F391418

General Info

Members Datasets Scaffolds Average Seq Length
293 172 290 107

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100006238|Ga0068862_1000062388
Length 103
Sequence MSGKDQGHATEHGGDRYSFRLYVTGATPSSSRAIAFIKAFCEQFLKGRYFLEVVDVYQQPALAEEERILATPTLVRTSPLPLRRIVGNLSDPHRLQAGLGISV

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
4 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
69 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
70 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
162 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
163 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
164 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.34
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0
Rhizoplane 1.71
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 2.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4113148 2162886011 Bacteria 1821
2 rootH1_10044094 3300003316 Bacteria 1475
3 rootH2_10287560 3300003320 Bacteria 2712
4 rootL2_10168466 3300003322 Bacteria 3253
5 rootH1_10390741 3300003323 Bacteria 1317
6 Ga0032354_1127704 3300003693 Viruses 573
7 Ga0065712_10013783 3300005290 Bacteria 2138
8 Ga0065712_10095010 3300005290 Bacteria 2231
9 Ga0065712_10411094 3300005290 Unclassified 721
10 Ga0070683_100347248 3300005329 Bacteria 1413
11 Ga0070690_100283310 3300005330 Bacteria 1183
12 Ga0070690_101036435 3300005330 Bacteria 648
13 Ga0070670_100426680 3300005331 Bacteria 1173
14 Ga0070670_100641695 3300005331 Bacteria 952
15 Ga0068869_100005451 3300005334 Bacteria 8003
16 Ga0070666_10038196 3300005335 Unclassified 3194
17 Ga0070666_10039907 3300005335 Unclassified 3130
18 Ga0070680_100169367 3300005336 Bacteria 1837
19 Ga0070680_100335979 3300005336 Bacteria 1283
20 Ga0068868_100015976 3300005338 Bacteria 5567
21 Ga0068868_100079516 3300005338 Bacteria 2626
22 Ga0068868_100101837 3300005338 Bacteria 2325
23 Ga0068868_100312573 3300005338 Unclassified 1337
24 Ga0070660_100175203 3300005339 Bacteria 1734
25 Ga0070689_100091335 3300005340 Bacteria 2400
26 Ga0070689_100172712 3300005340 Bacteria 1752
27 Ga0070689_100747719 3300005340 Bacteria 857
28 Ga0070689_101301346 3300005340 Bacteria 655
29 Ga0070692_10024267 3300005345 Unclassified 2979
30 Ga0070675_100042595 3300005354 Unclassified 3710
31 Ga0070675_100094830 3300005354 Bacteria 2505
32 Ga0070675_100119229 3300005354 Bacteria 2241
33 Ga0070675_100370561 3300005354 Bacteria 1273
34 Ga0070671_100105319 3300005355 Unclassified 2367
35 Ga0070671_101697396 3300005355 Bacteria 560
36 Ga0070674_100048242 3300005356 Bacteria 2922
37 Ga0070674_101071656 3300005356 Bacteria 710
38 Ga0070673_100102294 3300005364 Bacteria 2362
39 Ga0070673_100849099 3300005364 Bacteria 845
40 Ga0070688_100072315 3300005365 Bacteria 2210
41 Ga0070688_100103919 3300005365 Unclassified 1878
42 Ga0070688_101410708 3300005365 Bacteria 565
43 Ga0070701_10601862 3300005438 Bacteria 728
44 Ga0070663_101715342 3300005455 Bacteria 562
45 Ga0070663_102014245 3300005455 Unclassified 520
46 Ga0070678_100394182 3300005456 Bacteria 1201
47 Ga0070678_100890598 3300005456 Bacteria 813
48 Ga0070662_100008286 3300005457 Bacteria 6771
49 Ga0070662_100013573 3300005457 Bacteria 5424
50 Ga0070681_10773412 3300005458 Bacteria 877
51 Ga0068867_100073299 3300005459 Bacteria 2564
52 Ga0068867_100363914 3300005459 Bacteria 1210
53 Ga0068867_100809541 3300005459 Bacteria 836
54 Ga0070685_10029651 3300005466 Unclassified 3042
55 Ga0070706_101650701 3300005467 Unclassified 584
56 Ga0070679_100037930 3300005530 Bacteria 4789
57 Ga0070684_100001297 3300005535 Bacteria 17907
58 Ga0068853_100198686 3300005539 Bacteria 1824
59 Ga0068853_100355774 3300005539 Bacteria 1363
60 Ga0070672_100100861 3300005543 Bacteria 2341
61 Ga0070672_100518196 3300005543 Bacteria 1033
62 Ga0070672_101722851 3300005543 Bacteria 563
63 Ga0070686_100007741 3300005544 Bacteria 6005
64 Ga0070686_100025861 3300005544 Bacteria 3535
65 Ga0070686_101877739 3300005544 Unclassified 511
66 Ga0070686_101890909 3300005544 Bacteria 509
67 Ga0070665_100136948 3300005548 Bacteria 2452
68 Ga0068855_100048415 3300005563 Bacteria 5016
69 Ga0070664_100044389 3300005564 Bacteria 3753
70 Ga0070664_100121229 3300005564 Bacteria 2290
