F391511

General Info

Members Datasets Scaffolds Average Seq Length
293 174 285 293

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10000903|Ga0157379_1000090310
Length 298
Sequence MRMSTIAFIGVGNMGGPMARNLLKAQEQVRAFDVSPAALKPVVESGAKQANTALDAVKGADVVITMLPAGAHVRSVYLEDASIMSAARKDAVLIDCSTIDIDSARAVHATAERAGFDFLDAPVSGGVGGAEAGTLAFMCGGSDKAFARAKPFLEKMGKRIVHAGGAGAGQAAKICNNMLLAISMIGTCEAFVLGEKLGLDHQKLFDIMSAASGQCWSLTSYCPVPGPVQASPSNRDYSGGFATSLMLKDLKLAQNAALSAGANTPLGAEAEQLYSLFDSKGHGALDFSGIIKMLRGDM

Samples

Sample ID Description Type Environment
1 2643221736 Bosea sp. Root483D1 Isolate Unclassified
2 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
3 2841760612 Bosea sp. Tri-49 Isolate Nodule
4 2844104063 Bosea sp. Tri-39 Isolate Nodule
5 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
6 2851182111 Bosea sp. Tri-44 Isolate Nodule
7 2851246043 Bosea sp. Tri-54 Isolate Nodule
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
47 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
98 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
99 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
118 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
171 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
172 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 4.1
Rhizoplane 2.05
Rhizosphere 86.01
Stem 0
Stem Tuber 0
Unclassified 5.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006922 3300002987 Bacteria 3315
2 rootH2_10004048 3300003320 Bacteria 9099
3 Ga0065165_1000062 3300005262 Bacteria 178885
4 Ga0070658_10005037 3300005327 Bacteria 10752
5 Ga0070683_100532189 3300005329 Bacteria 1123
6 Ga0070660_100000531 3300005339 Bacteria 25439
7 Ga0070691_10006078 3300005341 Bacteria 5510
8 Ga0070691_10009989 3300005341 Bacteria 4324
9 Ga0070691_10030949 3300005341 Bacteria 2508
10 Ga0070661_100000019 3300005344 Bacteria 132428
11 Ga0070661_100034583 3300005344 Bacteria 3665
12 Ga0070709_10002394 3300005434 Bacteria 10160
13 Ga0070709_10046293 3300005434 Bacteria 2704
14 Ga0070713_100000007 3300005436 Bacteria 186402
15 Ga0070711_100228469 3300005439 Bacteria 1450
16 Ga0070700_100162823 3300005441 Bacteria 1537
17 Ga0070694_100159838 3300005444 Bacteria 1652
18 Ga0070681_10000002 3300005458 Bacteria 821814
19 Ga0070699_100169588 3300005518 Bacteria 1934
20 Ga0070679_100000062 3300005530 Bacteria 79849
21 Ga0068853_100000192 3300005539 Bacteria 42895
22 Ga0068853_100000341 3300005539 Bacteria 32498
23 Ga0068853_100017631 3300005539 Bacteria 5893
24 Ga0068853_100066224 3300005539 Bacteria 3137
25 Ga0070695_100002254 3300005545 Bacteria 11040
26 Ga0070695_100014166 3300005545 Bacteria 4804
27 Ga0070693_100069152 3300005547 Bacteria 2074
28 Ga0070665_100335055 3300005548 Bacteria 1518
29 Ga0068855_100000024 3300005563 Bacteria 184241
30 Ga0068855_100018233 3300005563 Bacteria 8432
31 Ga0068855_100207853 3300005563 Bacteria 2201
32 Ga0068857_100000974 3300005577 Bacteria 21916
33 Ga0068854_100011000 3300005578 Bacteria 5872
34 Ga0068856_100000142 3300005614 Bacteria 72931
35 Ga0068856_100001227 3300005614 Bacteria 26880
36 Ga0068856_100136212 3300005614 Bacteria 2461
37 Ga0068852_100004882 3300005616 Bacteria 9523
38 Ga0068852_100022283 3300005616 Bacteria 5078
39 Ga0068852_100073158 3300005616 Bacteria 3015
40 Ga0068861_100242652 3300005719 Bacteria 1533
41 Ga0068858_100100098 3300005842 Bacteria 2703
42 Ga0081455_10000014 3300005937 Bacteria 193884
43 Ga0081540_1000455 3300005983 Bacteria 40662
44 Ga0070716_100111808 3300006173 Bacteria 1694
45 Ga0070712_100000015 3300006175 Bacteria 106593
46 Ga0097621_100133376 3300006237 Bacteria 2116
47 Ga0075428_100011084 3300006844 Bacteria 10028
48 Ga0075431_100010036 3300006847 Bacteria 9512
49 Ga0075433_10000620 3300006852 Bacteria 23661
50 Ga0075433_10397995 3300006852 Bacteria 1215
51 Ga0075434_100001438 3300006871 Bacteria 19988
52 Ga0075434_100042153 3300006871 Bacteria 4524
53 Ga0075434_100048256 3300006871 Bacteria 4225
54 Ga0075429_100010008 3300006880 Bacteria 8219
55 Ga0075436_100000100 3300006914 Bacteria 51034
56 Ga0099824_1015014 3300006942 Bacteria 7492
57 Ga0099822_1001480 3300006943 Bacteria 27484
58 Ga0075435_100002141 3300007076 Bacteria 13020
59 Ga0075435_100023915 3300007076 Bacteria 4734
60 Ga0105240_10000132 3300009093 Bacteria 152512
61 Ga0105240_10047260 3300009093 Bacteria 5447
62 Ga0105240_10200086 3300009093 Bacteria 2342
63 Ga0111539_10005178 3300009094 Bacteria 16895
64 Ga0111539_10006730 3300009094 Bacteria 14789
65 Ga0105247_10007163 3300009101 Bacteria 6845
66 Ga0114129_10020811 3300009147 Bacteria 9319
67 Ga0114129_10169147 3300009147 Bacteria 2981
68 Ga0105241_10013841 3300009174 Bacteria 5909
69 Ga0105242_10130825 3300009176 Bacteria 2166
