F391438

General Info

Members Datasets Scaffolds Average Seq Length
293 177 289 234

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10049366|Ga0075366_100493662
Length 263
Sequence MFKSIGAQAWRIVALVLLSALALQLYFVLRIAAMRVIDPQSTTFQRSEAWRLIEQKHAIAWSQQWADYPRLSDHLKRAVIASEDAGFSEHSGVEWDALEKAWERNQHAEARVDKINAQIDRRLLKTQAAAASARPAAHKQAKIVGGSTITQQLAKNLFLSGERNLLRKGQEFAITLMLEACLPKQRILEIYLNNVEWGEGVFGAEAAARHYFRTSAAGLSTGQAAQLAVMLPAPKRFEKRPGSAYVVGRAGTIAARMGAVEVP

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
3 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
4 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0
Rhizoplane 0.34
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10046028 3300003322 Bacteria 4999
2 Ga0070676_10002353 3300005328 Bacteria 9679
3 Ga0070676_10010815 3300005328 Bacteria 4951
4 Ga0070690_100005366 3300005330 Bacteria 7195
5 Ga0070670_100197227 3300005331 Bacteria 1749
6 Ga0070670_100636238 3300005331 Bacteria 956
7 Ga0070670_100684891 3300005331 Bacteria 921
8 Ga0068869_100000049 3300005334 Bacteria 50658
9 Ga0068869_100016765 3300005334 Bacteria 4946
10 Ga0070682_100130491 3300005337 Bacteria 1700
11 Ga0068868_100009022 3300005338 Bacteria 7157
12 Ga0068868_100032296 3300005338 Bacteria 4027
13 Ga0070660_100110313 3300005339 Bacteria 2188
14 Ga0070689_100000283 3300005340 Bacteria 29408
15 Ga0070689_100747765 3300005340 Bacteria 857
16 Ga0070691_10031649 3300005341 Bacteria 2482
17 Ga0070687_100014305 3300005343 Bacteria 3563
18 Ga0070692_10005239 3300005345 Bacteria 5501
19 Ga0070692_10088228 3300005345 Bacteria 1682
20 Ga0070675_100005231 3300005354 Bacteria 9903
21 Ga0070674_100029248 3300005356 Bacteria 3627
22 Ga0070674_100314001 3300005356 Bacteria 1254
23 Ga0070673_100009689 3300005364 Bacteria 6480
24 Ga0070659_100064591 3300005366 Bacteria 2897
25 Ga0070667_100068931 3300005367 Bacteria 3010
26 Ga0070701_10070500 3300005438 Bacteria 1867
27 Ga0070705_100021089 3300005440 Bacteria 3461
28 Ga0070700_100000483 3300005441 Bacteria 19960
29 Ga0070700_100491375 3300005441 Bacteria 942
30 Ga0070694_100036028 3300005444 Bacteria 3275
31 Ga0070694_100208173 3300005444 Bacteria 1461
32 Ga0070662_100057925 3300005457 Bacteria 2817
33 Ga0070662_100134569 3300005457 Bacteria 1910
34 Ga0070681_10118003 3300005458 Bacteria 2590
35 Ga0068867_100004961 3300005459 Bacteria 9378
36 Ga0068867_100005705 3300005459 Bacteria 8826
37 Ga0068867_100060040 3300005459 Bacteria 2820
38 Ga0068867_100273453 3300005459 Bacteria 1382
39 Ga0070706_100001272 3300005467 Bacteria 26932
40 Ga0070699_100134827 3300005518 Bacteria 2178
41 Ga0070679_100175442 3300005530 Bacteria 2116
42 Ga0070684_100683982 3300005535 Bacteria 956
43 Ga0068853_100011886 3300005539 Bacteria 7080
44 Ga0070672_100003578 3300005543 Bacteria 10065
45 Ga0070672_100366809 3300005543 Bacteria 1230
46 Ga0070686_100000581 3300005544 Bacteria 21695
47 Ga0070696_100080873 3300005546 Bacteria 2301
48 Ga0070693_100034826 3300005547 Bacteria 2788
49 Ga0070693_100207117 3300005547 Bacteria 1277
50 Ga0070665_100090819 3300005548 Bacteria 3060
51 Ga0070704_100662300 3300005549 Bacteria 922
52 Ga0068855_100028134 3300005563 Bacteria 6723
53 Ga0070664_100115692 3300005564 Bacteria 2344
54 Ga0070664_100230459 3300005564 Bacteria 1660
55 Ga0068857_100059646 3300005577 Bacteria 3390
56 Ga0068857_100095083 3300005577 Bacteria 2669
57 Ga0068857_100114661 3300005577 Bacteria 2424
58 Ga0068857_100168519 3300005577 Bacteria 1990
59 Ga0068854_100188697 3300005578 Bacteria 1614
60 Ga0068854_100303363 3300005578 Bacteria 1293
61 Ga0068856_100886167 3300005614 Bacteria 911
62 Ga0068856_100997486 3300005614 Bacteria 856
63 Ga0070702_100002790 3300005615 Bacteria 7648
64 Ga0068859_100009911 3300005617 Bacteria 9622
65 Ga0068859_100206630 3300005617 Bacteria 2049
66 Ga0068864_100032648 3300005618 Bacteria 4424
67 Ga0068866_10007913 3300005718 Bacteria 4462
68 Ga0068866_10130584 3300005718 Bacteria 1428
69 Ga0068861_100004451 3300005719 Bacteria 9406
70 Ga0068870_10032647 3300005840 Bacteria 2649
71 Ga0068870_10180132 3300005840 Bacteria 1268
72 Ga0068863_100010638 3300005841 Bacteria 8931
73 Ga0068863_100055329 3300005841 Bacteria 3757
74 Ga0068858_100003672 3300005842 Bacteria 15203
75 Ga0068858_100043670 3300005842 Bacteria 4156
76 Ga0068860_100051766 3300005843 Bacteria 3906
77 Ga0068860_100057367 3300005843 Bacteria 3702
78 Ga0068860_100559759 3300005843 Bacteria 1146
79 Ga0068862_100010521 3300005844 Bacteria 7642
80 Ga0070717_10118981 3300006028 Bacteria 2261
81 Ga0075368_10014743 3300006042 Bacteria 2891
82 Ga0075363_100034513 3300006048 Bacteria 2641
83 Ga0075362_10003105 3300006177 Bacteria 5728
84 Ga0075367_10081014 3300006178 Bacteria 1964
85 Ga0075369_10015885 3300006186 Bacteria 3029
86 Ga0075366_10034909 3300006195 Bacteria 2964
87 Ga0075366_10049366 3300006195 Bacteria 2497
88 Ga0075366_10086121 3300006195 Bacteria 1880
