F391438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 293 | 177 | 289 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10049366|Ga0075366_100493662 |
| Length | 263 |
| Sequence | MFKSIGAQAWRIVALVLLSALALQLYFVLRIAAMRVIDPQSTTFQRSEAWRLIEQKHAIAWSQQWADYPRLSDHLKRAVIASEDAGFSEHSGVEWDALEKAWERNQHAEARVDKINAQIDRRLLKTQAAAASARPAAHKQAKIVGGSTITQQLAKNLFLSGERNLLRKGQEFAITLMLEACLPKQRILEIYLNNVEWGEGVFGAEAAARHYFRTSAAGLSTGQAAQLAVMLPAPKRFEKRPGSAYVVGRAGTIAARMGAVEVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 3 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 4 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 154 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 157 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 172 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 173 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 174 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 177 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.63 |
| Metatranscriptomes | 0 |
| Isolates | 1.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.8 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 92.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10046028 | 3300003322 | Bacteria | 4999 |
| 2 | Ga0070676_10002353 | 3300005328 | Bacteria | 9679 |
| 3 | Ga0070676_10010815 | 3300005328 | Bacteria | 4951 |
| 4 | Ga0070690_100005366 | 3300005330 | Bacteria | 7195 |
| 5 | Ga0070670_100197227 | 3300005331 | Bacteria | 1749 |
| 6 | Ga0070670_100636238 | 3300005331 | Bacteria | 956 |
| 7 | Ga0070670_100684891 | 3300005331 | Bacteria | 921 |
| 8 | Ga0068869_100000049 | 3300005334 | Bacteria | 50658 |
| 9 | Ga0068869_100016765 | 3300005334 | Bacteria | 4946 |
| 10 | Ga0070682_100130491 | 3300005337 | Bacteria | 1700 |
| 11 | Ga0068868_100009022 | 3300005338 | Bacteria | 7157 |
| 12 | Ga0068868_100032296 | 3300005338 | Bacteria | 4027 |
| 13 | Ga0070660_100110313 | 3300005339 | Bacteria | 2188 |
| 14 | Ga0070689_100000283 | 3300005340 | Bacteria | 29408 |
| 15 | Ga0070689_100747765 | 3300005340 | Bacteria | 857 |
| 16 | Ga0070691_10031649 | 3300005341 | Bacteria | 2482 |
| 17 | Ga0070687_100014305 | 3300005343 | Bacteria | 3563 |
| 18 | Ga0070692_10005239 | 3300005345 | Bacteria | 5501 |
| 19 | Ga0070692_10088228 | 3300005345 | Bacteria | 1682 |
| 20 | Ga0070675_100005231 | 3300005354 | Bacteria | 9903 |
| 21 | Ga0070674_100029248 | 3300005356 | Bacteria | 3627 |
| 22 | Ga0070674_100314001 | 3300005356 | Bacteria | 1254 |
| 23 | Ga0070673_100009689 | 3300005364 | Bacteria | 6480 |
| 24 | Ga0070659_100064591 | 3300005366 | Bacteria | 2897 |
| 25 | Ga0070667_100068931 | 3300005367 | Bacteria | 3010 |
| 26 | Ga0070701_10070500 | 3300005438 | Bacteria | 1867 |
| 27 | Ga0070705_100021089 | 3300005440 | Bacteria | 3461 |
| 28 | Ga0070700_100000483 | 3300005441 | Bacteria | 19960 |
| 29 | Ga0070700_100491375 | 3300005441 | Bacteria | 942 |
| 30 | Ga0070694_100036028 | 3300005444 | Bacteria | 3275 |
| 31 | Ga0070694_100208173 | 3300005444 | Bacteria | 1461 |
| 32 | Ga0070662_100057925 | 3300005457 | Bacteria | 2817 |
| 33 | Ga0070662_100134569 | 3300005457 | Bacteria | 1910 |
| 34 | Ga0070681_10118003 | 3300005458 | Bacteria | 2590 |
| 35 | Ga0068867_100004961 | 3300005459 | Bacteria | 9378 |
| 36 | Ga0068867_100005705 | 3300005459 | Bacteria | 8826 |
| 37 | Ga0068867_100060040 | 3300005459 | Bacteria | 2820 |
| 38 | Ga0068867_100273453 | 3300005459 | Bacteria | 1382 |
| 39 | Ga0070706_100001272 | 3300005467 | Bacteria | 26932 |
| 40 | Ga0070699_100134827 | 3300005518 | Bacteria | 2178 |
| 41 | Ga0070679_100175442 | 3300005530 | Bacteria | 2116 |
| 42 | Ga0070684_100683982 | 3300005535 | Bacteria | 956 |
| 43 | Ga0068853_100011886 | 3300005539 | Bacteria | 7080 |
| 44 | Ga0070672_100003578 | 3300005543 | Bacteria | 10065 |
| 45 | Ga0070672_100366809 | 3300005543 | Bacteria | 1230 |
| 46 | Ga0070686_100000581 | 3300005544 | Bacteria | 21695 |
| 47 | Ga0070696_100080873 | 3300005546 | Bacteria | 2301 |
| 48 | Ga0070693_100034826 | 3300005547 | Bacteria | 2788 |
| 49 | Ga0070693_100207117 | 3300005547 | Bacteria | 1277 |
| 50 | Ga0070665_100090819 | 3300005548 | Bacteria | 3060 |
| 51 | Ga0070704_100662300 | 3300005549 | Bacteria | 922 |
| 52 | Ga0068855_100028134 | 3300005563 | Bacteria | 6723 |
| 53 | Ga0070664_100115692 | 3300005564 | Bacteria | 2344 |
| 54 | Ga0070664_100230459 | 3300005564 | Bacteria | 1660 |
| 55 | Ga0068857_100059646 | 3300005577 | Bacteria | 3390 |
| 56 | Ga0068857_100095083 | 3300005577 | Bacteria | 2669 |
| 57 | Ga0068857_100114661 | 3300005577 | Bacteria | 2424 |
| 58 | Ga0068857_100168519 | 3300005577 | Bacteria | 1990 |
| 59 | Ga0068854_100188697 | 3300005578 | Bacteria | 1614 |
| 60 | Ga0068854_100303363 | 3300005578 | Bacteria | 1293 |
| 61 | Ga0068856_100886167 | 3300005614 | Bacteria | 911 |
| 62 | Ga0068856_100997486 | 3300005614 | Bacteria | 856 |
| 63 | Ga0070702_100002790 | 3300005615 | Bacteria | 7648 |
| 64 | Ga0068859_100009911 | 3300005617 | Bacteria | 9622 |
| 65 | Ga0068859_100206630 | 3300005617 | Bacteria | 2049 |
| 66 | Ga0068864_100032648 | 3300005618 | Bacteria | 4424 |
| 67 | Ga0068866_10007913 | 3300005718 | Bacteria | 4462 |
| 68 | Ga0068866_10130584 | 3300005718 | Bacteria | 1428 |