70 Ga0105248_10000015 3300009177 Bacteria 322959
71 Ga0105248_10345005 3300009177 Bacteria 1676
72 Ga0105237_10020468 3300009545 Bacteria 6817
73 Ga0105237_10126182 3300009545 Bacteria 2553
74 Ga0105238_10001069 3300009551 Bacteria 27648
75 Ga0105238_10009122 3300009551 Bacteria 9928
76 Ga0105238_10030438 3300009551 Bacteria 5495
77 Ga0105239_10002163 3300010375 Bacteria 25281
78 Ga0105239_10118028 3300010375 Bacteria 2944
79 Ga0157373_10000231 3300013100 Bacteria 45740
80 Ga0157370_10020678 3300013104 Bacteria 6568
81 Ga0157369_10026355 3300013105 Bacteria 6448
82 Ga0157369_10056249 3300013105 Bacteria 4246
83 Ga0157378_10055566 3300013297 Bacteria 3527
84 Ga0163162_10088211 3300013306 Bacteria 3181
85 Ga0163162_10106497 3300013306 Bacteria 2899
86 Ga0157372_10007254 3300013307 Bacteria 11804
87 Ga0157372_10012756 3300013307 Bacteria 8953
88 Ga0157372_10149056 3300013307 Bacteria 2699
89 Ga0157372_10188816 3300013307 Bacteria 2386
90 Ga0182008_10075676 3300014497 Bacteria 1656
91 Ga0157379_10000903 3300014968 Bacteria 24017
92 Ga0157379_10029252 3300014968 Bacteria 4900
93 Ga0213876_10000175 3300021384 Bacteria 66420
94 Ga0213876_10000549 3300021384 Bacteria 28086
95 Ga0213876_10031540 3300021384 Bacteria 2796
96 Ga0213875_10002544 3300021388 Bacteria 10884
97 Ga0209130_1000174 3300025284 Bacteria 91725
98 Ga0209025_1059371 3300025294 Bacteria 1444
99 Ga0207710_10016612 3300025900 Bacteria 3115
100 Ga0207699_10000660 3300025906 Bacteria 16579
101 Ga0207699_10004918 3300025906 Bacteria 6395
102 Ga0207705_10000343 3300025909 Bacteria 42039
103 Ga0207654_10028089 3300025911 Bacteria 3065
104 Ga0207707_10000002 3300025912 Bacteria 1142054
105 Ga0207707_10005670 3300025912 Bacteria 10926
106 Ga0207695_10000003 3300025913 Bacteria 1368691
107 Ga0207695_10039393 3300025913 Bacteria 5080
108 Ga0207695_10064804 3300025913 Bacteria 3760
109 Ga0207695_10179613 3300025913 Bacteria 2038
110 Ga0207671_10008061 3300025914 Bacteria 9000
111 Ga0207693_10000048 3300025915 Bacteria 100685
112 Ga0207660_10000025 3300025917 Bacteria 69889
113 Ga0207660_10000782 3300025917 Bacteria 21122
114 Ga0207657_10000340 3300025919 Bacteria 49509
115 Ga0207649_10001111 3300025920 Bacteria 16338
116 Ga0207649_10042186 3300025920 Bacteria 2782
117 Ga0207652_10000053 3300025921 Bacteria 118700
118 Ga0207652_10001279 3300025921 Bacteria 22410
119 Ga0207694_10000016 3300025924 Bacteria 349087
120 Ga0207694_10107494 3300025924 Bacteria 2216
121 Ga0207700_10000014 3300025928 Bacteria 229475
122 Ga0207664_10076040 3300025929 Bacteria 2717
123 Ga0207664_10520662 3300025929 Bacteria 1066
124 Ga0207686_10113658 3300025934 Bacteria 1831
125 Ga0207711_10000003 3300025941 Bacteria 1042791
126 Ga0207711_10000005 3300025941 Bacteria 822972
127 Ga0207711_10000009 3300025941 Bacteria 580864
128 Ga0207711_10209583 3300025941 Bacteria 1780
129 Ga0207661_10370503 3300025944 Bacteria 1295
130 Ga0207667_10000021 3300025949 Bacteria 370524
131 Ga0207667_10038471 3300025949 Bacteria 5109
132 Ga0207667_10107245 3300025949 Bacteria 2881
133 Ga0207667_10419503 3300025949 Bacteria 1362
134 Ga0207640_10149055 3300025981 Bacteria 1716
135 Ga0207703_10018817 3300026035 Bacteria 5394
136 Ga0207639_10000313 3300026041 Bacteria 34326
137 Ga0207639_10010554 3300026041 Bacteria 6397
138 Ga0207639_10050121 3300026041 Bacteria 3169
139 Ga0207639_10081841 3300026041 Bacteria 2558
140 Ga0207708_10045504 3300026075 Bacteria 3345
141 Ga0207702_10000066 3300026078 Bacteria 117825
142 Ga0207702_10004558 3300026078 Bacteria 12279
143 Ga0207702_10747149 3300026078 Bacteria 966
144 Ga0207674_10000004 3300026116 Bacteria 241430
145 Ga0207698_10009353 3300026142 Bacteria 6245
146 Ga0207698_10024079 3300026142 Bacteria 4267
147 Ga0209589_1000001 3300027357 Bacteria 794224
148 Ga0209489_100001 3300027361 Bacteria 794224
149 Ga0209700_100001 3300027363 Bacteria 794224
150 Ga0207428_10008744 3300027907 Bacteria 9134
151 Ga0207428_10026326 3300027907 Bacteria 4855
152 Ga0265334_10009656 3300028573 Bacteria 4079
153 Ga0265318_10000025 3300028577 Bacteria 159237
154 Ga0265338_10000869 3300028800 Bacteria 51220
155 Ga0265338_10059501 3300028800 Bacteria 3365
156 Ga0265338_10070138 3300028800 Bacteria 3007
157 Ga0265332_10014026 3300031238 Bacteria 3546
158 Ga0265332_10047091 3300031238 Bacteria 1856
159 Ga0265332_10089280 3300031238 Bacteria 1304
160 Ga0265332_10095127 3300031238 Bacteria 1259
161 Ga0265320_10000097 3300031240 Bacteria 74341
162 Ga0265325_10000112 3300031241 Bacteria 55792
163 Ga0265325_10006453 3300031241 Bacteria 7111
164 Ga0265325_10018755 3300031241 Bacteria 3836
165 Ga0265325_10036706 3300031241 Bacteria 2595
166 Ga0265340_10026316 3300031247 Bacteria 2941