89 Ga0097621_100021677 3300006237 Bacteria 4975
90 Ga0075370_10141133 3300006353 Bacteria 1408
91 Ga0068871_100021237 3300006358 Bacteria 4987
92 Ga0068871_100048005 3300006358 Bacteria 3444
93 Ga0075434_100280287 3300006871 Bacteria 1686
94 Ga0068865_100000084 3300006881 Bacteria 50482
95 Ga0068865_100232895 3300006881 Bacteria 1446
96 Ga0068865_100301908 3300006881 Bacteria 1282
97 Ga0097620_100009910 3300006931 Bacteria 9622
98 Ga0097620_100206637 3300006931 Bacteria 2049
99 Ga0105240_10343645 3300009093 Bacteria 1694
100 Ga0105240_10605660 3300009093 Bacteria 1206
101 Ga0105245_10000063 3300009098 Bacteria 113377
102 Ga0105245_10060388 3300009098 Bacteria 3414
103 Ga0105245_10068724 3300009098 Bacteria 3211
104 Ga0105245_10101002 3300009098 Bacteria 2669
105 Ga0105245_10129008 3300009098 Bacteria 2370
106 Ga0105245_10236552 3300009098 Bacteria 1769
107 Ga0105245_10714347 3300009098 Bacteria 1036
108 Ga0105247_10034353 3300009101 Bacteria 3088
109 Ga0105243_10001481 3300009148 Bacteria 20602
110 Ga0105241_10020663 3300009174 Bacteria 4865
111 Ga0105242_10066932 3300009176 Bacteria 2968
112 Ga0105248_10041043 3300009177 Bacteria 5187
113 Ga0105237_10002642 3300009545 Bacteria 22062
114 Ga0105237_10783017 3300009545 Bacteria 960
115 Ga0105238_10080059 3300009551 Bacteria 3256
116 Ga0105249_10098827 3300009553 Bacteria 2742
117 Ga0105239_10046289 3300010375 Bacteria 4767
118 Ga0105239_10869485 3300010375 Bacteria 1034
119 Ga0157374_10000417 3300013296 Bacteria 38535
120 Ga0157374_10142440 3300013296 Bacteria 2327
121 Ga0157378_10000193 3300013297 Bacteria 58970
122 Ga0157378_10090597 3300013297 Bacteria 2779
123 Ga0157378_10226422 3300013297 Bacteria 1780
124 Ga0157378_10602470 3300013297 Bacteria 1110
125 Ga0163162_10280914 3300013306 Bacteria 1797
126 Ga0157372_10382110 3300013307 Bacteria 1641
127 Ga0157375_10006468 3300013308 Bacteria 10209
128 Ga0157375_10007965 3300013308 Bacteria 9275
129 Ga0157375_10062912 3300013308 Bacteria 3689
130 Ga0157375_10144706 3300013308 Bacteria 2507
131 Ga0157375_11015798 3300013308 Bacteria 968
132 Ga0157380_10700460 3300014326 Bacteria 1018
133 Ga0157377_10141008 3300014745 Bacteria 1481
134 Ga0157377_10250879 3300014745 Bacteria 1147
135 Ga0157377_10473787 3300014745 Bacteria 869
136 Ga0157379_10058827 3300014968 Bacteria 3437
137 Ga0157376_10419627 3300014969 Bacteria 1298
138 Ga0157376_10643070 3300014969 Bacteria 1060
139 Ga0163161_10398894 3300017792 Bacteria 1103
140 Ga0213872_10000508 3300021361 Bacteria 30750
141 Ga0213872_10024874 3300021361 Bacteria 2753
142 Ga0207642_10001761 3300025899 Bacteria 6689
143 Ga0207680_10157877 3300025903 Bacteria 1518
144 Ga0207645_10004178 3300025907 Bacteria 10720
145 Ga0207645_10015413 3300025907 Bacteria 5078
146 Ga0207643_10006373 3300025908 Bacteria 6320
147 Ga0207684_10066712 3300025910 Bacteria 3056
148 Ga0207707_10091120 3300025912 Bacteria 2664
149 Ga0207671_10031203 3300025914 Bacteria 3971
150 Ga0207671_10147043 3300025914 Bacteria 1818
151 Ga0207662_10127882 3300025918 Unclassified 1599
152 Ga0207657_10150413 3300025919 Bacteria 1897
153 Ga0207694_10170338 3300025924 Bacteria 1763
154 Ga0207650_10024224 3300025925 Bacteria 4312
155 Ga0207650_10186146 3300025925 Bacteria 1657
156 Ga0207659_10016587 3300025926 Bacteria 4796
157 Ga0207687_10113447 3300025927 Bacteria 2016
158 Ga0207690_10045589 3300025932 Bacteria 2897
159 Ga0207706_10035099 3300025933 Bacteria 4461
160 Ga0207706_10061857 3300025933 Bacteria 3297
161 Ga0207686_10000467 3300025934 Bacteria 26772
162 Ga0207686_10036117 3300025934 Bacteria 2972
163 Ga0207709_10001392 3300025935 Bacteria 16932
164 Ga0207670_10035535 3300025936 Bacteria 3232
165 Ga0207669_10360775 3300025937 Bacteria 1126
166 Ga0207704_10000579 3300025938 Bacteria 16294
167 Ga0207704_10044587 3300025938 Bacteria 2628
168 Ga0207704_10216396 3300025938 Bacteria 1414
169 Ga0207691_10008114 3300025940 Bacteria 10080
170 Ga0207691_10487037 3300025940 Bacteria 1048
171 Ga0207711_10026034 3300025941 Bacteria 4906
172 Ga0207711_10257497 3300025941 Bacteria 1603
173 Ga0207689_10000152 3300025942 Bacteria 59757
174 Ga0207689_10002309 3300025942 Bacteria 17861
175 Ga0207689_10012076 3300025942 Bacteria 7398
176 Ga0207689_10111051 3300025942 Bacteria 2253
177 Ga0207667_10036360 3300025949 Bacteria 5279
178 Ga0207651_10014341 3300025960 Bacteria 4571
179 Ga0207712_10064255 3300025961 Bacteria 2616
180 Ga0207640_10248318 3300025981 Bacteria 1379
181 Ga0207658_10027903 3300025986 Bacteria 3971
182 Ga0207658_10352960 3300025986 Bacteria 1281
183 Ga0207677_10008876 3300026023 Bacteria 5635
184 Ga0207677_10017087 3300026023 Bacteria 4316
185 Ga0207677_10472405 3300026023 Bacteria 1079
186 Ga0207639_10012271 3300026041 Bacteria 5967
187 Ga0207708_10000166 3300026075 Bacteria 51921
188 Ga0207702_10811797 3300026078 Bacteria 925