71 Ga0070664_100202869 3300005564 Bacteria 1770
72 Ga0068857_100041732 3300005577 Bacteria 4068
73 Ga0068857_100042527 3300005577 Bacteria 4032
74 Ga0068857_101115735 3300005577 Bacteria 762
75 Ga0068854_100260687 3300005578 Bacteria 1388
76 Ga0068854_101977199 3300005578 Bacteria 537
77 Ga0070702_100032042 3300005615 Unclassified 2882
78 Ga0070702_101402508 3300005615 Bacteria 571
79 Ga0068852_100178357 3300005616 Bacteria 1996
80 Ga0068852_100213706 3300005616 Unclassified 1831
81 Ga0068852_100557299 3300005616 Bacteria 1147
82 Ga0068859_100117887 3300005617 Unclassified 2720
83 Ga0068859_100163581 3300005617 Bacteria 2304
84 Ga0068859_100219977 3300005617 Unclassified 1986
85 Ga0068859_101238825 3300005617 Bacteria 822
86 Ga0068864_102047894 3300005618 Bacteria 579
87 Ga0068861_100246892 3300005719 Bacteria 1521
88 Ga0068851_10097339 3300005834 Unclassified 1557
89 Ga0068863_100559254 3300005841 Bacteria 1130
90 Ga0068858_100030967 3300005842 Bacteria 4969
91 Ga0068860_100107466 3300005843 Bacteria 2667
92 Ga0068862_100006238 3300005844 Bacteria 9926
93 Ga0070715_10046522 3300006163 Bacteria 1845
94 Ga0075366_10086528 3300006195 Bacteria 1875
95 Ga0075366_10714810 3300006195 Bacteria 622
96 Ga0097621_100064876 3300006237 Unclassified 3004
97 Ga0097621_100314228 3300006237 Bacteria 1386
98 Ga0068871_100364610 3300006358 Bacteria 1280
99 Ga0068865_100066036 3300006881 Unclassified 2551
100 Ga0097620_100117883 3300006931 Unclassified 2720
101 Ga0097620_100163584 3300006931 Bacteria 2304
102 Ga0097620_100219972 3300006931 Unclassified 1986
103 Ga0097620_101238903 3300006931 Bacteria 822
104 Ga0105240_10000011 3300009093 Bacteria 523646
105 Ga0105240_10713268 3300009093 Bacteria 1094
106 Ga0111539_10184108 3300009094 Bacteria 2439
107 Ga0105247_10131056 3300009101 Unclassified 1634
108 Ga0105242_10196024 3300009176 Bacteria 1791
109 Ga0105242_10657722 3300009176 Bacteria 1020
110 Ga0105248_10342979 3300009177 Bacteria 1682
111 Ga0105237_10195069 3300009545 Unclassified 2024
112 Ga0105249_10077789 3300009553 Bacteria 3077
113 Ga0105249_10182315 3300009553 Bacteria 2044
114 Ga0105249_11882617 3300009553 Bacteria 671
115 Ga0105239_10000052 3300010375 Bacteria 164624
116 Ga0105239_10000059 3300010375 Bacteria 155685
117 Ga0105239_12651160 3300010375 Unclassified 585
118 Ga0157318_1014945 3300012482 Bacteria 629
119 Ga0157323_1052174 3300012495 Bacteria 501
120 Ga0157324_1024611 3300012506 Bacteria 640
121 Ga0157371_10002684 3300013102 Bacteria 16831
122 Ga0157371_10261392 3300013102 Bacteria 1248
123 Ga0157371_10287407 3300013102 Bacteria 1189
124 Ga0157371_10367919 3300013102 Bacteria 1048
125 Ga0157371_10839898 3300013102 Bacteria 694
126 Ga0157370_10009205 3300013104 Bacteria 10588
127 Ga0157374_10001792 3300013296 Bacteria 18071
128 Ga0157374_10002989 3300013296 Bacteria 14152
129 Ga0157374_10316252 3300013296 Bacteria 1546
130 Ga0157378_10060099 3300013297 Unclassified 3391
131 Ga0163162_10030580 3300013306 Bacteria 5336
132 Ga0163162_10037356 3300013306 Bacteria 4846
133 Ga0163162_10063766 3300013306 Bacteria 3729
134 Ga0163162_12231623 3300013306 Bacteria 629
135 Ga0163162_13047846 3300013306 Unclassified 538
136 Ga0157372_10031587 3300013307 Bacteria 5798
137 Ga0157372_10058237 3300013307 Bacteria 4318
138 Ga0157372_10060007 3300013307 Bacteria 4256
139 Ga0157372_10465825 3300013307 Bacteria 1473
140 Ga0157372_10853802 3300013307 Bacteria 1057
141 Ga0157375_10120816 3300013308 Unclassified 2729
142 Ga0157375_10173570 3300013308 Bacteria 2304
143 Ga0157375_10641200 3300013308 Bacteria 1219
144 Ga0157375_10808879 3300013308 Bacteria 1086
145 Ga0163163_10005369 3300014325 Bacteria 11073
146 Ga0163163_10097488 3300014325 Unclassified 2960
147 Ga0163163_10854030 3300014325 Bacteria 974
148 Ga0157380_10272582 3300014326 Bacteria 1544
149 Ga0157380_10322421 3300014326 Bacteria 1433
150 Ga0157377_10039464 3300014745 Bacteria 2612
151 Ga0157377_10081770 3300014745 Bacteria 1890
152 Ga0157379_10043612 3300014968 Unclassified 4005
153 Ga0157379_10127198 3300014968 Bacteria 2293
154 Ga0157379_10233653 3300014968 Bacteria 1667
155 Ga0157376_10006975 3300014969 Bacteria 8014
156 Ga0157376_10052741 3300014969 Unclassified 3383