167 Ga0265340_10026507 3300031247 Bacteria 2929
168 Ga0265340_10182240 3300031247 Bacteria 949
169 Ga0265339_10001618 3300031249 Bacteria 16654
170 Ga0265339_10075757 3300031249 Bacteria 1785
171 Ga0265331_10000054 3300031250 Bacteria 180181
172 Ga0265331_10003224 3300031250 Bacteria 10628
173 Ga0265331_10006497 3300031250 Bacteria 6901
174 Ga0265331_10020551 3300031250 Bacteria 3387
175 Ga0265327_10001912 3300031251 Bacteria 24043
176 Ga0265327_10030808 3300031251 Bacteria 3026
177 Ga0265316_10275902 3300031344 Bacteria 1229
178 Ga0265313_10005780 3300031595 Bacteria 8987
179 Ga0265313_10006697 3300031595 Bacteria 8072
180 Ga0265313_10071991 3300031595 Bacteria 1589
181 Ga0265313_10116950 3300031595 Bacteria 1167
182 Ga0265314_10000754 3300031711 Bacteria 38698
183 Ga0265314_10005531 3300031711 Bacteria 11369
184 Ga0265314_10009531 3300031711 Bacteria 8183
185 Ga0265314_10095669 3300031711 Bacteria 1922
186 Ga0265314_10177040 3300031711 Bacteria 1282
187 Ga0265342_10004007 3300031712 Bacteria 11773
188 Ga0265342_10014382 3300031712 Bacteria 5255
189 Ga0265342_10107244 3300031712 Bacteria 1585
190 Ga0316576_10067427 3300031727 Unclassified 2634
191 Ga0316576_10144777 3300031727 Bacteria 1790
192 Ga0307516_10025385 3300031730 Bacteria 6035
193 Ga0373958_0013547 3300034819 Bacteria 1414
194 Ga0373938_0047783 3300034957 Bacteria 969
195 Ga0373952_0025073 3300035092 Bacteria 1285
196 Ga0373932_0102992 3300035112 Bacteria 931
197 Ga0373954_0128297 3300035118 Bacteria 1234
198 Ga0373955_0036780 3300035172 Bacteria 2600
199 Ga0373931_0004215 3300035691 Bacteria 6547
200 Ga0373931_0181408 3300035691 Bacteria 1247
201 Ga0373937_0387990 3300036401 Bacteria 1325
202 Ga0436364_0133943 3300037853 Bacteria 9607
203 Ga0436365_0107178 3300039437 Bacteria 3817
204 Ga0436365_0766183 3300039437 Bacteria 2327
205 Ga0436365_1026614 3300039437 Bacteria 53933
206 Ga0436365_1340216 3300039437 Bacteria 877
207 Ga0436365_1612150 3300039437 Bacteria 85869
208 Ga0436360_0470253 3300039438 Bacteria 1630
209 Ga0436361_1132286 3300039447 Bacteria 1113
210 Ga0436363_1011850 3300039450 Bacteria 5507
211 Ga0436362_0041086 3300039453 Bacteria 2363
212 Ga0436362_0990496 3300039453 Bacteria 1243
213 Ga0495580_0071363 3300046472 Bacteria 2426
214 Ga0495652_0049122 3300046529 Bacteria 3613
215 Ga0495645_0038168 3300046543 Bacteria 3503
216 Ga0496101_0049293 3300048904 Bacteria 3029
217 Ga0496105_0101680 3300048908 Bacteria 2373
218 Ga0496106_0291970 3300048909 Bacteria 1307
219 Ga0496108_0077699 3300048911 Bacteria 2808
220 Ga0496112_0068143 3300048915 Bacteria 3514
221 Ga0496113_0041166 3300048916 Bacteria 3408
222 Ga0496126_0002906 3300048929 Bacteria 22317
223 Ga0496126_0037779 3300048929 Bacteria 4501
224 Ga0495682_0001030 3300049460 Bacteria 16454
225 Ga0501033_0168004 3300049570 Bacteria 1576
226 Ga0501034_0060660 3300049571 Bacteria 3799
227 Ga0501036_0285047 3300049572 Bacteria 1382
228 Ga0501037_0021169 3300049573 Bacteria 4805
229 Ga0501037_0156503 3300049573 Bacteria 1626
230 Ga0501037_0204823 3300049573 Bacteria 1393
231 Ga0501037_0260487 3300049573 Bacteria 1212
232 Ga0501038_0073581 3300049574 Bacteria 2893
233 Ga0501038_0273557 3300049574 Bacteria 1331
234 Ga0501043_0019047 3300049579 Bacteria 5389
235 Ga0501043_0084448 3300049579 Bacteria 2495
236 Ga0501043_0150117 3300049579 Bacteria 1824
237 Ga0501046_0041468 3300049580 Bacteria 3673
238 Ga0501047_0026625 3300049581 Bacteria 5565
239 Ga0501047_0053609 3300049581 Bacteria 3900
240 Ga0501047_0133945 3300049581 Bacteria 2358
241 Ga0501047_0347606 3300049581 Bacteria 1320
242 Ga0501048_0021942 3300049582 Bacteria 4674
243 Ga0501067_0005948 3300049583 Bacteria 6763
244 Ga0501067_0019558 3300049583 Bacteria 3750
245 Ga0501069_0068907 3300049585 Bacteria 1980
246 Ga0501069_0070767 3300049585 Bacteria 1955
247 Ga0501070_0000002 3300049586 Bacteria 347524
248 Ga0501070_0006731 3300049586 Bacteria 9786
249 Ga0501070_0009688 3300049586 Bacteria 8147
250 Ga0501070_0079152 3300049586 Bacteria 2720
251 Ga0501072_0006068 3300049588 Bacteria 9225
252 Ga0501073_0119715 3300049589 Bacteria 1824
253 Ga0501074_0042727 3300049590 Bacteria 3279
254 Ga0501080_0011529 3300049742 Bacteria 8094
255 Ga0501080_0077000 3300049742 Bacteria 3101
256 Ga0501080_0185845 3300049742 Bacteria 1911
257 Ga0501083_0082005 3300049744 Bacteria 2138
258 Ga0501035_0000579 3300049822 Bacteria 40337
259 Ga0501035_0023581 3300049822 Bacteria 5645
260 Ga0501035_0192743 3300049822 Bacteria 1752
261 Ga0501044_0010951 3300049823 Bacteria 9844
262 Ga0501044_0025175 3300049823 Bacteria 6309
263 Ga0501044_0043694 3300049823 Bacteria 4654
264 Ga0501044_0108017 3300049823 Bacteria 2793
265 nmdc:mga05p37_1191_c1 3300050507 Bacteria 30041