| 69 | Ga0068861_100004451 | 3300005719 | Bacteria | 9406 |
| 70 | Ga0068870_10032647 | 3300005840 | Bacteria | 2649 |
| 71 | Ga0068870_10180132 | 3300005840 | Bacteria | 1268 |
| 72 | Ga0068863_100010638 | 3300005841 | Bacteria | 8931 |
| 73 | Ga0068863_100055329 | 3300005841 | Bacteria | 3757 |
| 74 | Ga0068858_100003672 | 3300005842 | Bacteria | 15203 |
| 75 | Ga0068858_100043670 | 3300005842 | Bacteria | 4156 |
| 76 | Ga0068860_100051766 | 3300005843 | Bacteria | 3906 |
| 77 | Ga0068860_100057367 | 3300005843 | Bacteria | 3702 |
| 78 | Ga0068860_100559759 | 3300005843 | Bacteria | 1146 |
| 79 | Ga0068862_100010521 | 3300005844 | Bacteria | 7642 |
| 80 | Ga0070717_10118981 | 3300006028 | Bacteria | 2261 |
| 81 | Ga0075368_10014743 | 3300006042 | Bacteria | 2891 |
| 82 | Ga0075363_100034513 | 3300006048 | Bacteria | 2641 |
| 83 | Ga0075362_10003105 | 3300006177 | Bacteria | 5728 |
| 84 | Ga0075367_10081014 | 3300006178 | Bacteria | 1964 |
| 85 | Ga0075369_10015885 | 3300006186 | Bacteria | 3029 |
| 86 | Ga0075366_10034909 | 3300006195 | Bacteria | 2964 |
| 87 | Ga0075366_10049366 | 3300006195 | Bacteria | 2497 |
| 88 | Ga0075366_10086121 | 3300006195 | Bacteria | 1880 |
| 89 | Ga0097621_100021677 | 3300006237 | Bacteria | 4975 |
| 90 | Ga0075370_10141133 | 3300006353 | Bacteria | 1408 |
| 91 | Ga0068871_100021237 | 3300006358 | Bacteria | 4987 |
| 92 | Ga0068871_100048005 | 3300006358 | Bacteria | 3444 |
| 93 | Ga0075434_100280287 | 3300006871 | Bacteria | 1686 |
| 94 | Ga0068865_100000084 | 3300006881 | Bacteria | 50482 |
| 95 | Ga0068865_100232895 | 3300006881 | Bacteria | 1446 |
| 96 | Ga0068865_100301908 | 3300006881 | Bacteria | 1282 |
| 97 | Ga0097620_100009910 | 3300006931 | Bacteria | 9622 |
| 98 | Ga0097620_100206637 | 3300006931 | Bacteria | 2049 |
| 99 | Ga0105240_10343645 | 3300009093 | Bacteria | 1694 |
| 100 | Ga0105240_10605660 | 3300009093 | Bacteria | 1206 |
| 101 | Ga0105245_10000063 | 3300009098 | Bacteria | 113377 |
| 102 | Ga0105245_10060388 | 3300009098 | Bacteria | 3414 |
| 103 | Ga0105245_10068724 | 3300009098 | Bacteria | 3211 |
| 104 | Ga0105245_10101002 | 3300009098 | Bacteria | 2669 |
| 105 | Ga0105245_10129008 | 3300009098 | Bacteria | 2370 |
| 106 | Ga0105245_10236552 | 3300009098 | Bacteria | 1769 |
| 107 | Ga0105245_10714347 | 3300009098 | Bacteria | 1036 |
| 108 | Ga0105247_10034353 | 3300009101 | Bacteria | 3088 |
| 109 | Ga0105243_10001481 | 3300009148 | Bacteria | 20602 |
| 110 | Ga0105241_10020663 | 3300009174 | Bacteria | 4865 |
| 111 | Ga0105242_10066932 | 3300009176 | Bacteria | 2968 |
| 112 | Ga0105248_10041043 | 3300009177 | Bacteria | 5187 |
| 113 | Ga0105237_10002642 | 3300009545 | Bacteria | 22062 |
| 114 | Ga0105237_10783017 | 3300009545 | Bacteria | 960 |
| 115 | Ga0105238_10080059 | 3300009551 | Bacteria | 3256 |
| 116 | Ga0105249_10098827 | 3300009553 | Bacteria | 2742 |
| 117 | Ga0105239_10046289 | 3300010375 | Bacteria | 4767 |
| 118 | Ga0105239_10869485 | 3300010375 | Bacteria | 1034 |
| 119 | Ga0157374_10000417 | 3300013296 | Bacteria | 38535 |
| 120 | Ga0157374_10142440 | 3300013296 | Bacteria | 2327 |
| 121 | Ga0157378_10000193 | 3300013297 | Bacteria | 58970 |
| 122 | Ga0157378_10090597 | 3300013297 | Bacteria | 2779 |
| 123 | Ga0157378_10226422 | 3300013297 | Bacteria | 1780 |
| 124 | Ga0157378_10602470 | 3300013297 | Bacteria | 1110 |
| 125 | Ga0163162_10280914 | 3300013306 | Bacteria | 1797 |
| 126 | Ga0157372_10382110 | 3300013307 | Bacteria | 1641 |
| 127 | Ga0157375_10006468 | 3300013308 | Bacteria | 10209 |
| 128 | Ga0157375_10007965 | 3300013308 | Bacteria | 9275 |
| 129 | Ga0157375_10062912 | 3300013308 | Bacteria | 3689 |
| 130 | Ga0157375_10144706 | 3300013308 | Bacteria | 2507 |
| 131 | Ga0157375_11015798 | 3300013308 | Bacteria | 968 |
| 132 | Ga0157380_10700460 | 3300014326 | Bacteria | 1018 |
| 133 | Ga0157377_10141008 | 3300014745 | Bacteria | 1481 |
| 134 | Ga0157377_10250879 | 3300014745 | Bacteria | 1147 |
| 135 | Ga0157377_10473787 | 3300014745 | Bacteria | 869 |
| 136 | Ga0157379_10058827 | 3300014968 | Bacteria | 3437 |
| 137 | Ga0157376_10419627 | 3300014969 | Bacteria | 1298 |
| 138 | Ga0157376_10643070 | 3300014969 | Bacteria | 1060 |
| 139 | Ga0163161_10398894 | 3300017792 | Bacteria | 1103 |
| 140 | Ga0213872_10000508 | 3300021361 | Bacteria | 30750 |
| 141 | Ga0213872_10024874 | 3300021361 | Bacteria | 2753 |
| 142 | Ga0207642_10001761 | 3300025899 | Bacteria | 6689 |
| 143 | Ga0207680_10157877 | 3300025903 | Bacteria | 1518 |
| 144 | Ga0207645_10004178 | 3300025907 | Bacteria | 10720 |
| 145 | Ga0207645_10015413 | 3300025907 | Bacteria | 5078 |
| 146 | Ga0207643_10006373 | 3300025908 | Bacteria | 6320 |
| 147 | Ga0207684_10066712 | 3300025910 | Bacteria | 3056 |
| 148 | Ga0207707_10091120 | 3300025912 | Bacteria | 2664 |
| 149 | Ga0207671_10031203 | 3300025914 | Bacteria | 3971 |
| 150 | Ga0207671_10147043 | 3300025914 | Bacteria | 1818 |
| 151 | Ga0207662_10127882 | 3300025918 | Unclassified | 1599 |
| 152 | Ga0207657_10150413 | 3300025919 | Bacteria | 1897 |
| 153 | Ga0207694_10170338 | 3300025924 | Bacteria | 1763 |
| 154 | Ga0207650_10024224 | 3300025925 | Bacteria | 4312 |
| 155 | Ga0207650_10186146 | 3300025925 | Bacteria | 1657 |
| 156 | Ga0207659_10016587 | 3300025926 | Bacteria | 4796 |