157 Ga0163161_10014435 3300017792 Bacteria 5499
158 Ga0163161_10181277 3300017792 Bacteria 1615
159 Ga0163161_10251902 3300017792 Bacteria 1376
160 Ga0207642_11043827 3300025899 Bacteria 527
161 Ga0207688_10252077 3300025901 Unclassified 1069
162 Ga0207680_10123242 3300025903 Bacteria 1698
163 Ga0207680_10836157 3300025903 Unclassified 660
164 Ga0207645_10011978 3300025907 Bacteria 5899
165 Ga0207645_10378114 3300025907 Bacteria 950
166 Ga0207705_10463756 3300025909 Bacteria 983
167 Ga0207684_11015203 3300025910 Unclassified 693
168 Ga0207654_10106095 3300025911 Bacteria 1739
169 Ga0207695_10000010 3300025913 Bacteria 981919
170 Ga0207695_10634084 3300025913 Bacteria 950
171 Ga0207660_10061848 3300025917 Bacteria 2696
172 Ga0207660_10269476 3300025917 Bacteria 1349
173 Ga0207657_10172630 3300025919 Bacteria 1751
174 Ga0207657_10707376 3300025919 Bacteria 782
175 Ga0207652_10132383 3300025921 Unclassified 2225
176 Ga0207650_10188136 3300025925 Bacteria 1648
177 Ga0207650_10414658 3300025925 Bacteria 1116
178 Ga0207659_10034419 3300025926 Bacteria 3493
179 Ga0207659_10057317 3300025926 Bacteria 2793
180 Ga0207659_10198833 3300025926 Bacteria 1599
181 Ga0207659_10807232 3300025926 Bacteria 806
182 Ga0207644_10032451 3300025931 Unclassified 3644
183 Ga0207644_10141786 3300025931 Bacteria 1851
184 Ga0207644_10488209 3300025931 Bacteria 1015
185 Ga0207706_10005984 3300025933 Bacteria 11310
186 Ga0207706_10324346 3300025933 Bacteria 1340
187 Ga0207686_10959885 3300025934 Bacteria 692
188 Ga0207670_10015641 3300025936 Bacteria 4539
189 Ga0207670_10668311 3300025936 Bacteria 858
190 Ga0207670_11076580 3300025936 Bacteria 678
191 Ga0207669_11079389 3300025937 Bacteria 677
192 Ga0207691_10191351 3300025940 Bacteria 1784
193 Ga0207691_10771817 3300025940 Bacteria 809
194 Ga0207689_10017735 3300025942 Bacteria 6015
195 Ga0207689_10097747 3300025942 Unclassified 2412
196 Ga0207661_10292923 3300025944 Bacteria 1457
197 Ga0207679_10098689 3300025945 Bacteria 2278
198 Ga0207679_11286822 3300025945 Bacteria 671
199 Ga0207679_11759018 3300025945 Unclassified 567
200 Ga0207667_10048274 3300025949 Bacteria 4502
201 Ga0207651_10073666 3300025960 Bacteria 2429
202 Ga0207651_10324690 3300025960 Unclassified 1288
203 Ga0207712_10124168 3300025961 Unclassified 1958
204 Ga0207712_10795710 3300025961 Unclassified 831
205 Ga0207640_10355507 3300025981 Bacteria 1178
206 Ga0207658_10149323 3300025986 Bacteria 1902
207 Ga0207658_10668419 3300025986 Bacteria 937
208 Ga0207677_10209792 3300026023 Bacteria 1554
209 Ga0207677_11566672 3300026023 Bacteria 609
210 Ga0207677_12135552 3300026023 Bacteria 521
211 Ga0207639_10109249 3300026041 Bacteria 2250
212 Ga0207678_10053309 3300026067 Unclassified 3486
213 Ga0207678_10959439 3300026067 Bacteria 756
214 Ga0207708_10673567 3300026075 Unclassified 882
215 Ga0207641_10401722 3300026088 Bacteria 1316
216 Ga0207648_10076456 3300026089 Bacteria 2918
217 Ga0207648_10160572 3300026089 Unclassified 1985
218 Ga0207648_10670923 3300026089 Bacteria 959
219 Ga0207676_10403919 3300026095 Bacteria 1277
220 Ga0207676_12519467 3300026095 Unclassified 511
221 Ga0207674_10325664 3300026116 Bacteria 1486
222 Ga0207675_100721699 3300026118 Bacteria 1007
223 Ga0207683_10209917 3300026121 Bacteria 1772
224 Ga0207698_10297036 3300026142 Bacteria 1502
225 Ga0207698_10416918 3300026142 Bacteria 1287
226 Ga0207698_10496706 3300026142 Bacteria 1187
227 Ga0207698_11011914 3300026142 Bacteria 842
228 Ga0268266_10115916 3300028379 Bacteria 2379
229 Ga0268266_10770380 3300028379 Bacteria 929
230 Ga0268265_10000398 3300028380 Bacteria 46539
231 Ga0268264_10178689 3300028381 Bacteria 1926
232 Ga0307516_10707166 3300031730 Bacteria 665
233 Ga0307405_11978869 3300031731 Bacteria 521
234 Ga0307414_10191807 3300032004 Bacteria 1654
235 Ga0307414_10309123 3300032004 Bacteria 1341
236 Ga0307414_12073100 3300032004 Unclassified 531
237 Ga0307414_12165457 3300032004 Bacteria 519
238 Ga0307415_100706047 3300032126 Bacteria 911
239 Ga0373941_0421648 3300035115 Bacteria 555
240 Ga0373931_1159239 3300035691 Bacteria 528
241 Ga0395899_0001970 3300037312 Bacteria 16881
242 Ga0395899_0077008 3300037312 Bacteria 2433
243 Ga0395900_0003580 3300037418 Bacteria 16703