266 nmdc:mga09592_7325_c1 3300050508 Bacteria 8968
267 nmdc:mga06r32_6718_c1 3300050510 Bacteria 10340
268 nmdc:mga08y16_1654_c1 3300050511 Bacteria 22592
269 nmdc:mga08y16_78582_c1 3300050511 Bacteria 3440
270 nmdc:mga08y16_87585_c1 3300050511 Bacteria 3245
271 nmdc:mga0n895_31855_c1 3300050512 Bacteria 5054
272 nmdc:mga0n895_51986_c1 3300050512 Bacteria 4021
273 nmdc:mga0n895_7873_c1 3300050512 Bacteria 9187
274 nmdc:mga0rr50_10235_c1 3300050513 Bacteria 5940
275 nmdc:mga0rr50_13675_c1 3300050513 Bacteria 5295
276 nmdc:mga0rr50_176323_c1 3300050513 Bacteria 1745
277 nmdc:mga0rr50_8664_c1 3300050513 Bacteria 6341
278 nmdc:mga08x19_52_c1 3300050514 Bacteria 123790
279 nmdc:mga0a205_9191_c1 3300050515 Bacteria 9023
280 Ga0495619_0028666 3300053085 Bacteria 3593
281 Ga0500608_000148 3300053122 Bacteria 29285
282 Ga0500655_015681 3300053133 Bacteria 1391
283 Ga0500619_000636 3300053154 Bacteria 5949
284 Ga0501084_0012635 3300054114 Bacteria 6996
285 Ga0501084_0079938 3300054114 Bacteria 2741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0084448 Ga0501043_0084448_20_787 246
2 3300048904 Ga0496101_0049293 Ga0496101_0049293_1234_2169 254
3 3300048908 Ga0496105_0101680 Ga0496105_0101680_695_1630 254
4 3300048911 Ga0496108_0077699 Ga0496108_0077699_1268_2203 254
5 3300048915 Ga0496112_0068143 Ga0496112_0068143_600_1535 254
6 3300048916 Ga0496113_0041166 Ga0496113_0041166_383_1318 254
7 3300031250 Ga0265331_10000054 Ga0265331_1000005461 255
8 3300031711 Ga0265314_10095669 Ga0265314_100956692 255
9 3300031711 Ga0265314_10005531 Ga0265314_100055319 264
10 3300039437 Ga0436365_1340216 Ga0436365_1340216_13_855 265
11 3300005327 Ga0070658_10005037 Ga0070658_100050376 270
12 3300005339 Ga0070660_100000531 Ga0070660_1000005313 270
13 3300005341 Ga0070691_10006078 Ga0070691_100060786 270
14 3300005539 Ga0068853_100066224 Ga0068853_1000662243 270
15 3300005563 Ga0068855_100018233 Ga0068855_10001823310 270
16 3300009551 Ga0105238_10009122 Ga0105238_100091229 270
17 3300025909 Ga0207705_10000343 Ga0207705_1000034329 270
18 3300025912 Ga0207707_10005670 Ga0207707_1000567014 270
19 3300025917 Ga0207660_10000782 Ga0207660_1000078224 270
20 3300025919 Ga0207657_10000340 Ga0207657_1000034024 270
21 3300025921 Ga0207652_10001279 Ga0207652_100012794 270
22 3300026041 Ga0207639_10081841 Ga0207639_100818413 270
23 3300035092 Ga0373952_0025073 Ga0373952_0025073_33_875 272
24 3300049574 Ga0501038_0273557 Ga0501038_0273557_474_1319 272
25 3300053085 Ga0495619_0028666 Ga0495619_0028666_192_1079 273
26 3300013307 Ga0157372_10007254 Ga0157372_1000725410 276
27 3300028800 Ga0265338_10059501 Ga0265338_100595012 276
28 3300031238 Ga0265332_10095127 Ga0265332_100951272 276
29 3300049581 Ga0501047_0026625 Ga0501047_0026625_17_874 276
30 3300006871 Ga0075434_100042153 Ga0075434_1000421533 277
31 3300050512 nmdc:mga0n895_31855_c1 nmdc:mga0n895_31855_c1_1444_2331 277
32 3300050513 nmdc:mga0rr50_8664_c1 nmdc:mga0rr50_8664_c1_175_1062 277
33 3300021384 Ga0213876_10031540 Ga0213876_100315402 280
34 3300031247 Ga0265340_10026316 Ga0265340_100263162 280
35 3300031251 Ga0265327_10030808 Ga0265327_100308083 280
36 3300031711 Ga0265314_10177040 Ga0265314_101770402 280
37 3300039437 Ga0436365_0766183 Ga0436365_0766183_935_1822 280
38 3300039453 Ga0436362_0990496 Ga0436362_0990496_267_1154 280
39 3300006844 Ga0075428_100011084 Ga0075428_1000110844 281
40 3300006847 Ga0075431_100010036 Ga0075431_1000100367 281
41 3300006880 Ga0075429_100010008 Ga0075429_1000100084 281
42 3300009094 Ga0111539_10006730 Ga0111539_100067304 281
43 3300009147 Ga0114129_10020811 Ga0114129_100208113 281
44 3300027907 Ga0207428_10026326 Ga0207428_100263263 281
45 3300039438 Ga0436360_0470253 Ga0436360_0470253_180_1070 281
46 3300039447 Ga0436361_1132286 Ga0436361_1132286_158_1054 281
47 3300039453 Ga0436362_0041086 Ga0436362_0041086_1077_1973 281
48 3300050507 nmdc:mga05p37_1191_c1 nmdc:mga05p37_1191_c1_829_1716 281
49 3300050508 nmdc:mga09592_7325_c1 nmdc:mga09592_7325_c1_1750_2637 281
50 3300050510 nmdc:mga06r32_6718_c1 nmdc:mga06r32_6718_c1_1851_2738 281
51 3300050511 nmdc:mga08y16_1654_c1 nmdc:mga08y16_1654_c1_11899_12786 281
52 3300028800 Ga0265338_10070138 Ga0265338_100701383 285
53 iso_pu_bacteria 2643221736 2644742492 285
54 iso_pu_bacteria 2728368998 2728753506 285
55 iso_pu_bacteria 2841760612 2841763893 285
56 iso_pu_bacteria 2844104063 2844108652 285
57 iso_pu_bacteria 2849076700 2849079081 285
58 iso_pu_bacteria 2851182111 2851185107 285
59 iso_pu_bacteria 2851246043 2851250328 285
60 iso_pu_bacteria 8057529695 8057534173 285
61 3300021384 Ga0213876_10000549 Ga0213876_100005498 286
62 3300031238 Ga0265332_10047091 Ga0265332_100470912 286