| 157 | Ga0207687_10113447 | 3300025927 | Bacteria | 2016 |
| 158 | Ga0207690_10045589 | 3300025932 | Bacteria | 2897 |
| 159 | Ga0207706_10035099 | 3300025933 | Bacteria | 4461 |
| 160 | Ga0207706_10061857 | 3300025933 | Bacteria | 3297 |
| 161 | Ga0207686_10000467 | 3300025934 | Bacteria | 26772 |
| 162 | Ga0207686_10036117 | 3300025934 | Bacteria | 2972 |
| 163 | Ga0207709_10001392 | 3300025935 | Bacteria | 16932 |
| 164 | Ga0207670_10035535 | 3300025936 | Bacteria | 3232 |
| 165 | Ga0207669_10360775 | 3300025937 | Bacteria | 1126 |
| 166 | Ga0207704_10000579 | 3300025938 | Bacteria | 16294 |
| 167 | Ga0207704_10044587 | 3300025938 | Bacteria | 2628 |
| 168 | Ga0207704_10216396 | 3300025938 | Bacteria | 1414 |
| 169 | Ga0207691_10008114 | 3300025940 | Bacteria | 10080 |
| 170 | Ga0207691_10487037 | 3300025940 | Bacteria | 1048 |
| 171 | Ga0207711_10026034 | 3300025941 | Bacteria | 4906 |
| 172 | Ga0207711_10257497 | 3300025941 | Bacteria | 1603 |
| 173 | Ga0207689_10000152 | 3300025942 | Bacteria | 59757 |
| 174 | Ga0207689_10002309 | 3300025942 | Bacteria | 17861 |
| 175 | Ga0207689_10012076 | 3300025942 | Bacteria | 7398 |
| 176 | Ga0207689_10111051 | 3300025942 | Bacteria | 2253 |
| 177 | Ga0207667_10036360 | 3300025949 | Bacteria | 5279 |
| 178 | Ga0207651_10014341 | 3300025960 | Bacteria | 4571 |
| 179 | Ga0207712_10064255 | 3300025961 | Bacteria | 2616 |
| 180 | Ga0207640_10248318 | 3300025981 | Bacteria | 1379 |
| 181 | Ga0207658_10027903 | 3300025986 | Bacteria | 3971 |
| 182 | Ga0207658_10352960 | 3300025986 | Bacteria | 1281 |
| 183 | Ga0207677_10008876 | 3300026023 | Bacteria | 5635 |
| 184 | Ga0207677_10017087 | 3300026023 | Bacteria | 4316 |
| 185 | Ga0207677_10472405 | 3300026023 | Bacteria | 1079 |
| 186 | Ga0207639_10012271 | 3300026041 | Bacteria | 5967 |
| 187 | Ga0207708_10000166 | 3300026075 | Bacteria | 51921 |
| 188 | Ga0207702_10811797 | 3300026078 | Bacteria | 925 |
| 189 | Ga0207641_10110371 | 3300026088 | Bacteria | 2437 |
| 190 | Ga0207641_10512146 | 3300026088 | Bacteria | 1166 |
| 191 | Ga0207648_10000131 | 3300026089 | Bacteria | 73949 |
| 192 | Ga0207648_10003979 | 3300026089 | Bacteria | 15346 |
| 193 | Ga0207648_10014846 | 3300026089 | Bacteria | 7183 |
| 194 | Ga0207648_10406538 | 3300026089 | Bacteria | 1234 |
| 195 | Ga0207674_10015017 | 3300026116 | Bacteria | 8530 |
| 196 | Ga0207674_10051969 | 3300026116 | Bacteria | 4180 |
| 197 | Ga0207674_10098711 | 3300026116 | Bacteria | 2903 |
| 198 | Ga0207674_10131940 | 3300026116 | Bacteria | 2461 |
| 199 | Ga0207675_100000084 | 3300026118 | Bacteria | 74312 |
| 200 | Ga0207675_100045407 | 3300026118 | Bacteria | 4104 |
| 201 | Ga0207683_10011637 | 3300026121 | Bacteria | 7511 |
| 202 | Ga0207698_10571100 | 3300026142 | Bacteria | 1111 |
| 203 | Ga0209813_10089946 | 3300027866 | Bacteria | 1029 |
| 204 | Ga0268266_10083609 | 3300028379 | Bacteria | 2787 |
| 205 | Ga0268265_10161984 | 3300028380 | Bacteria | 1901 |
| 206 | Ga0268265_10704809 | 3300028380 | Bacteria | 976 |
| 207 | Ga0268264_10024774 | 3300028381 | Bacteria | 4901 |
| 208 | Ga0268264_10113093 | 3300028381 | Bacteria | 2381 |
| 209 | Ga0268264_10719189 | 3300028381 | Bacteria | 993 |
| 210 | Ga0265324_10000055 | 3300029957 | Bacteria | 95549 |
| 211 | Ga0265324_10000056 | 3300029957 | Bacteria | 95534 |
| 212 | Ga0265324_10003290 | 3300029957 | Bacteria | 7765 |
| 213 | Ga0265330_10001792 | 3300031235 | Bacteria | 12048 |
| 214 | Ga0265328_10000444 | 3300031239 | Bacteria | 19287 |
| 215 | Ga0265328_10004356 | 3300031239 | Bacteria | 6151 |
| 216 | Ga0265325_10000233 | 3300031241 | Bacteria | 39510 |
| 217 | Ga0265331_10000050 | 3300031250 | Bacteria | 181286 |
| 218 | Ga0265331_10002575 | 3300031250 | Bacteria | 12194 |
| 219 | Ga0265331_10008850 | 3300031250 | Bacteria | 5698 |
| 220 | Ga0265331_10010559 | 3300031250 | Bacteria | 5102 |
| 221 | Ga0265331_10032375 | 3300031250 | Bacteria | 2591 |
| 222 | Ga0265327_10000109 | 3300031251 | Bacteria | 181275 |
| 223 | Ga0265327_10000213 | 3300031251 | Bacteria | 121151 |
| 224 | Ga0265327_10000730 | 3300031251 | Bacteria | 51310 |
| 225 | Ga0265327_10013003 | 3300031251 | Bacteria | 5564 |
| 226 | Ga0265327_10055001 | 3300031251 | Bacteria | 2058 |
| 227 | Ga0265327_10056269 | 3300031251 | Bacteria | 2027 |
| 228 | Ga0265327_10097850 | 3300031251 | Bacteria | 1420 |
| 229 | Ga0265316_10167557 | 3300031344 | Bacteria | 1640 |
| 230 | Ga0265316_10278227 | 3300031344 | Bacteria | 1223 |
| 231 | Ga0307408_100065329 | 3300031548 | Bacteria | 2668 |
| 232 | Ga0316575_10000182 | 3300031665 | Bacteria | 16330 |
| 233 | Ga0265314_10016464 | 3300031711 | Bacteria | 5838 |
| 234 | Ga0265314_10034031 | 3300031711 | Bacteria | 3728 |
| 235 | Ga0265314_10076381 | 3300031711 | Bacteria | 2225 |
| 236 | Ga0307516_10074970 | 3300031730 | Bacteria | 3238 |
| 237 | Ga0307405_10040777 | 3300031731 | Bacteria | 2814 |
| 238 | Ga0307410_10105043 | 3300031852 | Bacteria | 2032 |
| 239 | Ga0307406_10008965 | 3300031901 | Bacteria | 5594 |
| 240 | Ga0307407_10103164 | 3300031903 | Bacteria | 1775 |
| 241 | Ga0307409_100023982 | 3300031995 | Bacteria | 4243 |
| 242 | Ga0307416_100087311 | 3300032002 | Bacteria | 2662 |
| 243 | Ga0307414_10079928 | 3300032004 | Bacteria | 2389 |