189 Ga0207641_10110371 3300026088 Bacteria 2437
190 Ga0207641_10512146 3300026088 Bacteria 1166
191 Ga0207648_10000131 3300026089 Bacteria 73949
192 Ga0207648_10003979 3300026089 Bacteria 15346
193 Ga0207648_10014846 3300026089 Bacteria 7183
194 Ga0207648_10406538 3300026089 Bacteria 1234
195 Ga0207674_10015017 3300026116 Bacteria 8530
196 Ga0207674_10051969 3300026116 Bacteria 4180
197 Ga0207674_10098711 3300026116 Bacteria 2903
198 Ga0207674_10131940 3300026116 Bacteria 2461
199 Ga0207675_100000084 3300026118 Bacteria 74312
200 Ga0207675_100045407 3300026118 Bacteria 4104
201 Ga0207683_10011637 3300026121 Bacteria 7511
202 Ga0207698_10571100 3300026142 Bacteria 1111
203 Ga0209813_10089946 3300027866 Bacteria 1029
204 Ga0268266_10083609 3300028379 Bacteria 2787
205 Ga0268265_10161984 3300028380 Bacteria 1901
206 Ga0268265_10704809 3300028380 Bacteria 976
207 Ga0268264_10024774 3300028381 Bacteria 4901
208 Ga0268264_10113093 3300028381 Bacteria 2381
209 Ga0268264_10719189 3300028381 Bacteria 993
210 Ga0265324_10000055 3300029957 Bacteria 95549
211 Ga0265324_10000056 3300029957 Bacteria 95534
212 Ga0265324_10003290 3300029957 Bacteria 7765
213 Ga0265330_10001792 3300031235 Bacteria 12048
214 Ga0265328_10000444 3300031239 Bacteria 19287
215 Ga0265328_10004356 3300031239 Bacteria 6151
216 Ga0265325_10000233 3300031241 Bacteria 39510
217 Ga0265331_10000050 3300031250 Bacteria 181286
218 Ga0265331_10002575 3300031250 Bacteria 12194
219 Ga0265331_10008850 3300031250 Bacteria 5698
220 Ga0265331_10010559 3300031250 Bacteria 5102
221 Ga0265331_10032375 3300031250 Bacteria 2591
222 Ga0265327_10000109 3300031251 Bacteria 181275
223 Ga0265327_10000213 3300031251 Bacteria 121151
224 Ga0265327_10000730 3300031251 Bacteria 51310
225 Ga0265327_10013003 3300031251 Bacteria 5564
226 Ga0265327_10055001 3300031251 Bacteria 2058
227 Ga0265327_10056269 3300031251 Bacteria 2027
228 Ga0265327_10097850 3300031251 Bacteria 1420
229 Ga0265316_10167557 3300031344 Bacteria 1640
230 Ga0265316_10278227 3300031344 Bacteria 1223
231 Ga0307408_100065329 3300031548 Bacteria 2668
232 Ga0316575_10000182 3300031665 Bacteria 16330
233 Ga0265314_10016464 3300031711 Bacteria 5838
234 Ga0265314_10034031 3300031711 Bacteria 3728
235 Ga0265314_10076381 3300031711 Bacteria 2225
236 Ga0307516_10074970 3300031730 Bacteria 3238
237 Ga0307405_10040777 3300031731 Bacteria 2814
238 Ga0307410_10105043 3300031852 Bacteria 2032
239 Ga0307406_10008965 3300031901 Bacteria 5594
240 Ga0307407_10103164 3300031903 Bacteria 1775
241 Ga0307409_100023982 3300031995 Bacteria 4243
242 Ga0307416_100087311 3300032002 Bacteria 2662
243 Ga0307414_10079928 3300032004 Bacteria 2389
244 Ga0307411_10235291 3300032005 Unclassified 1430
245 Ga0307411_10315957 3300032005 Bacteria 1259
246 Ga0316583_10012162 3300032133 Bacteria 3105
247 Ga0373937_0290086 3300036401 Bacteria 1546
248 Ga0373937_0618426 3300036401 Bacteria 1028
249 Ga0436360_0848587 3300039438 Bacteria 2342
250 Ga0436361_0270077 3300039447 Bacteria 30158
251 Ga0436361_0592921 3300039447 Bacteria 32848
252 Ga0436361_0856179 3300039447 Bacteria 4573
253 Ga0451577_0000013 3300042876 Bacteria 550689
254 Ga0451577_0449878 3300042876 Bacteria 1170
255 Ga0451577_0602767 3300042876 Bacteria 997
256 Ga0453683_0000033 3300044673 Bacteria 241479
257 Ga0453683_0196421 3300044673 Bacteria 1281
258 Ga0453684_0000029 3300044712 Bacteria 757969
259 Ga0453684_0000085 3300044712 Bacteria 397817
260 Ga0453684_0777858 3300044712 Bacteria 1034
261 Ga0453684_0987294 3300044712 Bacteria 896
262 Ga0451576_0000013 3300045051 Bacteria 665120
263 Ga0451576_0000018 3300045051 Bacteria 550689
264 Ga0451576_0001926 3300045051 Bacteria 33249
265 Ga0451576_0011550 3300045051 Bacteria 10020
266 Ga0451576_0016337 3300045051 Bacteria 8197
267 Ga0451576_0646477 3300045051 Bacteria 1111
268 Ga0451576_1052155 3300045051 Bacteria 852
269 Ga0495627_000016 3300046453 Bacteria 318947
270 Ga0495590_0004668 3300046457 Bacteria 5503
271 Ga0495638_0029049 3300046460 Bacteria 3566
272 Ga0495609_0000263 3300046538 Bacteria 49427
273 Ga0495625_0084420 3300046660 Bacteria 2206
274 Ga0495649_0023511 3300046694 Bacteria 3443
275 Ga0495660_0000292 3300046810 Bacteria 46230
276 Ga0495660_0044525 3300046810 Bacteria 2441
277 Ga0496114_0234662 3300048917 Bacteria 1612
278 Ga0496116_0049081 3300048919 Bacteria 2826
279 Ga0496124_0075420 3300048927 Bacteria 2786
280 Ga0501034_0002148 3300049571 Bacteria 24489
281 Ga0501072_0006565 3300049588 Bacteria 8858
282 nmdc:mga0k408_313021_c1 3300050493 Bacteria 937
283 nmdc:mga0k408_94387_c1 3300050493 Bacteria 1759
284 nmdc:mga06z11_11307_c1 3300050494 Bacteria 3845
285 nmdc:mga04h51_7743_c1 3300050495 Bacteria 2847
286 nmdc:mga07m45_59398_c1 3300050496 Bacteria 2164
287 Ga0495619_0228948 3300053085 Bacteria 1288
288 Ga0500593_011742 3300053117 Bacteria 3700
289 Ga0500622_0000011 3300053156 Bacteria 386096