63 3300031250 Ga0265331_10020551 Ga0265331_100205513 286
64 3300039437 Ga0436365_0107178 Ga0436365_0107178_2104_2991 286
65 3300039437 Ga0436365_1026614 Ga0436365_1026614_50919_51803 286
66 3300048929 Ga0496126_0002906 Ga0496126_0002906_1616_2503 286
67 3300053122 Ga0500608_000148 Ga0500608_000148_26139_27017 286
68 3300003320 rootH2_10004048 rootH2_100040488 287
69 3300005329 Ga0070683_100532189 Ga0070683_1005321891 287
70 3300005341 Ga0070691_10009989 Ga0070691_100099894 287
71 3300005341 Ga0070691_10030949 Ga0070691_100309493 287
72 3300005344 Ga0070661_100000019 Ga0070661_1000000197 287
73 3300005344 Ga0070661_100034583 Ga0070661_1000345833 287
74 3300005434 Ga0070709_10002394 Ga0070709_100023943 287
75 3300005434 Ga0070709_10046293 Ga0070709_100462933 287
76 3300005436 Ga0070713_100000007 Ga0070713_10000000795 287
77 3300005439 Ga0070711_100228469 Ga0070711_1002284692 287
78 3300005441 Ga0070700_100162823 Ga0070700_1001628232 287
79 3300005444 Ga0070694_100159838 Ga0070694_1001598382 287
80 3300005458 Ga0070681_10000002 Ga0070681_10000002277 287
81 3300005518 Ga0070699_100169588 Ga0070699_1001695882 287
82 3300005530 Ga0070679_100000062 Ga0070679_10000006283 287
83 3300005539 Ga0068853_100000192 Ga0068853_10000019224 287
84 3300005539 Ga0068853_100000341 Ga0068853_1000003417 287
85 3300005539 Ga0068853_100017631 Ga0068853_1000176312 287
86 3300005545 Ga0070695_100002254 Ga0070695_1000022546 287
87 3300005545 Ga0070695_100014166 Ga0070695_1000141664 287
88 3300005547 Ga0070693_100069152 Ga0070693_1000691522 287
89 3300005548 Ga0070665_100335055 Ga0070665_1003350552 287
90 3300005563 Ga0068855_100000024 Ga0068855_100000024142 287
91 3300005563 Ga0068855_100207853 Ga0068855_1002078532 287
92 3300005577 Ga0068857_100000974 Ga0068857_10000097421 287
93 3300005578 Ga0068854_100011000 Ga0068854_1000110002 287
94 3300005614 Ga0068856_100000142 Ga0068856_10000014262 287
95 3300005614 Ga0068856_100001227 Ga0068856_1000012273 287
96 3300005614 Ga0068856_100136212 Ga0068856_1001362122 287
97 3300005616 Ga0068852_100004882 Ga0068852_1000048823 287
98 3300005616 Ga0068852_100022283 Ga0068852_1000222833 287
99 3300005616 Ga0068852_100073158 Ga0068852_1000731582 287
100 3300005719 Ga0068861_100242652 Ga0068861_1002426522 287
101 3300005842 Ga0068858_100100098 Ga0068858_1001000982 287
102 3300005937 Ga0081455_10000014 Ga0081455_1000001412 287
103 3300005983 Ga0081540_1000455 Ga0081540_100045521 287
104 3300006173 Ga0070716_100111808 Ga0070716_1001118082 287
105 3300006175 Ga0070712_100000015 Ga0070712_10000001516 287
106 3300006237 Ga0097621_100133376 Ga0097621_1001333762 287
107 3300006852 Ga0075433_10000620 Ga0075433_1000062017 287
108 3300006852 Ga0075433_10397995 Ga0075433_103979952 287
109 3300006871 Ga0075434_100001438 Ga0075434_1000014389 287
110 3300006871 Ga0075434_100048256 Ga0075434_1000482563 287
111 3300006914 Ga0075436_100000100 Ga0075436_1000001003 287
112 3300007076 Ga0075435_100002141 Ga0075435_1000021415 287
113 3300007076 Ga0075435_100023915 Ga0075435_1000239152 287
114 3300009093 Ga0105240_10000132 Ga0105240_10000132110 287
115 3300009093 Ga0105240_10047260 Ga0105240_100472605 287
116 3300009093 Ga0105240_10200086 Ga0105240_102000862 287
117 3300009094 Ga0111539_10005178 Ga0111539_1000517810 287
118 3300009101 Ga0105247_10007163 Ga0105247_100071634 287
119 3300009147 Ga0114129_10169147 Ga0114129_101691471 287
120 3300009174 Ga0105241_10013841 Ga0105241_100138413 287
121 3300009176 Ga0105242_10130825 Ga0105242_101308252 287
122 3300009177 Ga0105248_10000015 Ga0105248_10000015140 287
123 3300009177 Ga0105248_10345005 Ga0105248_103450052 287
124 3300009545 Ga0105237_10020468 Ga0105237_100204684 287
125 3300009545 Ga0105237_10126182 Ga0105237_101261822 287
126 3300009551 Ga0105238_10001069 Ga0105238_100010698 287
127 3300009551 Ga0105238_10030438 Ga0105238_100304383 287
128 3300010375 Ga0105239_10002163 Ga0105239_100021633 287
129 3300010375 Ga0105239_10118028 Ga0105239_101180282 287
130 3300013100 Ga0157373_10000231 Ga0157373_1000023138 287
131 3300013104 Ga0157370_10020678 Ga0157370_100206785 287
132 3300013105 Ga0157369_10026355 Ga0157369_100263556 287
133 3300013105 Ga0157369_10056249 Ga0157369_100562493 287
134 3300013297 Ga0157378_10055566 Ga0157378_100555662 287
135 3300013306 Ga0163162_10088211 Ga0163162_100882111 287
136 3300013306 Ga0163162_10106497 Ga0163162_101064972 287
137 3300013307 Ga0157372_10012756 Ga0157372_100127564 287
138 3300013307 Ga0157372_10149056 Ga0157372_101490562 287
139 3300013307 Ga0157372_10188816 Ga0157372_101888162 287
140 3300014497 Ga0182008_10075676 Ga0182008_100756762 287
141 3300014968 Ga0157379_10000903 Ga0157379_1000090310 287
142 3300014968 Ga0157379_10029252 Ga0157379_100292522 287