| 244 | Ga0307411_10235291 | 3300032005 | Unclassified | 1430 |
| 245 | Ga0307411_10315957 | 3300032005 | Bacteria | 1259 |
| 246 | Ga0316583_10012162 | 3300032133 | Bacteria | 3105 |
| 247 | Ga0373937_0290086 | 3300036401 | Bacteria | 1546 |
| 248 | Ga0373937_0618426 | 3300036401 | Bacteria | 1028 |
| 249 | Ga0436360_0848587 | 3300039438 | Bacteria | 2342 |
| 250 | Ga0436361_0270077 | 3300039447 | Bacteria | 30158 |
| 251 | Ga0436361_0592921 | 3300039447 | Bacteria | 32848 |
| 252 | Ga0436361_0856179 | 3300039447 | Bacteria | 4573 |
| 253 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 254 | Ga0451577_0449878 | 3300042876 | Bacteria | 1170 |
| 255 | Ga0451577_0602767 | 3300042876 | Bacteria | 997 |
| 256 | Ga0453683_0000033 | 3300044673 | Bacteria | 241479 |
| 257 | Ga0453683_0196421 | 3300044673 | Bacteria | 1281 |
| 258 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 259 | Ga0453684_0000085 | 3300044712 | Bacteria | 397817 |
| 260 | Ga0453684_0777858 | 3300044712 | Bacteria | 1034 |
| 261 | Ga0453684_0987294 | 3300044712 | Bacteria | 896 |
| 262 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 263 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 264 | Ga0451576_0001926 | 3300045051 | Bacteria | 33249 |
| 265 | Ga0451576_0011550 | 3300045051 | Bacteria | 10020 |
| 266 | Ga0451576_0016337 | 3300045051 | Bacteria | 8197 |
| 267 | Ga0451576_0646477 | 3300045051 | Bacteria | 1111 |
| 268 | Ga0451576_1052155 | 3300045051 | Bacteria | 852 |
| 269 | Ga0495627_000016 | 3300046453 | Bacteria | 318947 |
| 270 | Ga0495590_0004668 | 3300046457 | Bacteria | 5503 |
| 271 | Ga0495638_0029049 | 3300046460 | Bacteria | 3566 |
| 272 | Ga0495609_0000263 | 3300046538 | Bacteria | 49427 |
| 273 | Ga0495625_0084420 | 3300046660 | Bacteria | 2206 |
| 274 | Ga0495649_0023511 | 3300046694 | Bacteria | 3443 |
| 275 | Ga0495660_0000292 | 3300046810 | Bacteria | 46230 |
| 276 | Ga0495660_0044525 | 3300046810 | Bacteria | 2441 |
| 277 | Ga0496114_0234662 | 3300048917 | Bacteria | 1612 |
| 278 | Ga0496116_0049081 | 3300048919 | Bacteria | 2826 |
| 279 | Ga0496124_0075420 | 3300048927 | Bacteria | 2786 |
| 280 | Ga0501034_0002148 | 3300049571 | Bacteria | 24489 |
| 281 | Ga0501072_0006565 | 3300049588 | Bacteria | 8858 |
| 282 | nmdc:mga0k408_313021_c1 | 3300050493 | Bacteria | 937 |
| 283 | nmdc:mga0k408_94387_c1 | 3300050493 | Bacteria | 1759 |
| 284 | nmdc:mga06z11_11307_c1 | 3300050494 | Bacteria | 3845 |
| 285 | nmdc:mga04h51_7743_c1 | 3300050495 | Bacteria | 2847 |
| 286 | nmdc:mga07m45_59398_c1 | 3300050496 | Bacteria | 2164 |
| 287 | Ga0495619_0228948 | 3300053085 | Bacteria | 1288 |
| 288 | Ga0500593_011742 | 3300053117 | Bacteria | 3700 |
| 289 | Ga0500622_0000011 | 3300053156 | Bacteria | 386096 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005618 | Ga0068864_100032648 | Ga0068864_1000326485 | 209 |
| 2 | 3300005841 | Ga0068863_100010638 | Ga0068863_1000106389 | 209 |
| 3 | 3300009098 | Ga0105245_10236552 | Ga0105245_102365522 | 209 |
| 4 | 3300028381 | Ga0268264_10113093 | Ga0268264_101130933 | 209 |
| 5 | 3300048917 | Ga0496114_0234662 | Ga0496114_0234662_297_992 | 213 |
| 6 | 3300031250 | Ga0265331_10002575 | Ga0265331_100025753 | 215 |
| 7 | 3300031251 | Ga0265327_10000730 | Ga0265327_1000073043 | 215 |
| 8 | 3300046460 | Ga0495638_0029049 | Ga0495638_0029049_2077_2781 | 216 |
| 9 | 3300046694 | Ga0495649_0023511 | Ga0495649_0023511_1316_2020 | 216 |
| 10 | 3300009545 | Ga0105237_10783017 | Ga0105237_107830172 | 218 |
| 11 | 3300031711 | Ga0265314_10076381 | Ga0265314_100763813 | 218 |
| 12 | 3300013297 | Ga0157378_10602470 | Ga0157378_106024702 | 219 |
| 13 | 3300031239 | Ga0265328_10000444 | Ga0265328_100004445 | 219 |
| 14 | 3300031250 | Ga0265331_10000050 | Ga0265331_10000050221 | 219 |
| 15 | 3300031251 | Ga0265327_10000109 | Ga0265327_100001094 | 219 |
| 16 | 3300005345 | Ga0070692_10005239 | Ga0070692_100052393 | 221 |
| 17 | 3300005549 | Ga0070704_100662300 | Ga0070704_1006623001 | 221 |
| 18 | 3300013297 | Ga0157378_10226422 | Ga0157378_102264223 | 221 |
| 19 | 3300031251 | Ga0265327_10056269 | Ga0265327_100562692 | 221 |
| 20 | 3300006195 | Ga0075366_10034909 | Ga0075366_100349094 | 222 |
| 21 | iso_pu_bacteria | 2547132103 | 2547375339 | 222 |
| 22 | iso_pu_bacteria | 2843690924 | 2843694314 | 222 |
| 23 | iso_pu_bacteria | 2846033681 | 2846034230 | 223 |
| 24 | iso_pu_bacteria | 2846037992 | 2846041067 | 223 |
| 25 | 3300021361 | Ga0213872_10000508 | Ga0213872_1000050827 | 226 |
| 26 | 3300031665 | Ga0316575_10000182 | Ga0316575_100001822 | 226 |
| 27 | 3300039447 | Ga0436361_0270077 | Ga0436361_0270077_18940_19623 | 226 |
| 28 | 3300039447 | Ga0436361_0592921 | Ga0436361_0592921_26248_26934 | 226 |
| 29 | 3300039447 | Ga0436361_0856179 | Ga0436361_0856179_3371_4054 | 226 |
| 30 | 3300031239 | Ga0265328_10004356 | Ga0265328_100043566 | 227 |
| 31 | 3300031250 | Ga0265331_10010559 | Ga0265331_100105592 | 227 |
| 32 | 3300031251 | Ga0265327_10097850 | Ga0265327_100978502 | 227 |
| 33 | 3300031344 | Ga0265316_10167557 | Ga0265316_101675572 | 227 |
| 34 | 3300039438 | Ga0436360_0848587 | Ga0436360_0848587_392_1078 | 227 |
| 35 | 3300048927 | Ga0496124_0075420 | Ga0496124_0075420_1000_1791 | 228 |