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100032648 Ga0068864_1000326485 209
2 3300005841 Ga0068863_100010638 Ga0068863_1000106389 209
3 3300009098 Ga0105245_10236552 Ga0105245_102365522 209
4 3300028381 Ga0268264_10113093 Ga0268264_101130933 209
5 3300048917 Ga0496114_0234662 Ga0496114_0234662_297_992 213
6 3300031250 Ga0265331_10002575 Ga0265331_100025753 215
7 3300031251 Ga0265327_10000730 Ga0265327_1000073043 215
8 3300046460 Ga0495638_0029049 Ga0495638_0029049_2077_2781 216
9 3300046694 Ga0495649_0023511 Ga0495649_0023511_1316_2020 216
10 3300009545 Ga0105237_10783017 Ga0105237_107830172 218
11 3300031711 Ga0265314_10076381 Ga0265314_100763813 218
12 3300013297 Ga0157378_10602470 Ga0157378_106024702 219
13 3300031239 Ga0265328_10000444 Ga0265328_100004445 219
14 3300031250 Ga0265331_10000050 Ga0265331_10000050221 219
15 3300031251 Ga0265327_10000109 Ga0265327_100001094 219
16 3300005345 Ga0070692_10005239 Ga0070692_100052393 221
17 3300005549 Ga0070704_100662300 Ga0070704_1006623001 221
18 3300013297 Ga0157378_10226422 Ga0157378_102264223 221
19 3300031251 Ga0265327_10056269 Ga0265327_100562692 221
20 3300006195 Ga0075366_10034909 Ga0075366_100349094 222
21 iso_pu_bacteria 2547132103 2547375339 222
22 iso_pu_bacteria 2843690924 2843694314 222
23 iso_pu_bacteria 2846033681 2846034230 223
24 iso_pu_bacteria 2846037992 2846041067 223
25 3300021361 Ga0213872_10000508 Ga0213872_1000050827 226
26 3300031665 Ga0316575_10000182 Ga0316575_100001822 226
27 3300039447 Ga0436361_0270077 Ga0436361_0270077_18940_19623 226
28 3300039447 Ga0436361_0592921 Ga0436361_0592921_26248_26934 226
29 3300039447 Ga0436361_0856179 Ga0436361_0856179_3371_4054 226
30 3300031239 Ga0265328_10004356 Ga0265328_100043566 227
31 3300031250 Ga0265331_10010559 Ga0265331_100105592 227
32 3300031251 Ga0265327_10097850 Ga0265327_100978502 227
33 3300031344 Ga0265316_10167557 Ga0265316_101675572 227
34 3300039438 Ga0436360_0848587 Ga0436360_0848587_392_1078 227
35 3300048927 Ga0496124_0075420 Ga0496124_0075420_1000_1791 228
36 3300013307 Ga0157372_10382110 Ga0157372_103821102 229
37 3300021361 Ga0213872_10024874 Ga0213872_100248744 229
38 3300031251 Ga0265327_10000213 Ga0265327_1000021388 229
39 3300042876 Ga0451577_0000013 Ga0451577_0000013_132273_132965 229
40 3300044673 Ga0453683_0000033 Ga0453683_0000033_11116_11808 229
41 3300044712 Ga0453684_0000085 Ga0453684_0000085_264853_265545 229
42 3300045051 Ga0451576_0000018 Ga0451576_0000018_417725_418417 229
43 3300053156 Ga0500622_0000011 Ga0500622_0000011_60737_61429 229
44 3300005330 Ga0070690_100005366 Ga0070690_1000053663 230
45 3300005331 Ga0070670_100684891 Ga0070670_1006848912 230
46 3300005334 Ga0068869_100000049 Ga0068869_10000004939 230
47 3300005338 Ga0068868_100032296 Ga0068868_1000322963 230
48 3300005340 Ga0070689_100000283 Ga0070689_1000002832 230
49 3300005341 Ga0070691_10031649 Ga0070691_100316492 230
50 3300005356 Ga0070674_100314001 Ga0070674_1003140012 230
51 3300005438 Ga0070701_10070500 Ga0070701_100705002 230
52 3300005440 Ga0070705_100021089 Ga0070705_1000210895 230
53 3300005441 Ga0070700_100000483 Ga0070700_1000004834 230
54 3300005444 Ga0070694_100036028 Ga0070694_1000360282 230
55 3300005459 Ga0068867_100004961 Ga0068867_1000049612 230
56 3300005459 Ga0068867_100273453 Ga0068867_1002734532 230
57 3300005543 Ga0070672_100366809 Ga0070672_1003668091 230
58 3300005544 Ga0070686_100000581 Ga0070686_10000058114 230
59 3300005546 Ga0070696_100080873 Ga0070696_1000808732 230
60 3300005547 Ga0070693_100034826 Ga0070693_1000348262 230
61 3300005615 Ga0070702_100002790 Ga0070702_1000027908 230
62 3300005617 Ga0068859_100009911 Ga0068859_1000099118 230
63 3300005617 Ga0068859_100206630 Ga0068859_1002066302 230
64 3300005718 Ga0068866_10007913 Ga0068866_100079133 230
65 3300005719 Ga0068861_100004451 Ga0068861_1000044513 230
66 3300005840 Ga0068870_10032647 Ga0068870_100326472 230
67 3300005842 Ga0068858_100003672 Ga0068858_1000036722 230
68 3300005842 Ga0068858_100043670 Ga0068858_1000436703 230
69 3300005843 Ga0068860_100051766 Ga0068860_1000517663 230
70 3300005843 Ga0068860_100057367 Ga0068860_1000573673 230
71 3300005844 Ga0068862_100010521 Ga0068862_1000105215 230
72 3300006237 Ga0097621_100021677 Ga0097621_1000216773 230
73 3300006358 Ga0068871_100021237 Ga0068871_1000212374 230
74 3300006358 Ga0068871_100048005 Ga0068871_1000480052 230