244 Ga0395900_0062868 3300037418 Unclassified 3815
245 Ga0395898_0003083 3300037466 Bacteria 18860
246 Ga0395905_0563342 3300037471 Unclassified 1041
247 Ga0395901_0002601 3300038443 Bacteria 18282
248 Ga0395901_0006670 3300038443 Bacteria 11668
249 Ga0439439_0064326 3300041406 Bacteria 977
250 Ga0451807_1426141 3300041486 Bacteria 996
251 Ga0451847_0226367 3300041503 Bacteria 630
252 Ga0439431_0237875 3300041997 Bacteria 538
253 Ga0439462_0042753 3300042015 Bacteria 1211
254 Ga0439446_0169760 3300042156 Unclassified 725
255 Ga0495650_0000003 3300046471 Bacteria 900730
256 Ga0495585_0000079 3300046492 Bacteria 100159
257 Ga0495606_0000163 3300046507 Bacteria 117268
258 Ga0495610_0001356 3300046512 Bacteria 21738
259 Ga0495631_0018542 3300046518 Bacteria 3274
260 Ga0495632_0161968 3300046519 Bacteria 1030
261 Ga0495637_0142008 3300046520 Bacteria 910
262 Ga0495661_0004265 3300046665 Bacteria 10395
263 Ga0495669_0176580 3300046684 Bacteria 1017
264 Ga0495671_0024300 3300046692 Bacteria 3157
265 Ga0495649_0074967 3300046694 Bacteria 1812
266 Ga0495581_0503819 3300047315 Bacteria 704
267 Ga0495674_0166786 3300047319 Bacteria 1840
268 Ga0495683_0070890 3300047323 Bacteria 1711
269 Ga0495687_002471 3300047443 Bacteria 14756
270 Ga0495686_0105252 3300047472 Unclassified 1698
271 Ga0495686_0371733 3300047472 Unclassified 773
272 Ga0496109_0235028 3300048912 Bacteria 1725
273 Ga0496110_0096794 3300048913 Unclassified 2645
274 Ga0496110_0174473 3300048913 Bacteria 1951
275 Ga0496112_0514623 3300048915 Bacteria 1132
276 Ga0501230_083905 3300049667 Unclassified 670
277 Ga0501250_039676 3300049680 Unclassified 686
278 Ga0501253_084280 3300049683 Unclassified 722
279 Ga0501259_015517 3300049688 Bacteria 1302
280 Ga0501225_0000405 3300049705 Bacteria 13566
281 nmdc:mga0k408_106746_c1 3300050493 Bacteria 1654
282 nmdc:mga0k408_142853_c1 3300050493 Bacteria 1424
283 nmdc:mga09592_559608_c1 3300050508 Bacteria 982
284 nmdc:mga08y16_43447_c1 3300050511 Bacteria 4709
285 nmdc:mga08y16_821473_c1 3300050511 Bacteria 921
286 Ga0500583_0000226 3300053092 Bacteria 20632
287 Ga0500583_0001989 3300053092 Bacteria 6012
288 Ga0500588_0010616 3300053146 Unclassified 2231
289 Ga0500616_0134524 3300053153 Bacteria 1164
290 Ga0500622_0140908 3300053156 Bacteria 1150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_1426141 Ga0451807_1426141_148_438 91
2 3300005354 Ga0070675_100094830 Ga0070675_1000948304 92
3 3300005364 Ga0070673_100849099 Ga0070673_1008490992 92
4 3300005459 Ga0068867_100363914 Ga0068867_1003639142 92
5 3300014325 Ga0163163_10097488 Ga0163163_100974884 92
6 3300025926 Ga0207659_10057317 Ga0207659_100573173 92
7 3300047472 Ga0495686_0371733 Ga0495686_0371733_360_641 92
8 iso_pu_bacteria 2929154850 2929159130 93
9 3300042156 Ga0439446_0169760 Ga0439446_0169760_278_574 98
10 3300026067 Ga0207678_10959439 Ga0207678_109594392 100
11 3300025945 Ga0207679_11759018 Ga0207679_117590182 102
12 3300026075 Ga0207708_10673567 Ga0207708_106735672 102
13 3300035115 Ga0373941_0421648 Ga0373941_0421648_205_534 102
14 3300053146 Ga0500588_0010616 Ga0500588_0010616_1839_2147 102
15 iso_pu_bacteria 2738541278 2738726696 102
16 iso_pu_bacteria 2896109856 2896111047 102
17 3300003693 Ga0032354_1127704 Ga0032354_11277041 103
18 3300005290 Ga0065712_10095010 Ga0065712_100950103 103
19 3300005329 Ga0070683_100347248 Ga0070683_1003472482 103
20 3300005330 Ga0070690_100283310 Ga0070690_1002833102 103
21 3300005330 Ga0070690_101036435 Ga0070690_1010364352 103
22 3300005331 Ga0070670_100426680 Ga0070670_1004266802 103
23 3300005334 Ga0068869_100005451 Ga0068869_1000054512 103
24 3300005335 Ga0070666_10038196 Ga0070666_100381962 103
25 3300005335 Ga0070666_10039907 Ga0070666_100399074 103
26 3300005338 Ga0068868_100015976 Ga0068868_1000159762 103
27 3300005338 Ga0068868_100079516 Ga0068868_1000795163 103
28 3300005338 Ga0068868_100101837 Ga0068868_1001018373 103
29 3300005338 Ga0068868_100312573 Ga0068868_1003125733 103
30 3300005340 Ga0070689_100091335 Ga0070689_1000913353 103
31 3300005340 Ga0070689_100172712 Ga0070689_1001727122 103
32 3300005340 Ga0070689_100747719 Ga0070689_1007477192 103
33 3300005340 Ga0070689_101301346 Ga0070689_1013013461 103