| 36 | 3300013307 | Ga0157372_10382110 | Ga0157372_103821102 | 229 |
| 37 | 3300021361 | Ga0213872_10024874 | Ga0213872_100248744 | 229 |
| 38 | 3300031251 | Ga0265327_10000213 | Ga0265327_1000021388 | 229 |
| 39 | 3300042876 | Ga0451577_0000013 | Ga0451577_0000013_132273_132965 | 229 |
| 40 | 3300044673 | Ga0453683_0000033 | Ga0453683_0000033_11116_11808 | 229 |
| 41 | 3300044712 | Ga0453684_0000085 | Ga0453684_0000085_264853_265545 | 229 |
| 42 | 3300045051 | Ga0451576_0000018 | Ga0451576_0000018_417725_418417 | 229 |
| 43 | 3300053156 | Ga0500622_0000011 | Ga0500622_0000011_60737_61429 | 229 |
| 44 | 3300005330 | Ga0070690_100005366 | Ga0070690_1000053663 | 230 |
| 45 | 3300005331 | Ga0070670_100684891 | Ga0070670_1006848912 | 230 |
| 46 | 3300005334 | Ga0068869_100000049 | Ga0068869_10000004939 | 230 |
| 47 | 3300005338 | Ga0068868_100032296 | Ga0068868_1000322963 | 230 |
| 48 | 3300005340 | Ga0070689_100000283 | Ga0070689_1000002832 | 230 |
| 49 | 3300005341 | Ga0070691_10031649 | Ga0070691_100316492 | 230 |
| 50 | 3300005356 | Ga0070674_100314001 | Ga0070674_1003140012 | 230 |
| 51 | 3300005438 | Ga0070701_10070500 | Ga0070701_100705002 | 230 |
| 52 | 3300005440 | Ga0070705_100021089 | Ga0070705_1000210895 | 230 |
| 53 | 3300005441 | Ga0070700_100000483 | Ga0070700_1000004834 | 230 |
| 54 | 3300005444 | Ga0070694_100036028 | Ga0070694_1000360282 | 230 |
| 55 | 3300005459 | Ga0068867_100004961 | Ga0068867_1000049612 | 230 |
| 56 | 3300005459 | Ga0068867_100273453 | Ga0068867_1002734532 | 230 |
| 57 | 3300005543 | Ga0070672_100366809 | Ga0070672_1003668091 | 230 |
| 58 | 3300005544 | Ga0070686_100000581 | Ga0070686_10000058114 | 230 |
| 59 | 3300005546 | Ga0070696_100080873 | Ga0070696_1000808732 | 230 |
| 60 | 3300005547 | Ga0070693_100034826 | Ga0070693_1000348262 | 230 |
| 61 | 3300005615 | Ga0070702_100002790 | Ga0070702_1000027908 | 230 |
| 62 | 3300005617 | Ga0068859_100009911 | Ga0068859_1000099118 | 230 |
| 63 | 3300005617 | Ga0068859_100206630 | Ga0068859_1002066302 | 230 |
| 64 | 3300005718 | Ga0068866_10007913 | Ga0068866_100079133 | 230 |
| 65 | 3300005719 | Ga0068861_100004451 | Ga0068861_1000044513 | 230 |
| 66 | 3300005840 | Ga0068870_10032647 | Ga0068870_100326472 | 230 |
| 67 | 3300005842 | Ga0068858_100003672 | Ga0068858_1000036722 | 230 |
| 68 | 3300005842 | Ga0068858_100043670 | Ga0068858_1000436703 | 230 |
| 69 | 3300005843 | Ga0068860_100051766 | Ga0068860_1000517663 | 230 |
| 70 | 3300005843 | Ga0068860_100057367 | Ga0068860_1000573673 | 230 |
| 71 | 3300005844 | Ga0068862_100010521 | Ga0068862_1000105215 | 230 |
| 72 | 3300006237 | Ga0097621_100021677 | Ga0097621_1000216773 | 230 |
| 73 | 3300006358 | Ga0068871_100021237 | Ga0068871_1000212374 | 230 |
| 74 | 3300006358 | Ga0068871_100048005 | Ga0068871_1000480052 | 230 |
| 75 | 3300006871 | Ga0075434_100280287 | Ga0075434_1002802871 | 230 |
| 76 | 3300006881 | Ga0068865_100000084 | Ga0068865_10000008414 | 230 |
| 77 | 3300006881 | Ga0068865_100301908 | Ga0068865_1003019082 | 230 |
| 78 | 3300006931 | Ga0097620_100009910 | Ga0097620_1000099103 | 230 |
| 79 | 3300006931 | Ga0097620_100206637 | Ga0097620_1002066372 | 230 |
| 80 | 3300009098 | Ga0105245_10000063 | Ga0105245_1000006367 | 230 |
| 81 | 3300009098 | Ga0105245_10068724 | Ga0105245_100687244 | 230 |
| 82 | 3300009101 | Ga0105247_10034353 | Ga0105247_100343532 | 230 |
| 83 | 3300009148 | Ga0105243_10001481 | Ga0105243_100014814 | 230 |
| 84 | 3300009177 | Ga0105248_10041043 | Ga0105248_100410432 | 230 |
| 85 | 3300009553 | Ga0105249_10098827 | Ga0105249_100988272 | 230 |
| 86 | 3300013297 | Ga0157378_10000193 | Ga0157378_1000019315 | 230 |
| 87 | 3300013297 | Ga0157378_10090597 | Ga0157378_100905972 | 230 |
| 88 | 3300013306 | Ga0163162_10280914 | Ga0163162_102809142 | 230 |
| 89 | 3300013308 | Ga0157375_10007965 | Ga0157375_100079653 | 230 |
| 90 | 3300013308 | Ga0157375_10144706 | Ga0157375_101447064 | 230 |
| 91 | 3300014326 | Ga0157380_10700460 | Ga0157380_107004602 | 230 |
| 92 | 3300014745 | Ga0157377_10250879 | Ga0157377_102508792 | 230 |
| 93 | 3300014968 | Ga0157379_10058827 | Ga0157379_100588272 | 230 |
| 94 | 3300014969 | Ga0157376_10419627 | Ga0157376_104196272 | 230 |
| 95 | 3300025899 | Ga0207642_10001761 | Ga0207642_100017614 | 230 |
| 96 | 3300025903 | Ga0207680_10157877 | Ga0207680_101578772 | 230 |
| 97 | 3300025908 | Ga0207643_10006373 | Ga0207643_100063735 | 230 |
| 98 | 3300025934 | Ga0207686_10000467 | Ga0207686_1000046713 | 230 |
| 99 | 3300025935 | Ga0207709_10001392 | Ga0207709_100013924 | 230 |
| 100 | 3300025936 | Ga0207670_10035535 | Ga0207670_100355352 | 230 |
| 101 | 3300025937 | Ga0207669_10360775 | Ga0207669_103607752 | 230 |
| 102 | 3300025938 | Ga0207704_10000579 | Ga0207704_100005797 | 230 |
| 103 | 3300025940 | Ga0207691_10487037 | Ga0207691_104870372 | 230 |
| 104 | 3300025941 | Ga0207711_10026034 | Ga0207711_100260346 | 230 |
| 105 | 3300025941 | Ga0207711_10257497 | Ga0207711_102574972 | 230 |
| 106 | 3300025942 | Ga0207689_10000152 | Ga0207689_1000015221 | 230 |
| 107 | 3300025942 | Ga0207689_10002309 | Ga0207689_1000230917 | 230 |
| 108 | 3300025961 | Ga0207712_10064255 | Ga0207712_100642552 | 230 |
| 109 | 3300025986 | Ga0207658_10352960 | Ga0207658_103529602 | 230 |