75 3300006871 Ga0075434_100280287 Ga0075434_1002802871 230
76 3300006881 Ga0068865_100000084 Ga0068865_10000008414 230
77 3300006881 Ga0068865_100301908 Ga0068865_1003019082 230
78 3300006931 Ga0097620_100009910 Ga0097620_1000099103 230
79 3300006931 Ga0097620_100206637 Ga0097620_1002066372 230
80 3300009098 Ga0105245_10000063 Ga0105245_1000006367 230
81 3300009098 Ga0105245_10068724 Ga0105245_100687244 230
82 3300009101 Ga0105247_10034353 Ga0105247_100343532 230
83 3300009148 Ga0105243_10001481 Ga0105243_100014814 230
84 3300009177 Ga0105248_10041043 Ga0105248_100410432 230
85 3300009553 Ga0105249_10098827 Ga0105249_100988272 230
86 3300013297 Ga0157378_10000193 Ga0157378_1000019315 230
87 3300013297 Ga0157378_10090597 Ga0157378_100905972 230
88 3300013306 Ga0163162_10280914 Ga0163162_102809142 230
89 3300013308 Ga0157375_10007965 Ga0157375_100079653 230
90 3300013308 Ga0157375_10144706 Ga0157375_101447064 230
91 3300014326 Ga0157380_10700460 Ga0157380_107004602 230
92 3300014745 Ga0157377_10250879 Ga0157377_102508792 230
93 3300014968 Ga0157379_10058827 Ga0157379_100588272 230
94 3300014969 Ga0157376_10419627 Ga0157376_104196272 230
95 3300025899 Ga0207642_10001761 Ga0207642_100017614 230
96 3300025903 Ga0207680_10157877 Ga0207680_101578772 230
97 3300025908 Ga0207643_10006373 Ga0207643_100063735 230
98 3300025934 Ga0207686_10000467 Ga0207686_1000046713 230
99 3300025935 Ga0207709_10001392 Ga0207709_100013924 230
100 3300025936 Ga0207670_10035535 Ga0207670_100355352 230
101 3300025937 Ga0207669_10360775 Ga0207669_103607752 230
102 3300025938 Ga0207704_10000579 Ga0207704_100005797 230
103 3300025940 Ga0207691_10487037 Ga0207691_104870372 230
104 3300025941 Ga0207711_10026034 Ga0207711_100260346 230
105 3300025941 Ga0207711_10257497 Ga0207711_102574972 230
106 3300025942 Ga0207689_10000152 Ga0207689_1000015221 230
107 3300025942 Ga0207689_10002309 Ga0207689_1000230917 230
108 3300025961 Ga0207712_10064255 Ga0207712_100642552 230
109 3300025986 Ga0207658_10352960 Ga0207658_103529602 230
110 3300026023 Ga0207677_10017087 Ga0207677_100170873 230
111 3300026075 Ga0207708_10000166 Ga0207708_1000016613 230
112 3300026088 Ga0207641_10512146 Ga0207641_105121462 230
113 3300026089 Ga0207648_10000131 Ga0207648_1000013137 230
114 3300026118 Ga0207675_100000084 Ga0207675_10000008454 230
115 3300026118 Ga0207675_100045407 Ga0207675_1000454072 230
116 3300026121 Ga0207683_10011637 Ga0207683_100116377 230
117 3300028380 Ga0268265_10161984 Ga0268265_101619842 230
118 3300028381 Ga0268264_10024774 Ga0268264_100247744 230
119 3300029957 Ga0265324_10000055 Ga0265324_1000005579 230
120 3300029957 Ga0265324_10000056 Ga0265324_100000568 230
121 3300029957 Ga0265324_10003290 Ga0265324_100032905 230
122 3300031241 Ga0265325_10000233 Ga0265325_1000023310 230
123 3300031250 Ga0265331_10008850 Ga0265331_100088505 230
124 3300031250 Ga0265331_10032375 Ga0265331_100323752 230
125 3300031344 Ga0265316_10278227 Ga0265316_102782271 230
126 3300031711 Ga0265314_10016464 Ga0265314_100164642 230
127 3300031711 Ga0265314_10034031 Ga0265314_100340313 230
128 3300036401 Ga0373937_0618426 Ga0373937_0618426_43_738 230
129 3300042876 Ga0451577_0449878 Ga0451577_0449878_284_979 230
130 3300042876 Ga0451577_0602767 Ga0451577_0602767_219_914 230
131 3300044712 Ga0453684_0000029 Ga0453684_0000029_691_1386 230
132 3300045051 Ga0451576_0000013 Ga0451576_0000013_656417_657112 230
133 3300045051 Ga0451576_0646477 Ga0451576_0646477_289_984 230
134 3300049571 Ga0501034_0002148 Ga0501034_0002148_13096_13791 230
135 3300049588 Ga0501072_0006565 Ga0501072_0006565_4260_4955 230
136 3300053085 Ga0495619_0228948 Ga0495619_0228948_228_923 230
137 3300005331 Ga0070670_100636238 Ga0070670_1006362381 231
138 3300005337 Ga0070682_100130491 Ga0070682_1001304912 231
139 3300005339 Ga0070660_100110313 Ga0070660_1001103133 231
140 3300005340 Ga0070689_100747765 Ga0070689_1007477651 231
141 3300005343 Ga0070687_100014305 Ga0070687_1000143055 231
142 3300005345 Ga0070692_10088228 Ga0070692_100882281 231
143 3300005356 Ga0070674_100029248 Ga0070674_1000292482 231
144 3300005366 Ga0070659_100064591 Ga0070659_1000645912 231
145 3300005441 Ga0070700_100491375 Ga0070700_1004913751 231
146 3300005444 Ga0070694_100208173 Ga0070694_1002081732 231
147 3300005457 Ga0070662_100134569 Ga0070662_1001345693 231
148 3300005458 Ga0070681_10118003 Ga0070681_101180033 231