34 3300005354 Ga0070675_100119229 Ga0070675_1001192293 103
35 3300005354 Ga0070675_100370561 Ga0070675_1003705613 103
36 3300005355 Ga0070671_100105319 Ga0070671_1001053192 103
37 3300005355 Ga0070671_101697396 Ga0070671_1016973961 103
38 3300005364 Ga0070673_100102294 Ga0070673_1001022943 103
39 3300005365 Ga0070688_100072315 Ga0070688_1000723152 103
40 3300005365 Ga0070688_100103919 Ga0070688_1001039192 103
41 3300005438 Ga0070701_10601862 Ga0070701_106018622 103
42 3300005455 Ga0070663_101715342 Ga0070663_1017153422 103
43 3300005455 Ga0070663_102014245 Ga0070663_1020142452 103
44 3300005456 Ga0070678_100394182 Ga0070678_1003941822 103
45 3300005456 Ga0070678_100890598 Ga0070678_1008905982 103
46 3300005457 Ga0070662_100008286 Ga0070662_1000082863 103
47 3300005457 Ga0070662_100013573 Ga0070662_1000135734 103
48 3300005459 Ga0068867_100073299 Ga0068867_1000732993 103
49 3300005459 Ga0068867_100809541 Ga0068867_1008095412 103
50 3300005466 Ga0070685_10029651 Ga0070685_100296512 103
51 3300005535 Ga0070684_100001297 Ga0070684_10000129715 103
52 3300005539 Ga0068853_100355774 Ga0068853_1003557742 103
53 3300005543 Ga0070672_100100861 Ga0070672_1001008611 103
54 3300005543 Ga0070672_101722851 Ga0070672_1017228512 103
55 3300005544 Ga0070686_100007741 Ga0070686_1000077412 103
56 3300005544 Ga0070686_100025861 Ga0070686_1000258613 103
57 3300005544 Ga0070686_101877739 Ga0070686_1018777391 103
58 3300005548 Ga0070665_100136948 Ga0070665_1001369483 103
59 3300005564 Ga0070664_100044389 Ga0070664_1000443894 103
60 3300005564 Ga0070664_100121229 Ga0070664_1001212293 103
61 3300005564 Ga0070664_100202869 Ga0070664_1002028692 103
62 3300005577 Ga0068857_100041732 Ga0068857_1000417324 103
63 3300005577 Ga0068857_100042527 Ga0068857_1000425274 103
64 3300005577 Ga0068857_101115735 Ga0068857_1011157352 103
65 3300005578 Ga0068854_100260687 Ga0068854_1002606872 103
66 3300005578 Ga0068854_101977199 Ga0068854_1019771992 103
67 3300005615 Ga0070702_100032042 Ga0070702_1000320423 103
68 3300005615 Ga0070702_101402508 Ga0070702_1014025081 103
69 3300005616 Ga0068852_100178357 Ga0068852_1001783573 103
70 3300005616 Ga0068852_100213706 Ga0068852_1002137062 103
71 3300005616 Ga0068852_100557299 Ga0068852_1005572992 103
72 3300005617 Ga0068859_100117887 Ga0068859_1001178873 103
73 3300005617 Ga0068859_100163581 Ga0068859_1001635812 103
74 3300005617 Ga0068859_100219977 Ga0068859_1002199773 103
75 3300005617 Ga0068859_101238825 Ga0068859_1012388252 103
76 3300005618 Ga0068864_102047894 Ga0068864_1020478942 103
77 3300005719 Ga0068861_100246892 Ga0068861_1002468921 103
78 3300005834 Ga0068851_10097339 Ga0068851_100973392 103
79 3300005841 Ga0068863_100559254 Ga0068863_1005592542 103
80 3300005842 Ga0068858_100030967 Ga0068858_1000309673 103
81 3300005843 Ga0068860_100107466 Ga0068860_1001074662 103
82 3300005844 Ga0068862_100006238 Ga0068862_1000062388 103
83 3300006163 Ga0070715_10046522 Ga0070715_100465222 103
84 3300006237 Ga0097621_100064876 Ga0097621_1000648763 103
85 3300006237 Ga0097621_100314228 Ga0097621_1003142282 103
86 3300006358 Ga0068871_100364610 Ga0068871_1003646103 103
87 3300006881 Ga0068865_100066036 Ga0068865_1000660363 103
88 3300006931 Ga0097620_100117883 Ga0097620_1001178833 103
89 3300006931 Ga0097620_100163584 Ga0097620_1001635842 103
90 3300006931 Ga0097620_100219972 Ga0097620_1002199723 103
91 3300006931 Ga0097620_101238903 Ga0097620_1012389032 103
92 3300009093 Ga0105240_10713268 Ga0105240_107132682 103
93 3300009101 Ga0105247_10131056 Ga0105247_101310561 103
94 3300009176 Ga0105242_10196024 Ga0105242_101960243 103
95 3300009177 Ga0105248_10342979 Ga0105248_103429793 103
96 3300009553 Ga0105249_10077789 Ga0105249_100777893 103
97 3300009553 Ga0105249_10182315 Ga0105249_101823152 103
98 3300009553 Ga0105249_11882617 Ga0105249_118826172 103
99 3300010375 Ga0105239_12651160 Ga0105239_126511602 103
100 3300012482 Ga0157318_1014945 Ga0157318_10149452 103
101 3300012506 Ga0157324_1024611 Ga0157324_10246111 103
102 3300013102 Ga0157371_10367919 Ga0157371_103679192 103
103 3300013296 Ga0157374_10001792 Ga0157374_1000179212 103
104 3300013296 Ga0157374_10002989 Ga0157374_100029894 103
105 3300013296 Ga0157374_10316252 Ga0157374_103162523 103