| 110 | 3300026023 | Ga0207677_10017087 | Ga0207677_100170873 | 230 |
| 111 | 3300026075 | Ga0207708_10000166 | Ga0207708_1000016613 | 230 |
| 112 | 3300026088 | Ga0207641_10512146 | Ga0207641_105121462 | 230 |
| 113 | 3300026089 | Ga0207648_10000131 | Ga0207648_1000013137 | 230 |
| 114 | 3300026118 | Ga0207675_100000084 | Ga0207675_10000008454 | 230 |
| 115 | 3300026118 | Ga0207675_100045407 | Ga0207675_1000454072 | 230 |
| 116 | 3300026121 | Ga0207683_10011637 | Ga0207683_100116377 | 230 |
| 117 | 3300028380 | Ga0268265_10161984 | Ga0268265_101619842 | 230 |
| 118 | 3300028381 | Ga0268264_10024774 | Ga0268264_100247744 | 230 |
| 119 | 3300029957 | Ga0265324_10000055 | Ga0265324_1000005579 | 230 |
| 120 | 3300029957 | Ga0265324_10000056 | Ga0265324_100000568 | 230 |
| 121 | 3300029957 | Ga0265324_10003290 | Ga0265324_100032905 | 230 |
| 122 | 3300031241 | Ga0265325_10000233 | Ga0265325_1000023310 | 230 |
| 123 | 3300031250 | Ga0265331_10008850 | Ga0265331_100088505 | 230 |
| 124 | 3300031250 | Ga0265331_10032375 | Ga0265331_100323752 | 230 |
| 125 | 3300031344 | Ga0265316_10278227 | Ga0265316_102782271 | 230 |
| 126 | 3300031711 | Ga0265314_10016464 | Ga0265314_100164642 | 230 |
| 127 | 3300031711 | Ga0265314_10034031 | Ga0265314_100340313 | 230 |
| 128 | 3300036401 | Ga0373937_0618426 | Ga0373937_0618426_43_738 | 230 |
| 129 | 3300042876 | Ga0451577_0449878 | Ga0451577_0449878_284_979 | 230 |
| 130 | 3300042876 | Ga0451577_0602767 | Ga0451577_0602767_219_914 | 230 |
| 131 | 3300044712 | Ga0453684_0000029 | Ga0453684_0000029_691_1386 | 230 |
| 132 | 3300045051 | Ga0451576_0000013 | Ga0451576_0000013_656417_657112 | 230 |
| 133 | 3300045051 | Ga0451576_0646477 | Ga0451576_0646477_289_984 | 230 |
| 134 | 3300049571 | Ga0501034_0002148 | Ga0501034_0002148_13096_13791 | 230 |
| 135 | 3300049588 | Ga0501072_0006565 | Ga0501072_0006565_4260_4955 | 230 |
| 136 | 3300053085 | Ga0495619_0228948 | Ga0495619_0228948_228_923 | 230 |
| 137 | 3300005331 | Ga0070670_100636238 | Ga0070670_1006362381 | 231 |
| 138 | 3300005337 | Ga0070682_100130491 | Ga0070682_1001304912 | 231 |
| 139 | 3300005339 | Ga0070660_100110313 | Ga0070660_1001103133 | 231 |
| 140 | 3300005340 | Ga0070689_100747765 | Ga0070689_1007477651 | 231 |
| 141 | 3300005343 | Ga0070687_100014305 | Ga0070687_1000143055 | 231 |
| 142 | 3300005345 | Ga0070692_10088228 | Ga0070692_100882281 | 231 |
| 143 | 3300005356 | Ga0070674_100029248 | Ga0070674_1000292482 | 231 |
| 144 | 3300005366 | Ga0070659_100064591 | Ga0070659_1000645912 | 231 |
| 145 | 3300005441 | Ga0070700_100491375 | Ga0070700_1004913751 | 231 |
| 146 | 3300005444 | Ga0070694_100208173 | Ga0070694_1002081732 | 231 |
| 147 | 3300005457 | Ga0070662_100134569 | Ga0070662_1001345693 | 231 |
| 148 | 3300005458 | Ga0070681_10118003 | Ga0070681_101180033 | 231 |
| 149 | 3300005530 | Ga0070679_100175442 | Ga0070679_1001754422 | 231 |
| 150 | 3300005535 | Ga0070684_100683982 | Ga0070684_1006839821 | 231 |
| 151 | 3300005539 | Ga0068853_100011886 | Ga0068853_1000118868 | 231 |
| 152 | 3300005547 | Ga0070693_100207117 | Ga0070693_1002071172 | 231 |
| 153 | 3300005548 | Ga0070665_100090819 | Ga0070665_1000908192 | 231 |
| 154 | 3300005563 | Ga0068855_100028134 | Ga0068855_1000281345 | 231 |
| 155 | 3300005564 | Ga0070664_100115692 | Ga0070664_1001156923 | 231 |
| 156 | 3300005577 | Ga0068857_100095083 | Ga0068857_1000950832 | 231 |
| 157 | 3300005577 | Ga0068857_100114661 | Ga0068857_1001146612 | 231 |
| 158 | 3300005614 | Ga0068856_100886167 | Ga0068856_1008861672 | 231 |
| 159 | 3300005718 | Ga0068866_10130584 | Ga0068866_101305842 | 231 |
| 160 | 3300005840 | Ga0068870_10180132 | Ga0068870_101801322 | 231 |
| 161 | 3300005841 | Ga0068863_100055329 | Ga0068863_1000553293 | 231 |
| 162 | 3300005843 | Ga0068860_100559759 | Ga0068860_1005597592 | 231 |
| 163 | 3300006028 | Ga0070717_10118981 | Ga0070717_101189813 | 231 |
| 164 | 3300009093 | Ga0105240_10343645 | Ga0105240_103436452 | 231 |
| 165 | 3300009093 | Ga0105240_10605660 | Ga0105240_106056601 | 231 |
| 166 | 3300009098 | Ga0105245_10101002 | Ga0105245_101010023 | 231 |
| 167 | 3300009098 | Ga0105245_10129008 | Ga0105245_101290082 | 231 |
| 168 | 3300009098 | Ga0105245_10714347 | Ga0105245_107143472 | 231 |
| 169 | 3300009174 | Ga0105241_10020663 | Ga0105241_100206632 | 231 |
| 170 | 3300009176 | Ga0105242_10066932 | Ga0105242_100669324 | 231 |
| 171 | 3300009545 | Ga0105237_10002642 | Ga0105237_100026424 | 231 |
| 172 | 3300009551 | Ga0105238_10080059 | Ga0105238_100800591 | 231 |
| 173 | 3300010375 | Ga0105239_10046289 | Ga0105239_100462894 | 231 |
| 174 | 3300013296 | Ga0157374_10000417 | Ga0157374_1000041734 | 231 |
| 175 | 3300013296 | Ga0157374_10142440 | Ga0157374_101424402 | 231 |
| 176 | 3300013308 | Ga0157375_10062912 | Ga0157375_100629123 | 231 |
| 177 | 3300013308 | Ga0157375_11015798 | Ga0157375_110157981 | 231 |
| 178 | 3300014745 | Ga0157377_10473787 | Ga0157377_104737872 | 231 |
| 179 | 3300014969 | Ga0157376_10643070 | Ga0157376_106430702 | 231 |
| 180 | 3300017792 | Ga0163161_10398894 | Ga0163161_103988942 | 231 |
| 181 | 3300025912 | Ga0207707_10091120 | Ga0207707_100911203 | 231 |
| 182 | 3300025914 | Ga0207671_10147043 | Ga0207671_101470432 | 231 |