149 3300005530 Ga0070679_100175442 Ga0070679_1001754422 231
150 3300005535 Ga0070684_100683982 Ga0070684_1006839821 231
151 3300005539 Ga0068853_100011886 Ga0068853_1000118868 231
152 3300005547 Ga0070693_100207117 Ga0070693_1002071172 231
153 3300005548 Ga0070665_100090819 Ga0070665_1000908192 231
154 3300005563 Ga0068855_100028134 Ga0068855_1000281345 231
155 3300005564 Ga0070664_100115692 Ga0070664_1001156923 231
156 3300005577 Ga0068857_100095083 Ga0068857_1000950832 231
157 3300005577 Ga0068857_100114661 Ga0068857_1001146612 231
158 3300005614 Ga0068856_100886167 Ga0068856_1008861672 231
159 3300005718 Ga0068866_10130584 Ga0068866_101305842 231
160 3300005840 Ga0068870_10180132 Ga0068870_101801322 231
161 3300005841 Ga0068863_100055329 Ga0068863_1000553293 231
162 3300005843 Ga0068860_100559759 Ga0068860_1005597592 231
163 3300006028 Ga0070717_10118981 Ga0070717_101189813 231
164 3300009093 Ga0105240_10343645 Ga0105240_103436452 231
165 3300009093 Ga0105240_10605660 Ga0105240_106056601 231
166 3300009098 Ga0105245_10101002 Ga0105245_101010023 231
167 3300009098 Ga0105245_10129008 Ga0105245_101290082 231
168 3300009098 Ga0105245_10714347 Ga0105245_107143472 231
169 3300009174 Ga0105241_10020663 Ga0105241_100206632 231
170 3300009176 Ga0105242_10066932 Ga0105242_100669324 231
171 3300009545 Ga0105237_10002642 Ga0105237_100026424 231
172 3300009551 Ga0105238_10080059 Ga0105238_100800591 231
173 3300010375 Ga0105239_10046289 Ga0105239_100462894 231
174 3300013296 Ga0157374_10000417 Ga0157374_1000041734 231
175 3300013296 Ga0157374_10142440 Ga0157374_101424402 231
176 3300013308 Ga0157375_10062912 Ga0157375_100629123 231
177 3300013308 Ga0157375_11015798 Ga0157375_110157981 231
178 3300014745 Ga0157377_10473787 Ga0157377_104737872 231
179 3300014969 Ga0157376_10643070 Ga0157376_106430702 231
180 3300017792 Ga0163161_10398894 Ga0163161_103988942 231
181 3300025912 Ga0207707_10091120 Ga0207707_100911203 231
182 3300025914 Ga0207671_10147043 Ga0207671_101470432 231
183 3300025918 Ga0207662_10127882 Ga0207662_101278822 231
184 3300025919 Ga0207657_10150413 Ga0207657_101504132 231
185 3300025924 Ga0207694_10170338 Ga0207694_101703382 231
186 3300025925 Ga0207650_10024224 Ga0207650_100242241 231
187 3300025927 Ga0207687_10113447 Ga0207687_101134472 231
188 3300025932 Ga0207690_10045589 Ga0207690_100455893 231
189 3300025934 Ga0207686_10036117 Ga0207686_100361172 231
190 3300025942 Ga0207689_10111051 Ga0207689_101110511 231
191 3300025949 Ga0207667_10036360 Ga0207667_100363603 231
192 3300026023 Ga0207677_10472405 Ga0207677_104724052 231
193 3300026041 Ga0207639_10012271 Ga0207639_100122716 231
194 3300026088 Ga0207641_10110371 Ga0207641_101103712 231
195 3300026089 Ga0207648_10406538 Ga0207648_104065382 231
196 3300026116 Ga0207674_10051969 Ga0207674_100519693 231
197 3300026116 Ga0207674_10098711 Ga0207674_100987113 231
198 3300028379 Ga0268266_10083609 Ga0268266_100836093 231
199 3300028380 Ga0268265_10704809 Ga0268265_107048091 231
200 3300028381 Ga0268264_10719189 Ga0268264_107191892 231
201 3300031235 Ga0265330_10001792 Ga0265330_1000179210 231
202 3300031251 Ga0265327_10013003 Ga0265327_100130037 231
203 3300031251 Ga0265327_10055001 Ga0265327_100550012 231
204 3300031548 Ga0307408_100065329 Ga0307408_1000653292 231
205 3300031730 Ga0307516_10074970 Ga0307516_100749702 231
206 3300032005 Ga0307411_10235291 Ga0307411_102352912 231
207 3300032133 Ga0316583_10012162 Ga0316583_100121622 231
208 3300036401 Ga0373937_0290086 Ga0373937_0290086_99_797 231
209 3300044673 Ga0453683_0196421 Ga0453683_0196421_292_990 231
210 3300044712 Ga0453684_0777858 Ga0453684_0777858_245_994 231
211 3300044712 Ga0453684_0987294 Ga0453684_0987294_76_774 231
212 3300045051 Ga0451576_0001926 Ga0451576_0001926_8998_9696 231
213 3300045051 Ga0451576_0011550 Ga0451576_0011550_743_1441 231
214 3300045051 Ga0451576_0016337 Ga0451576_0016337_2462_3160 231
215 3300046453 Ga0495627_000016 Ga0495627_000016_299532_300266 231
216 3300046538 Ga0495609_0000263 Ga0495609_0000263_3876_4610 231
217 3300046660 Ga0495625_0084420 Ga0495625_0084420_1300_2004 231
218 3300046810 Ga0495660_0000292 Ga0495660_0000292_9347_10081 231
219 3300048919 Ga0496116_0049081 Ga0496116_0049081_533_1267 231
220 3300050493 nmdc:mga0k408_94387_c1 nmdc:mga0k408_94387_c1_174_911 231
221 3300005614 Ga0068856_100997486 Ga0068856_1009974861 233