106 3300013297 Ga0157378_10060099 Ga0157378_100600993 103
107 3300013306 Ga0163162_10030580 Ga0163162_100305804 103
108 3300013306 Ga0163162_10037356 Ga0163162_100373563 103
109 3300013306 Ga0163162_10063766 Ga0163162_100637662 103
110 3300013306 Ga0163162_12231623 Ga0163162_122316232 103
111 3300013306 Ga0163162_13047846 Ga0163162_130478462 103
112 3300013307 Ga0157372_10853802 Ga0157372_108538022 103
113 3300013308 Ga0157375_10120816 Ga0157375_101208162 103
114 3300013308 Ga0157375_10173570 Ga0157375_101735703 103
115 3300013308 Ga0157375_10641200 Ga0157375_106412002 103
116 3300013308 Ga0157375_10808879 Ga0157375_108088791 103
117 3300014325 Ga0163163_10005369 Ga0163163_100053694 103
118 3300014326 Ga0157380_10322421 Ga0157380_103224213 103
119 3300014745 Ga0157377_10039464 Ga0157377_100394643 103
120 3300014745 Ga0157377_10081770 Ga0157377_100817702 103
121 3300014968 Ga0157379_10043612 Ga0157379_100436121 103
122 3300014968 Ga0157379_10127198 Ga0157379_101271982 103
123 3300014968 Ga0157379_10233653 Ga0157379_102336533 103
124 3300014969 Ga0157376_10006975 Ga0157376_100069753 103
125 3300014969 Ga0157376_10052741 Ga0157376_100527414 103
126 3300017792 Ga0163161_10014435 Ga0163161_100144352 103
127 3300017792 Ga0163161_10181277 Ga0163161_101812772 103
128 3300017792 Ga0163161_10251902 Ga0163161_102519022 103
129 3300025899 Ga0207642_11043827 Ga0207642_110438272 103
130 3300025901 Ga0207688_10252077 Ga0207688_102520772 103
131 3300025903 Ga0207680_10123242 Ga0207680_101232422 103
132 3300025903 Ga0207680_10836157 Ga0207680_108361572 103
133 3300025907 Ga0207645_10011978 Ga0207645_100119784 103
134 3300025907 Ga0207645_10378114 Ga0207645_103781142 103
135 3300025911 Ga0207654_10106095 Ga0207654_101060952 103
136 3300025913 Ga0207695_10634084 Ga0207695_106340842 103
137 3300025919 Ga0207657_10707376 Ga0207657_107073761 103
138 3300025925 Ga0207650_10188136 Ga0207650_101881363 103
139 3300025926 Ga0207659_10034419 Ga0207659_100344192 103
140 3300025926 Ga0207659_10807232 Ga0207659_108072322 103
141 3300025931 Ga0207644_10032451 Ga0207644_100324512 103
142 3300025931 Ga0207644_10141786 Ga0207644_101417862 103
143 3300025931 Ga0207644_10488209 Ga0207644_104882092 103
144 3300025933 Ga0207706_10005984 Ga0207706_100059844 103
145 3300025933 Ga0207706_10324346 Ga0207706_103243462 103
146 3300025934 Ga0207686_10959885 Ga0207686_109598852 103
147 3300025936 Ga0207670_10015641 Ga0207670_100156415 103
148 3300025936 Ga0207670_10668311 Ga0207670_106683112 103
149 3300025936 Ga0207670_11076580 Ga0207670_110765802 103
150 3300025937 Ga0207669_11079389 Ga0207669_110793892 103
151 3300025940 Ga0207691_10191351 Ga0207691_101913513 103
152 3300025942 Ga0207689_10017735 Ga0207689_100177352 103
153 3300025942 Ga0207689_10097747 Ga0207689_100977472 103
154 3300025944 Ga0207661_10292923 Ga0207661_102929232 103
155 3300025945 Ga0207679_10098689 Ga0207679_100986892 103
156 3300025945 Ga0207679_11286822 Ga0207679_112868222 103
157 3300025960 Ga0207651_10073666 Ga0207651_100736663 103
158 3300025961 Ga0207712_10124168 Ga0207712_101241683 103
159 3300025961 Ga0207712_10795710 Ga0207712_107957102 103
160 3300025981 Ga0207640_10355507 Ga0207640_103555072 103
161 3300025986 Ga0207658_10149323 Ga0207658_101493233 103
162 3300025986 Ga0207658_10668419 Ga0207658_106684192 103
163 3300026023 Ga0207677_10209792 Ga0207677_102097922 103
164 3300026023 Ga0207677_11566672 Ga0207677_115666721 103
165 3300026023 Ga0207677_12135552 Ga0207677_121355522 103
166 3300026041 Ga0207639_10109249 Ga0207639_101092492 103
167 3300026067 Ga0207678_10053309 Ga0207678_100533092 103
168 3300026088 Ga0207641_10401722 Ga0207641_104017222 103
169 3300026089 Ga0207648_10076456 Ga0207648_100764563 103
170 3300026089 Ga0207648_10160572 Ga0207648_101605722 103
171 3300026089 Ga0207648_10670923 Ga0207648_106709232 103
172 3300026095 Ga0207676_10403919 Ga0207676_104039192 103
173 3300026095 Ga0207676_12519467 Ga0207676_125194672 103
174 3300026116 Ga0207674_10325664 Ga0207674_103256642 103
175 3300026118 Ga0207675_100721699 Ga0207675_1007216992 103
176 3300026121 Ga0207683_10209917 Ga0207683_102099173 103
177 3300026142 Ga0207698_10297036 Ga0207698_102970362 103
178 3300026142 Ga0207698_10496706 Ga0207698_104967061 103