| 183 | 3300025918 | Ga0207662_10127882 | Ga0207662_101278822 | 231 |
| 184 | 3300025919 | Ga0207657_10150413 | Ga0207657_101504132 | 231 |
| 185 | 3300025924 | Ga0207694_10170338 | Ga0207694_101703382 | 231 |
| 186 | 3300025925 | Ga0207650_10024224 | Ga0207650_100242241 | 231 |
| 187 | 3300025927 | Ga0207687_10113447 | Ga0207687_101134472 | 231 |
| 188 | 3300025932 | Ga0207690_10045589 | Ga0207690_100455893 | 231 |
| 189 | 3300025934 | Ga0207686_10036117 | Ga0207686_100361172 | 231 |
| 190 | 3300025942 | Ga0207689_10111051 | Ga0207689_101110511 | 231 |
| 191 | 3300025949 | Ga0207667_10036360 | Ga0207667_100363603 | 231 |
| 192 | 3300026023 | Ga0207677_10472405 | Ga0207677_104724052 | 231 |
| 193 | 3300026041 | Ga0207639_10012271 | Ga0207639_100122716 | 231 |
| 194 | 3300026088 | Ga0207641_10110371 | Ga0207641_101103712 | 231 |
| 195 | 3300026089 | Ga0207648_10406538 | Ga0207648_104065382 | 231 |
| 196 | 3300026116 | Ga0207674_10051969 | Ga0207674_100519693 | 231 |
| 197 | 3300026116 | Ga0207674_10098711 | Ga0207674_100987113 | 231 |
| 198 | 3300028379 | Ga0268266_10083609 | Ga0268266_100836093 | 231 |
| 199 | 3300028380 | Ga0268265_10704809 | Ga0268265_107048091 | 231 |
| 200 | 3300028381 | Ga0268264_10719189 | Ga0268264_107191892 | 231 |
| 201 | 3300031235 | Ga0265330_10001792 | Ga0265330_1000179210 | 231 |
| 202 | 3300031251 | Ga0265327_10013003 | Ga0265327_100130037 | 231 |
| 203 | 3300031251 | Ga0265327_10055001 | Ga0265327_100550012 | 231 |
| 204 | 3300031548 | Ga0307408_100065329 | Ga0307408_1000653292 | 231 |
| 205 | 3300031730 | Ga0307516_10074970 | Ga0307516_100749702 | 231 |
| 206 | 3300032005 | Ga0307411_10235291 | Ga0307411_102352912 | 231 |
| 207 | 3300032133 | Ga0316583_10012162 | Ga0316583_100121622 | 231 |
| 208 | 3300036401 | Ga0373937_0290086 | Ga0373937_0290086_99_797 | 231 |
| 209 | 3300044673 | Ga0453683_0196421 | Ga0453683_0196421_292_990 | 231 |
| 210 | 3300044712 | Ga0453684_0777858 | Ga0453684_0777858_245_994 | 231 |
| 211 | 3300044712 | Ga0453684_0987294 | Ga0453684_0987294_76_774 | 231 |
| 212 | 3300045051 | Ga0451576_0001926 | Ga0451576_0001926_8998_9696 | 231 |
| 213 | 3300045051 | Ga0451576_0011550 | Ga0451576_0011550_743_1441 | 231 |
| 214 | 3300045051 | Ga0451576_0016337 | Ga0451576_0016337_2462_3160 | 231 |
| 215 | 3300046453 | Ga0495627_000016 | Ga0495627_000016_299532_300266 | 231 |
| 216 | 3300046538 | Ga0495609_0000263 | Ga0495609_0000263_3876_4610 | 231 |
| 217 | 3300046660 | Ga0495625_0084420 | Ga0495625_0084420_1300_2004 | 231 |
| 218 | 3300046810 | Ga0495660_0000292 | Ga0495660_0000292_9347_10081 | 231 |
| 219 | 3300048919 | Ga0496116_0049081 | Ga0496116_0049081_533_1267 | 231 |
| 220 | 3300050493 | nmdc:mga0k408_94387_c1 | nmdc:mga0k408_94387_c1_174_911 | 231 |
| 221 | 3300005614 | Ga0068856_100997486 | Ga0068856_1009974861 | 233 |
| 222 | 3300026078 | Ga0207702_10811797 | Ga0207702_108117971 | 233 |
| 223 | 3300005328 | Ga0070676_10002353 | Ga0070676_1000235310 | 238 |
| 224 | 3300005331 | Ga0070670_100197227 | Ga0070670_1001972272 | 238 |
| 225 | 3300005334 | Ga0068869_100016765 | Ga0068869_1000167654 | 238 |
| 226 | 3300005338 | Ga0068868_100009022 | Ga0068868_1000090225 | 238 |
| 227 | 3300005354 | Ga0070675_100005231 | Ga0070675_1000052317 | 238 |
| 228 | 3300005364 | Ga0070673_100009689 | Ga0070673_1000096896 | 238 |
| 229 | 3300005367 | Ga0070667_100068931 | Ga0070667_1000689313 | 238 |
| 230 | 3300005457 | Ga0070662_100057925 | Ga0070662_1000579254 | 238 |
| 231 | 3300005459 | Ga0068867_100005705 | Ga0068867_1000057053 | 238 |
| 232 | 3300005543 | Ga0070672_100003578 | Ga0070672_1000035788 | 238 |
| 233 | 3300005564 | Ga0070664_100230459 | Ga0070664_1002304592 | 238 |
| 234 | 3300005577 | Ga0068857_100059646 | Ga0068857_1000596462 | 238 |
| 235 | 3300006195 | Ga0075366_10086121 | Ga0075366_100861212 | 238 |
| 236 | 3300009098 | Ga0105245_10060388 | Ga0105245_100603881 | 238 |
| 237 | 3300010375 | Ga0105239_10869485 | Ga0105239_108694851 | 238 |
| 238 | 3300013308 | Ga0157375_10006468 | Ga0157375_100064688 | 238 |
| 239 | 3300014745 | Ga0157377_10141008 | Ga0157377_101410082 | 238 |
| 240 | 3300025907 | Ga0207645_10004178 | Ga0207645_100041786 | 238 |
| 241 | 3300025925 | Ga0207650_10186146 | Ga0207650_101861463 | 238 |
| 242 | 3300025926 | Ga0207659_10016587 | Ga0207659_100165875 | 238 |
| 243 | 3300025933 | Ga0207706_10061857 | Ga0207706_100618575 | 238 |
| 244 | 3300025938 | Ga0207704_10044587 | Ga0207704_100445873 | 238 |
| 245 | 3300025940 | Ga0207691_10008114 | Ga0207691_100081148 | 238 |
| 246 | 3300025942 | Ga0207689_10012076 | Ga0207689_100120767 | 238 |
| 247 | 3300025960 | Ga0207651_10014341 | Ga0207651_100143412 | 238 |
| 248 | 3300025986 | Ga0207658_10027903 | Ga0207658_100279033 | 238 |
| 249 | 3300026023 | Ga0207677_10008876 | Ga0207677_100088763 | 238 |
| 250 | 3300026089 | Ga0207648_10003979 | Ga0207648_100039798 | 238 |
| 251 | 3300026116 | Ga0207674_10015017 | Ga0207674_100150174 | 238 |
| 252 | 3300050493 | nmdc:mga0k408_313021_c1 | nmdc:mga0k408_313021_c1_51_845 | 238 |
| 253 | 3300053117 | Ga0500593_011742 | Ga0500593_011742_451_1233 | 242 |
| 254 | 3300005577 | Ga0068857_100168519 | Ga0068857_1001685192 | 243 |
| 255 | 3300005578 | Ga0068854_100188697 | Ga0068854_1001886972 | 243 |