222 3300026078 Ga0207702_10811797 Ga0207702_108117971 233
223 3300005328 Ga0070676_10002353 Ga0070676_1000235310 238
224 3300005331 Ga0070670_100197227 Ga0070670_1001972272 238
225 3300005334 Ga0068869_100016765 Ga0068869_1000167654 238
226 3300005338 Ga0068868_100009022 Ga0068868_1000090225 238
227 3300005354 Ga0070675_100005231 Ga0070675_1000052317 238
228 3300005364 Ga0070673_100009689 Ga0070673_1000096896 238
229 3300005367 Ga0070667_100068931 Ga0070667_1000689313 238
230 3300005457 Ga0070662_100057925 Ga0070662_1000579254 238
231 3300005459 Ga0068867_100005705 Ga0068867_1000057053 238
232 3300005543 Ga0070672_100003578 Ga0070672_1000035788 238
233 3300005564 Ga0070664_100230459 Ga0070664_1002304592 238
234 3300005577 Ga0068857_100059646 Ga0068857_1000596462 238
235 3300006195 Ga0075366_10086121 Ga0075366_100861212 238
236 3300009098 Ga0105245_10060388 Ga0105245_100603881 238
237 3300010375 Ga0105239_10869485 Ga0105239_108694851 238
238 3300013308 Ga0157375_10006468 Ga0157375_100064688 238
239 3300014745 Ga0157377_10141008 Ga0157377_101410082 238
240 3300025907 Ga0207645_10004178 Ga0207645_100041786 238
241 3300025925 Ga0207650_10186146 Ga0207650_101861463 238
242 3300025926 Ga0207659_10016587 Ga0207659_100165875 238
243 3300025933 Ga0207706_10061857 Ga0207706_100618575 238
244 3300025938 Ga0207704_10044587 Ga0207704_100445873 238
245 3300025940 Ga0207691_10008114 Ga0207691_100081148 238
246 3300025942 Ga0207689_10012076 Ga0207689_100120767 238
247 3300025960 Ga0207651_10014341 Ga0207651_100143412 238
248 3300025986 Ga0207658_10027903 Ga0207658_100279033 238
249 3300026023 Ga0207677_10008876 Ga0207677_100088763 238
250 3300026089 Ga0207648_10003979 Ga0207648_100039798 238
251 3300026116 Ga0207674_10015017 Ga0207674_100150174 238
252 3300050493 nmdc:mga0k408_313021_c1 nmdc:mga0k408_313021_c1_51_845 238
253 3300053117 Ga0500593_011742 Ga0500593_011742_451_1233 242
254 3300005577 Ga0068857_100168519 Ga0068857_1001685192 243
255 3300005578 Ga0068854_100188697 Ga0068854_1001886972 243
256 3300006048 Ga0075363_100034513 Ga0075363_1000345132 243
257 3300006177 Ga0075362_10003105 Ga0075362_100031053 243
258 3300006186 Ga0075369_10015885 Ga0075369_100158854 243
259 3300006881 Ga0068865_100232895 Ga0068865_1002328952 243
260 3300025914 Ga0207671_10031203 Ga0207671_100312034 243
261 3300025933 Ga0207706_10035099 Ga0207706_100350993 243
262 3300025938 Ga0207704_10216396 Ga0207704_102163962 243
263 3300025981 Ga0207640_10248318 Ga0207640_102483182 243
264 3300026116 Ga0207674_10131940 Ga0207674_101319403 243
265 3300026142 Ga0207698_10571100 Ga0207698_105711002 243
266 3300005467 Ga0070706_100001272 Ga0070706_10000127211 244
267 3300005518 Ga0070699_100134827 Ga0070699_1001348273 244
268 3300006042 Ga0075368_10014743 Ga0075368_100147432 244
269 3300006178 Ga0075367_10081014 Ga0075367_100810141 244
270 3300006353 Ga0075370_10141133 Ga0075370_101411332 244
271 3300025910 Ga0207684_10066712 Ga0207684_100667124 244
272 3300027866 Ga0209813_10089946 Ga0209813_100899462 244
273 3300050494 nmdc:mga06z11_11307_c1 nmdc:mga06z11_11307_c1_1230_2021 244
274 3300050495 nmdc:mga04h51_7743_c1 nmdc:mga04h51_7743_c1_1885_2676 244
275 3300050496 nmdc:mga07m45_59398_c1 nmdc:mga07m45_59398_c1_1015_1806 244
276 3300031731 Ga0307405_10040777 Ga0307405_100407772 245
277 3300031852 Ga0307410_10105043 Ga0307410_101050432 245
278 3300031901 Ga0307406_10008965 Ga0307406_100089652 245
279 3300031903 Ga0307407_10103164 Ga0307407_101031642 245
280 3300031995 Ga0307409_100023982 Ga0307409_1000239824 245
281 3300032002 Ga0307416_100087311 Ga0307416_1000873112 245
282 3300032004 Ga0307414_10079928 Ga0307414_100799282 245
283 3300032005 Ga0307411_10315957 Ga0307411_103159571 245
284 3300046457 Ga0495590_0004668 Ga0495590_0004668_2612_3403 247
285 3300046810 Ga0495660_0044525 Ga0495660_0044525_1168_1959 247
286 3300045051 Ga0451576_1052155 Ga0451576_1052155_40_819 248
287 3300005459 Ga0068867_100060040 Ga0068867_1000600402 250
288 3300026089 Ga0207648_10014846 Ga0207648_100148463 250
289 3300005328 Ga0070676_10010815 Ga0070676_100108155 251
290 3300005578 Ga0068854_100303363 Ga0068854_1003033632 251
291 3300025907 Ga0207645_10015413 Ga0207645_100154134 251
292 3300006195 Ga0075366_10049366 Ga0075366_100493662 252
293 3300003322 rootL2_10046028 rootL2_100460286 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00912