143 3300021384 Ga0213876_10000175 Ga0213876_100001756 287
144 3300021388 Ga0213875_10002544 Ga0213875_100025448 287
145 3300025900 Ga0207710_10016612 Ga0207710_100166123 287
146 3300025906 Ga0207699_10000660 Ga0207699_100006604 287
147 3300025906 Ga0207699_10004918 Ga0207699_100049186 287
148 3300025911 Ga0207654_10028089 Ga0207654_100280892 287
149 3300025912 Ga0207707_10000002 Ga0207707_10000002676 287
150 3300025913 Ga0207695_10000003 Ga0207695_10000003264 287
151 3300025913 Ga0207695_10039393 Ga0207695_100393936 287
152 3300025913 Ga0207695_10064804 Ga0207695_100648042 287
153 3300025913 Ga0207695_10179613 Ga0207695_101796132 287
154 3300025914 Ga0207671_10008061 Ga0207671_100080618 287
155 3300025915 Ga0207693_10000048 Ga0207693_1000004813 287
156 3300025917 Ga0207660_10000025 Ga0207660_1000002528 287
157 3300025920 Ga0207649_10001111 Ga0207649_100011119 287
158 3300025920 Ga0207649_10042186 Ga0207649_100421863 287
159 3300025921 Ga0207652_10000053 Ga0207652_1000005388 287
160 3300025924 Ga0207694_10000016 Ga0207694_10000016238 287
161 3300025924 Ga0207694_10107494 Ga0207694_101074942 287
162 3300025928 Ga0207700_10000014 Ga0207700_10000014128 287
163 3300025929 Ga0207664_10076040 Ga0207664_100760402 287
164 3300025929 Ga0207664_10520662 Ga0207664_105206621 287
165 3300025934 Ga0207686_10113658 Ga0207686_101136582 287
166 3300025941 Ga0207711_10000003 Ga0207711_10000003989 287
167 3300025941 Ga0207711_10000005 Ga0207711_10000005144 287
168 3300025941 Ga0207711_10000009 Ga0207711_10000009511 287
169 3300025941 Ga0207711_10209583 Ga0207711_102095832 287
170 3300025944 Ga0207661_10370503 Ga0207661_103705032 287
171 3300025949 Ga0207667_10000021 Ga0207667_10000021112 287
172 3300025949 Ga0207667_10038471 Ga0207667_100384715 287
173 3300025949 Ga0207667_10107245 Ga0207667_101072454 287
174 3300025949 Ga0207667_10419503 Ga0207667_104195031 287
175 3300025981 Ga0207640_10149055 Ga0207640_101490552 287
176 3300026035 Ga0207703_10018817 Ga0207703_100188172 287
177 3300026041 Ga0207639_10000313 Ga0207639_1000031326 287
178 3300026041 Ga0207639_10010554 Ga0207639_100105542 287
179 3300026041 Ga0207639_10050121 Ga0207639_100501212 287
180 3300026075 Ga0207708_10045504 Ga0207708_100455042 287
181 3300026078 Ga0207702_10000066 Ga0207702_1000006641 287
182 3300026078 Ga0207702_10004558 Ga0207702_100045581 287
183 3300026078 Ga0207702_10747149 Ga0207702_107471491 287
184 3300026116 Ga0207674_10000004 Ga0207674_1000000469 287
185 3300026142 Ga0207698_10009353 Ga0207698_100093533 287
186 3300026142 Ga0207698_10024079 Ga0207698_100240792 287
187 3300027907 Ga0207428_10008744 Ga0207428_100087443 287
188 3300028573 Ga0265334_10009656 Ga0265334_100096563 287
189 3300028577 Ga0265318_10000025 Ga0265318_1000002530 287
190 3300028800 Ga0265338_10000869 Ga0265338_1000086927 287
191 3300031238 Ga0265332_10089280 Ga0265332_100892801 287
192 3300031240 Ga0265320_10000097 Ga0265320_1000009751 287
193 3300031241 Ga0265325_10000112 Ga0265325_1000011230 287
194 3300031241 Ga0265325_10006453 Ga0265325_100064533 287
195 3300031241 Ga0265325_10018755 Ga0265325_100187553 287
196 3300031241 Ga0265325_10036706 Ga0265325_100367062 287
197 3300031247 Ga0265340_10026507 Ga0265340_100265071 287
198 3300031247 Ga0265340_10182240 Ga0265340_101822401 287
199 3300031249 Ga0265339_10001618 Ga0265339_1000161811 287
200 3300031249 Ga0265339_10075757 Ga0265339_100757572 287
201 3300031250 Ga0265331_10003224 Ga0265331_1000322411 287
202 3300031250 Ga0265331_10006497 Ga0265331_100064973 287
203 3300031251 Ga0265327_10001912 Ga0265327_1000191218 287
204 3300031595 Ga0265313_10005780 Ga0265313_100057803 287
205 3300031595 Ga0265313_10006697 Ga0265313_100066979 287
206 3300031595 Ga0265313_10071991 Ga0265313_100719912 287
207 3300031595 Ga0265313_10116950 Ga0265313_101169502 287
208 3300031711 Ga0265314_10000754 Ga0265314_1000075420 287
209 3300031711 Ga0265314_10009531 Ga0265314_100095316 287
210 3300031712 Ga0265342_10004007 Ga0265342_100040075 287
211 3300031712 Ga0265342_10014382 Ga0265342_100143824 287
212 3300031712 Ga0265342_10107244 Ga0265342_101072442 287
213 3300031727 Ga0316576_10144777 Ga0316576_101447771 287
214 3300031730 Ga0307516_10025385 Ga0307516_100253853 287
215 3300034819 Ga0373958_0013547 Ga0373958_0013547_234_1178 287
216 3300034957 Ga0373938_0047783 Ga0373938_0047783_30_917 287
217 3300035112 Ga0373932_0102992 Ga0373932_0102992_25_915 287
218 3300035118 Ga0373954_0128297 Ga0373954_0128297_30_920 287
219 3300035172 Ga0373955_0036780 Ga0373955_0036780_997_1887 287
220 3300035691 Ga0373931_0004215 Ga0373931_0004215_650_1594 287
221 3300035691 Ga0373931_0181408 Ga0373931_0181408_180_1067 287
