-X1LKP6-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.9611 40 204 GO:0003824
GO:0009055
AF-A0A7X5VRZ0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.961 32 175 GO:0009055

Map