179 3300026142 Ga0207698_11011914 Ga0207698_110119143 103
180 3300028379 Ga0268266_10115916 Ga0268266_101159162 103
181 3300028379 Ga0268266_10770380 Ga0268266_107703802 103
182 3300028380 Ga0268265_10000398 Ga0268265_1000039826 103
183 3300028381 Ga0268264_10178689 Ga0268264_101786893 103
184 3300032004 Ga0307414_12073100 Ga0307414_120731002 103
185 3300032126 Ga0307415_100706047 Ga0307415_1007060471 103
186 3300035691 Ga0373931_1159239 Ga0373931_1159239_22_348 103
187 3300041503 Ga0451847_0226367 Ga0451847_0226367_282_602 103
188 3300047315 Ga0495581_0503819 Ga0495581_0503819_144_455 103
189 3300047319 Ga0495674_0166786 Ga0495674_0166786_455_766 103
190 3300048912 Ga0496109_0235028 Ga0496109_0235028_758_1084 103
191 3300048913 Ga0496110_0096794 Ga0496110_0096794_424_750 103
192 3300048913 Ga0496110_0174473 Ga0496110_0174473_605_931 103
193 3300048915 Ga0496112_0514623 Ga0496112_0514623_714_1040 103
194 3300050511 nmdc:mga08y16_821473_c1 nmdc:mga08y16_821473_c1_476_787 103
195 3300005336 Ga0070680_100335979 Ga0070680_1003359793 104
196 3300005339 Ga0070660_100175203 Ga0070660_1001752033 104
197 3300013307 Ga0157372_10465825 Ga0157372_104658252 104
198 3300025917 Ga0207660_10269476 Ga0207660_102694763 104
199 3300025919 Ga0207657_10172630 Ga0207657_101726302 104
200 3300049680 Ga0501250_039676 Ga0501250_039676_130_444 104
201 3300049683 Ga0501253_084280 Ga0501253_084280_59_373 104
202 3300049688 Ga0501259_015517 Ga0501259_015517_181_495 104
203 3300005345 Ga0070692_10024267 Ga0070692_100242673 105
204 3300013102 Ga0157371_10287407 Ga0157371_102874072 105
205 3300037312 Ga0395899_0001970 Ga0395899_0001970_15003_15320 105
206 3300037418 Ga0395900_0003580 Ga0395900_0003580_12368_12685 105
207 3300037466 Ga0395898_0003083 Ga0395898_0003083_13800_14117 105
208 3300038443 Ga0395901_0006670 Ga0395901_0006670_8218_8535 105
209 3300041406 Ga0439439_0064326 Ga0439439_0064326_334_651 105
210 3300042015 Ga0439462_0042753 Ga0439462_0042753_241_558 105
211 3300003316 rootH1_10044094 rootH1_100440942 106
212 3300003320 rootH2_10287560 rootH2_102875603 106
213 3300003322 rootL2_10168466 rootL2_101684662 106
214 3300003323 rootH1_10390741 rootH1_103907412 106
215 3300005290 Ga0065712_10411094 Ga0065712_104110942 106
216 3300005336 Ga0070680_100169367 Ga0070680_1001693673 106
217 3300005458 Ga0070681_10773412 Ga0070681_107734121 106
218 3300005467 Ga0070706_101650701 Ga0070706_1016507011 106
219 3300005530 Ga0070679_100037930 Ga0070679_1000379302 106
220 3300005539 Ga0068853_100198686 Ga0068853_1001986862 106
221 3300005563 Ga0068855_100048415 Ga0068855_1000484155 106
222 3300006195 Ga0075366_10086528 Ga0075366_100865283 106
223 3300006195 Ga0075366_10714810 Ga0075366_107148102 106
224 3300009093 Ga0105240_10000011 Ga0105240_10000011278 106
225 3300009545 Ga0105237_10195069 Ga0105237_101950692 106
226 3300010375 Ga0105239_10000052 Ga0105239_1000005228 106
227 3300010375 Ga0105239_10000059 Ga0105239_1000005912 106
228 3300013102 Ga0157371_10002684 Ga0157371_100026844 106
229 3300013104 Ga0157370_10009205 Ga0157370_100092055 106
230 3300013307 Ga0157372_10031587 Ga0157372_100315872 106
231 3300025909 Ga0207705_10463756 Ga0207705_104637562 106
232 3300025910 Ga0207684_11015203 Ga0207684_110152032 106
233 3300025913 Ga0207695_10000010 Ga0207695_10000010668 106
234 3300025917 Ga0207660_10061848 Ga0207660_100618483 106
235 3300025921 Ga0207652_10132383 Ga0207652_101323832 106
236 3300025949 Ga0207667_10048274 Ga0207667_100482744 106
237 3300031730 Ga0307516_10707166 Ga0307516_107071662 106
238 3300031731 Ga0307405_11978869 Ga0307405_119788692 106
239 3300037312 Ga0395899_0077008 Ga0395899_0077008_1009_1338 106
240 3300037418 Ga0395900_0062868 Ga0395900_0062868_546_875 106
241 3300037471 Ga0395905_0563342 Ga0395905_0563342_251_580 106
242 3300038443 Ga0395901_0002601 Ga0395901_0002601_11728_12057 106
243 3300046519 Ga0495632_0161968 Ga0495632_0161968_525_845 106
244 3300046694 Ga0495649_0074967 Ga0495649_0074967_139_459 106
245 3300047472 Ga0495686_0105252 Ga0495686_0105252_988_1311 106
246 3300049667 Ga0501230_083905 Ga0501230_083905_157_477 106
247 3300049705 Ga0501225_0000405 Ga0501225_0000405_5485_5805 106