222 3300036401 Ga0373937_0387990 Ga0373937_0387990_28_918 287
223 3300037853 Ga0436364_0133943 Ga0436364_0133943_4441_5328 287
224 3300039437 Ga0436365_1612150 Ga0436365_1612150_82081_82971 287
225 3300039450 Ga0436363_1011850 Ga0436363_1011850_3606_4493 287
226 3300046472 Ga0495580_0071363 Ga0495580_0071363_787_1683 287
227 3300046529 Ga0495652_0049122 Ga0495652_0049122_2525_3415 287
228 3300046543 Ga0495645_0038168 Ga0495645_0038168_1020_1910 287
229 3300048909 Ga0496106_0291970 Ga0496106_0291970_191_1081 287
230 3300048929 Ga0496126_0037779 Ga0496126_0037779_1250_2137 287
231 3300049460 Ga0495682_0001030 Ga0495682_0001030_12633_13523 287
232 3300049570 Ga0501033_0168004 Ga0501033_0168004_575_1462 287
233 3300049571 Ga0501034_0060660 Ga0501034_0060660_464_1351 287
234 3300049572 Ga0501036_0285047 Ga0501036_0285047_378_1265 287
235 3300049573 Ga0501037_0021169 Ga0501037_0021169_1061_1948 287
236 3300049573 Ga0501037_0156503 Ga0501037_0156503_659_1546 287
237 3300049573 Ga0501037_0204823 Ga0501037_0204823_391_1278 287
238 3300049573 Ga0501037_0260487 Ga0501037_0260487_239_1126 287
239 3300049574 Ga0501038_0073581 Ga0501038_0073581_627_1514 287
240 3300049579 Ga0501043_0019047 Ga0501043_0019047_2638_3525 287
241 3300049579 Ga0501043_0150117 Ga0501043_0150117_790_1677 287
242 3300049580 Ga0501046_0041468 Ga0501046_0041468_1738_2625 287
243 3300049581 Ga0501047_0053609 Ga0501047_0053609_2169_3056 287
244 3300049581 Ga0501047_0133945 Ga0501047_0133945_703_1593 287
245 3300049581 Ga0501047_0347606 Ga0501047_0347606_365_1255 287
246 3300049582 Ga0501048_0021942 Ga0501048_0021942_927_1814 287
247 3300049583 Ga0501067_0005948 Ga0501067_0005948_258_1145 287
248 3300049583 Ga0501067_0019558 Ga0501067_0019558_1017_1907 287
249 3300049585 Ga0501069_0068907 Ga0501069_0068907_701_1588 287
250 3300049585 Ga0501069_0070767 Ga0501069_0070767_25_912 287
251 3300049586 Ga0501070_0000002 Ga0501070_0000002_18378_19265 287
252 3300049586 Ga0501070_0006731 Ga0501070_0006731_3107_3994 287
253 3300049586 Ga0501070_0009688 Ga0501070_0009688_4916_5803 287
254 3300049586 Ga0501070_0079152 Ga0501070_0079152_579_1466 287
255 3300049588 Ga0501072_0006068 Ga0501072_0006068_5019_5909 287
256 3300049589 Ga0501073_0119715 Ga0501073_0119715_851_1738 287
257 3300049590 Ga0501074_0042727 Ga0501074_0042727_971_1858 287
258 3300049742 Ga0501080_0011529 Ga0501080_0011529_6078_6968 287
259 3300049742 Ga0501080_0077000 Ga0501080_0077000_481_1371 287
260 3300049742 Ga0501080_0185845 Ga0501080_0185845_539_1426 287
261 3300049744 Ga0501083_0082005 Ga0501083_0082005_291_1178 287
262 3300049822 Ga0501035_0000579 Ga0501035_0000579_36231_37118 287
263 3300049822 Ga0501035_0023581 Ga0501035_0023581_4725_5612 287
264 3300049822 Ga0501035_0192743 Ga0501035_0192743_522_1409 287
265 3300049823 Ga0501044_0010951 Ga0501044_0010951_1738_2625 287
266 3300049823 Ga0501044_0025175 Ga0501044_0025175_511_1398 287
267 3300049823 Ga0501044_0043694 Ga0501044_0043694_2474_3361 287
268 3300049823 Ga0501044_0108017 Ga0501044_0108017_1353_2240 287
269 3300050511 nmdc:mga08y16_78582_c1 nmdc:mga08y16_78582_c1_340_1284 287
270 3300050511 nmdc:mga08y16_87585_c1 nmdc:mga08y16_87585_c1_2201_3145 287
271 3300050512 nmdc:mga0n895_51986_c1 nmdc:mga0n895_51986_c1_585_1475 287
272 3300050512 nmdc:mga0n895_7873_c1 nmdc:mga0n895_7873_c1_7396_8283 287
273 3300050513 nmdc:mga0rr50_10235_c1 nmdc:mga0rr50_10235_c1_3650_4537 287
274 3300050513 nmdc:mga0rr50_13675_c1 nmdc:mga0rr50_13675_c1_2692_3582 287
275 3300050513 nmdc:mga0rr50_176323_c1 nmdc:mga0rr50_176323_c1_824_1714 287
276 3300050514 nmdc:mga08x19_52_c1 nmdc:mga08x19_52_c1_48949_49839 287
277 3300050515 nmdc:mga0a205_9191_c1 nmdc:mga0a205_9191_c1_4654_5541 287
278 3300053133 Ga0500655_015681 Ga0500655_015681_306_1196 287
279 3300053154 Ga0500619_000636 Ga0500619_000636_3415_4305 287
280 3300054114 Ga0501084_0012635 Ga0501084_0012635_3474_4364 287
281 3300054114 Ga0501084_0079938 Ga0501084_0079938_1085_1972 287
282 3300031238 Ga0265332_10014026 Ga0265332_100140263 288
283 3300031344 Ga0265316_10275902 Ga0265316_102759021 288
284 3300031727 Ga0316576_10067427 Ga0316576_100674271 288
285 3300002987 JGI25159J45721_1006922 JGI25159J45721_10069222 289
286 3300005262 Ga0065165_1000062 Ga0065165_1000062115 289
287 3300006942 Ga0099824_1015014 Ga0099824_10150145 289
288 3300006943 Ga0099822_1001480 Ga0099822_100148025 289
289 3300025284 Ga0209130_1000174 Ga0209130_100017435 289
290 3300025294 Ga0209025_1059371 Ga0209025_10593712 289
291 3300027357 Ga0209589_1000001 Ga0209589_1000001169 289
292 3300027361 Ga0209489_100001 Ga0209489_100001169 289
293 3300027363 Ga0209700_100001 Ga0209700_100001169 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