Transgly

Transglycosylase

120

258

0.9

PF00912

Transgly

Transglycosylase

51

129

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zg7-assembly1.cif.gz_B crystal structure of penicillin-binding protein 4 from listeria monocytogenes in the apo form 0.8975 175 245
2olv-assembly1.cif.gz_A structural insight into the transglycosylation step of bacterial cell wall biosynthesis : donor ligand complex 0.8879 58 250
2olv-assembly2.cif.gz_B structural insight into the transglycosylation step of bacterial cell wall biosynthesis : donor ligand complex 0.8874 58 250
2oqo-assembly1.cif.gz_A-2 crystal structure of a peptidoglycan glycosyltransferase from a class a pbp: insight into bacterial cell wall synthesis 0.8823 58 249
3d3h-assembly1.cif.gz_A-2 crystal structure of a complex of the peptidoglycan glycosyltransferase domain from aquifex aeolicus and neryl moenomycin a 0.8754 64 249
ID Description Score Start End Superfamily
af_P46022_52_241_1.10.3810.10 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.8913 49 249 1.10.3810.10
2olvA02 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.8784 62 255 1.10.3810.10
3d3hA00 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.8754 64 249 1.10.3810.10
3fwmA02 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.865 60 248 1.10.3810.10
af_P71707_174_375_1.10.3810.10 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.8641 62 249 1.10.3810.10
ID Description Score Start End GO Terms
AF-A0A0U1PZ17-F1-model_v4 Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28) (Glycan polymerase) (Peptidoglycan glycosyltransferase MtgA) (PGT) 0.9382 11 255 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0009274
GO:0016763
GO:0071555
AF-A0A0F9UIU3-F1-model_v4 Glycosyl transferase family 51 domain-containing protein 0.9348 11 249 GO:0005886
GO:0008360
GO:0009252
GO:0009274
GO:0016763
GO:0071555
AF-A0A125WFD2-F1-model_v4 deleted 0.9333 14 255
AF-A0A3D0EVM0-F1-model_v4 Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28) (Glycan polymerase) (Peptidoglycan glycosyltransferase MtgA) (PGT) 0.933 11 255 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0009274
GO:0016763
GO:0071555
AF-K1Z276-F1-model_v4 Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28) (Glycan polymerase) (Peptidoglycan glycosyltransferase MtgA) (PGT) 0.9317 22 255 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0009274
GO:0016763
GO:0071555

Feature Viewer

pLDDT pTM Quality
84.93 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map