248 3300050493 nmdc:mga0k408_106746_c1 nmdc:mga0k408_106746_c1_652_972 106
249 3300050493 nmdc:mga0k408_142853_c1 nmdc:mga0k408_142853_c1_934_1254 106
250 3300053092 Ga0500583_0000226 Ga0500583_0000226_11094_11414 106
251 3300053092 Ga0500583_0001989 Ga0500583_0001989_4344_4664 106
252 3300053153 Ga0500616_0134524 Ga0500616_0134524_150_470 106
253 3300053156 Ga0500622_0140908 Ga0500622_0140908_440_760 106
254 3300005356 Ga0070674_100048242 Ga0070674_1000482422 107
255 3300009094 Ga0111539_10184108 Ga0111539_101841083 107
256 3300009176 Ga0105242_10657722 Ga0105242_106577221 107
257 3300012495 Ga0157323_1052174 Ga0157323_10521742 107
258 3300013102 Ga0157371_10261392 Ga0157371_102613923 107
259 3300013307 Ga0157372_10058237 Ga0157372_100582372 107
260 3300046684 Ga0495669_0176580 Ga0495669_0176580_241_564 107
261 3300050508 nmdc:mga09592_559608_c1 nmdc:mga09592_559608_c1_336_659 107
262 3300050511 nmdc:mga08y16_43447_c1 nmdc:mga08y16_43447_c1_1572_1895 107
263 2162886011 MRS1b_contig_4113148 MRS1b_0977.00001530 108
264 3300005290 Ga0065712_10013783 Ga0065712_100137832 108
265 3300005331 Ga0070670_100641695 Ga0070670_1006416951 108
266 3300005354 Ga0070675_100042595 Ga0070675_1000425953 108
267 3300005356 Ga0070674_101071656 Ga0070674_1010716562 108
268 3300005365 Ga0070688_101410708 Ga0070688_1014107081 108
269 3300005543 Ga0070672_100518196 Ga0070672_1005181963 108
270 3300005544 Ga0070686_101890909 Ga0070686_1018909091 108
271 3300013102 Ga0157371_10839898 Ga0157371_108398982 108
272 3300013307 Ga0157372_10060007 Ga0157372_100600076 108
273 3300014325 Ga0163163_10854030 Ga0163163_108540303 108
274 3300014326 Ga0157380_10272582 Ga0157380_102725823 108
275 3300025925 Ga0207650_10414658 Ga0207650_104146582 108
276 3300025926 Ga0207659_10198833 Ga0207659_101988332 108
277 3300025940 Ga0207691_10771817 Ga0207691_107718172 108
278 3300025960 Ga0207651_10324690 Ga0207651_103246902 108
279 3300026142 Ga0207698_10416918 Ga0207698_104169182 108
280 3300032004 Ga0307414_10191807 Ga0307414_101918072 108
281 3300032004 Ga0307414_10309123 Ga0307414_103091233 108
282 3300032004 Ga0307414_12165457 Ga0307414_121654572 108
283 3300041997 Ga0439431_0237875 Ga0439431_0237875_194_520 108
284 3300046471 Ga0495650_0000003 Ga0495650_0000003_674282_674617 108
285 3300046492 Ga0495585_0000079 Ga0495585_0000079_65861_66196 108
286 3300046507 Ga0495606_0000163 Ga0495606_0000163_39531_39866 108
287 3300046512 Ga0495610_0001356 Ga0495610_0001356_14298_14633 108
288 3300046518 Ga0495631_0018542 Ga0495631_0018542_886_1221 108
289 3300046520 Ga0495637_0142008 Ga0495637_0142008_108_443 108
290 3300046665 Ga0495661_0004265 Ga0495661_0004265_9116_9451 108
291 3300046692 Ga0495671_0024300 Ga0495671_0024300_179_514 108
292 3300047323 Ga0495683_0070890 Ga0495683_0070890_232_567 108
293 3300047443 Ga0495687_002471 Ga0495687_002471_3824_4159 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

20

101

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.9556 21 107
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.915 21 107
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.8973 22 108
8fwj-assembly1.cif.gz_M structure of dodecameric kaic-rs-s413e/s414e complexed with kaib-rs solved by cryo-em 0.8923 23 104
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.8697 22 108
ID Description Score Start End Superfamily
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9552 21 104 3.40.30.10
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9033 21 104 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8724 22 108 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8547 22 108 3.40.30.10
5jwqD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8507 24 108 3.40.30.10
ID Description Score Start End GO Terms
AF-B7KA51-F1-model_v4 KaiB domain protein 0.9759 21 108 GO:0048511
AF-A0A0D6AI59-F1-model_v4 Circadian oscillation regulator KaiB 0.9744 21 107 GO:0048511
AF-A0A0Q4XA40-F1-model_v4 Circadian clock protein KaiB 0.9731 21 106 GO:0048511
AF-A0A2W1JVC4-F1-model_v4 Circadian clock protein KaiB 0.9726 21 107 GO:0048511
AF-A0A212R8A1-F1-model_v4 Circadian clock protein KaiB 0.9724 21 107 GO:0048511

Feature Viewer

pLDDT pTM Quality
82.89 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map