5

165

0.99

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

167

294

0.95

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

5

98

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cky-assembly2.cif.gz_D structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9444 42 283
3q3c-assembly1.cif.gz_A crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad 0.9437 4 282
3obb-assembly1.cif.gz_A crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 0.9351 1 285
2gf2-assembly1.cif.gz_A crystal structure of human hydroxyisobutyrate dehydrogenase 0.9316 4 284
3obb-assembly1.cif.gz_A crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 0.9192 1 285
ID Description Score Start End Superfamily
af_F1QE62_196_329_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.985 158 284 1.10.1040.10
af_Q653U8_207_338_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9805 155 284 1.10.1040.10
af_A0A1D8PQ07_211_343_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9649 161 283 1.10.1040.10
3ckyC02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9615 155 283 1.10.1040.10
af_Q653U8_207_338_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9587 155 284 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A5N7K0K0-F1-model_v4 NAD-binding protein 0.9896 125 284 GO:0006574
GO:0008442
GO:0051287
AF-A0A529HSX0-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9887 85 211 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A183U7X3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) 0.988 76 161 GO:0005739
GO:0006574
GO:0008442
GO:0050661
AF-A0A4Q2ZRT3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9869 112 283 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A7X6ISJ6-F1-model_v4 deleted 0.9866 52 165

Feature Viewer

pLDDT pTM Quality
93.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map