| 256 | 3300006048 | Ga0075363_100034513 | Ga0075363_1000345132 | 243 |
| 257 | 3300006177 | Ga0075362_10003105 | Ga0075362_100031053 | 243 |
| 258 | 3300006186 | Ga0075369_10015885 | Ga0075369_100158854 | 243 |
| 259 | 3300006881 | Ga0068865_100232895 | Ga0068865_1002328952 | 243 |
| 260 | 3300025914 | Ga0207671_10031203 | Ga0207671_100312034 | 243 |
| 261 | 3300025933 | Ga0207706_10035099 | Ga0207706_100350993 | 243 |
| 262 | 3300025938 | Ga0207704_10216396 | Ga0207704_102163962 | 243 |
| 263 | 3300025981 | Ga0207640_10248318 | Ga0207640_102483182 | 243 |
| 264 | 3300026116 | Ga0207674_10131940 | Ga0207674_101319403 | 243 |
| 265 | 3300026142 | Ga0207698_10571100 | Ga0207698_105711002 | 243 |
| 266 | 3300005467 | Ga0070706_100001272 | Ga0070706_10000127211 | 244 |
| 267 | 3300005518 | Ga0070699_100134827 | Ga0070699_1001348273 | 244 |
| 268 | 3300006042 | Ga0075368_10014743 | Ga0075368_100147432 | 244 |
| 269 | 3300006178 | Ga0075367_10081014 | Ga0075367_100810141 | 244 |
| 270 | 3300006353 | Ga0075370_10141133 | Ga0075370_101411332 | 244 |
| 271 | 3300025910 | Ga0207684_10066712 | Ga0207684_100667124 | 244 |
| 272 | 3300027866 | Ga0209813_10089946 | Ga0209813_100899462 | 244 |
| 273 | 3300050494 | nmdc:mga06z11_11307_c1 | nmdc:mga06z11_11307_c1_1230_2021 | 244 |
| 274 | 3300050495 | nmdc:mga04h51_7743_c1 | nmdc:mga04h51_7743_c1_1885_2676 | 244 |
| 275 | 3300050496 | nmdc:mga07m45_59398_c1 | nmdc:mga07m45_59398_c1_1015_1806 | 244 |
| 276 | 3300031731 | Ga0307405_10040777 | Ga0307405_100407772 | 245 |
| 277 | 3300031852 | Ga0307410_10105043 | Ga0307410_101050432 | 245 |
| 278 | 3300031901 | Ga0307406_10008965 | Ga0307406_100089652 | 245 |
| 279 | 3300031903 | Ga0307407_10103164 | Ga0307407_101031642 | 245 |
| 280 | 3300031995 | Ga0307409_100023982 | Ga0307409_1000239824 | 245 |
| 281 | 3300032002 | Ga0307416_100087311 | Ga0307416_1000873112 | 245 |
| 282 | 3300032004 | Ga0307414_10079928 | Ga0307414_100799282 | 245 |
| 283 | 3300032005 | Ga0307411_10315957 | Ga0307411_103159571 | 245 |
| 284 | 3300046457 | Ga0495590_0004668 | Ga0495590_0004668_2612_3403 | 247 |
| 285 | 3300046810 | Ga0495660_0044525 | Ga0495660_0044525_1168_1959 | 247 |
| 286 | 3300045051 | Ga0451576_1052155 | Ga0451576_1052155_40_819 | 248 |
| 287 | 3300005459 | Ga0068867_100060040 | Ga0068867_1000600402 | 250 |
| 288 | 3300026089 | Ga0207648_10014846 | Ga0207648_100148463 | 250 |
| 289 | 3300005328 | Ga0070676_10010815 | Ga0070676_100108155 | 251 |
| 290 | 3300005578 | Ga0068854_100303363 | Ga0068854_1003033632 | 251 |
| 291 | 3300025907 | Ga0207645_10015413 | Ga0207645_100154134 | 251 |
| 292 | 3300006195 | Ga0075366_10049366 | Ga0075366_100493662 | 252 |
| 293 | 3300003322 | rootL2_10046028 | rootL2_100460286 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zg7-assembly1.cif.gz_B | crystal structure of penicillin-binding protein 4 from listeria monocytogenes in the apo form | 0.8975 | 175 | 245 |
| 2olv-assembly1.cif.gz_A | structural insight into the transglycosylation step of bacterial cell wall biosynthesis : donor ligand complex | 0.8879 | 58 | 250 |
| 2olv-assembly2.cif.gz_B | structural insight into the transglycosylation step of bacterial cell wall biosynthesis : donor ligand complex | 0.8874 | 58 | 250 |
| 2oqo-assembly1.cif.gz_A-2 | crystal structure of a peptidoglycan glycosyltransferase from a class a pbp: insight into bacterial cell wall synthesis | 0.8823 | 58 | 249 |
| 3d3h-assembly1.cif.gz_A-2 | crystal structure of a complex of the peptidoglycan glycosyltransferase domain from aquifex aeolicus and neryl moenomycin a | 0.8754 | 64 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P46022_52_241_1.10.3810.10 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.8913 | 49 | 249 | 1.10.3810.10 |
| 2olvA02 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.8784 | 62 | 255 | 1.10.3810.10 |
| 3d3hA00 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.8754 | 64 | 249 | 1.10.3810.10 |
| 3fwmA02 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.865 | 60 | 248 | 1.10.3810.10 |
| af_P71707_174_375_1.10.3810.10 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.8641 | 62 | 249 | 1.10.3810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0U1PZ17-F1-model_v4 | Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28) (Glycan polymerase) (Peptidoglycan glycosyltransferase MtgA) (PGT) | 0.9382 | 11 | 255 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0009274 GO:0016763 GO:0071555 |
| AF-A0A0F9UIU3-F1-model_v4 | Glycosyl transferase family 51 domain-containing protein | 0.9348 | 11 | 249 |
GO:0005886
GO:0008360 GO:0009252 GO:0009274 GO:0016763 GO:0071555 |
| AF-A0A125WFD2-F1-model_v4 | deleted | 0.9333 | 14 | 255 |
|
| AF-A0A3D0EVM0-F1-model_v4 | Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28) (Glycan polymerase) (Peptidoglycan glycosyltransferase MtgA) (PGT) | 0.933 | 11 | 255 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0009274 GO:0016763 GO:0071555 |
| AF-K1Z276-F1-model_v4 | Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28) (Glycan polymerase) (Peptidoglycan glycosyltransferase MtgA) (PGT) | 0.9317 | 22 | 255 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0009274 GO:0016763 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar