F391390

General Info

Members Datasets Scaffolds Average Seq Length
293 187 586 328

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100058275|Ga0070698_1000582751
Length 303
Sequence MLSLKKKSDDLAVLLEWSDAGEMVDAEFEHAIAALDREVEAGEIKKMLGGEHDRKNAIVTIHPGAGGTESQDWAEMLLRMYLRWMERRGFKPEIIDYQPGDEAGLKSVTLTVAGEYAYGLLSAEAGVHRLVRISPFDQAARRHTSFASVYVWPELSEDIKDLRIDTYRSSGAGGQHVNVTDSAVRLTHLPTGIVVSCQNERSQHRNRDSAMKVLKSRLYDLRLKEQQARLDSIRGVKKDIAFGNQIRSYVLHPYQLVKDHRTKEQVGDINRVLDGDIDGFIKTFLMRKSSGTLGEVPVDDDAE

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
113 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 3.41
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100058275 3300005471 Bacteria 3905
2 Ga0065712_10159531 3300005290 Bacteria 1312
3 Ga0070658_10306470 3300005327 Bacteria 1355
4 Ga0070676_10073430 3300005328 Bacteria 2058
5 Ga0068869_100056741 3300005334 Bacteria 2857
6 Ga0068869_100090306 3300005334 Bacteria 2302
7 Ga0070666_10114809 3300005335 Bacteria 1864
8 Ga0070669_100015331 3300005353 Bacteria 5461
9 Ga0070675_100000002 3300005354 Bacteria 435215
10 Ga0070675_100073512 3300005354 Bacteria 2838
11 Ga0070675_100188156 3300005354 Bacteria 1788
12 Ga0070675_100276551 3300005354 Bacteria 1475
13 Ga0070674_100000436 3300005356 Bacteria 21015
14 Ga0070667_100090023 3300005367 Bacteria 2636
15 Ga0070714_100012482 3300005435 Bacteria 6784
16 Ga0070701_10005458 3300005438 Bacteria 5256
17 Ga0070705_100026804 3300005440 Bacteria 3140
18 Ga0070705_100060361 3300005440 Bacteria 2249
19 Ga0070694_100030039 3300005444 Bacteria 3551
20 Ga0070694_100071068 3300005444 Bacteria 2398
21 Ga0070708_100025282 3300005445 Bacteria 5075
22 Ga0070678_100199309 3300005456 Bacteria 1651
23 Ga0070681_10055440 3300005458 Bacteria 3946
24 Ga0068867_100007694 3300005459 Bacteria 7622
25 Ga0070698_100049636 3300005471 Bacteria 4282
26 Ga0070698_100183398 3300005471 Bacteria 2031
27 Ga0070698_100264478 3300005471 Bacteria 1652
28 Ga0070699_100008257 3300005518 Bacteria 9031
29 Ga0070699_100411906 3300005518 Bacteria 1223
30 Ga0070679_100181985 3300005530 Bacteria 2074
31 Ga0070697_100047613 3300005536 Bacteria 3476
32 Ga0068853_100201768 3300005539 Bacteria 1810
33 Ga0070672_100020167 3300005543 Bacteria 4857
34 Ga0070686_100109910 3300005544 Bacteria 1876
35 Ga0070686_100281014 3300005544 Bacteria 1228
36 Ga0070696_100148726 3300005546 Bacteria 1717
37 Ga0070665_100005699 3300005548 Bacteria 12790
38 Ga0070665_100007748 3300005548 Bacteria 10901
39 Ga0070665_100066719 3300005548 Bacteria 3610
40 Ga0070704_100022694 3300005549 Bacteria 4087
41 Ga0068855_100150281 3300005563 Bacteria 2648
42 Ga0068854_100033732 3300005578 Bacteria 3570
43 Ga0068856_100117051 3300005614 Bacteria 2666
44 Ga0070702_100019418 3300005615 Bacteria 3544
45 Ga0068859_100144770 3300005617 Bacteria 2451
46 Ga0068859_100415342 3300005617 Bacteria 1442
47 Ga0068864_100004407 3300005618 Bacteria 11565
48 Ga0068861_100002889 3300005719 Bacteria 11319
49 Ga0068861_100011289 3300005719 Bacteria 6203
50 Ga0068861_100040916 3300005719 Bacteria 3469
51 Ga0068861_100243233 3300005719 Bacteria 1531
52 Ga0068870_10103573 3300005840 Bacteria 1613
53 Ga0068863_100058029 3300005841 Bacteria 3663
54 Ga0068858_100004715 3300005842 Bacteria 13353
55 Ga0068858_100075422 3300005842 Bacteria 3132
56 Ga0068858_100465024 3300005842 Bacteria 1220
57 Ga0068860_100067710 3300005843 Bacteria 3392
58 Ga0068860_100240510 3300005843 Bacteria 1761
59 Ga0068860_100275350 3300005843 Bacteria 1643
60 Ga0068862_100261518 3300005844 Bacteria 1580
61 Ga0068862_100288663 3300005844 Bacteria 1506
62 Ga0081455_10106818 3300005937 Bacteria 2232
63 Ga0081539_10014297 3300005985 Bacteria 5884
64 Ga0075367_10001025 3300006178 Bacteria 11508
65 Ga0075366_10002598 3300006195 Bacteria 9282
66 Ga0097621_100019360 3300006237 Bacteria 5222
67 Ga0075370_10017125 3300006353 Bacteria 3911
68 Ga0068871_100000536 3300006358 Bacteria 25860
69 Ga0068871_100014957 3300006358 Bacteria 5802
70 Ga0068871_100107610 3300006358 Bacteria 2342
71 Ga0068871_100251550 3300006358 Bacteria 1539
72 Ga0075431_100045939 3300006847 Bacteria 4502
73 Ga0075433_10170157 3300006852 Bacteria 1939
74 Ga0075434_100035133 3300006871 Bacteria 4954
75 Ga0075434_100165348 3300006871 Bacteria 2232
76 Ga0068865_100151762 3300006881 Bacteria 1758
77 Ga0075436_100011841 3300006914 Bacteria 5984
78 Ga0097620_100144774 3300006931 Bacteria 2451
79 Ga0097620_100241387 3300006931 Bacteria 1896
80 Ga0097620_100415361 3300006931 Bacteria 1442
81 Ga0075435_100002678 3300007076 Bacteria 11891
82 Ga0105240_10384799 3300009093 Bacteria 1583
83 Ga0111539_10007861 3300009094 Bacteria 13616
84 Ga0111539_10011957 3300009094 Bacteria 10883
85 Ga0111539_10100646 3300009094 Bacteria 3393
86 Ga0111539_10193929 3300009094 Bacteria 2370
87 Ga0105247_10049886 3300009101 Bacteria 2575
88 Ga0114129_10000192 3300009147 Bacteria 68551
89 Ga0114129_10001078 3300009147 Bacteria 35880
90 Ga0114129_10011484 3300009147 Bacteria 12609
91 Ga0114129_10011875 3300009147 Bacteria 12387
92 Ga0114129_10036233 3300009147 Bacteria 6967
93 Ga0105243_10014967 3300009148 Bacteria 5872
94 Ga0105243_10032420 3300009148 Bacteria 4037
95 Ga0105241_10429951 3300009174 Bacteria 1164
96 Ga0105242_10000662 3300009176 Bacteria 26974
97 Ga0105242_10004280 3300009176 Bacteria 11124
98 Ga0105242_10019339 3300009176 Bacteria 5335
99 Ga0105242_10094075 3300009176 Bacteria 2527
100 Ga0105242_10201217 3300009176 Bacteria 1769
101 Ga0105242_10262655 3300009176 Bacteria 1560
102 Ga0105248_10005231 3300009177 Bacteria 14296
103 Ga0105248_10060281 3300009177 Bacteria 4260
104 Ga0105248_10065371 3300009177 Bacteria 4084
105 Ga0105248_10144528 3300009177 Bacteria 2684
106 Ga0105248_10258518 3300009177 Bacteria 1960
107 Ga0105248_10512028 3300009177 Bacteria 1353
108 Ga0105237_10268327 3300009545 Bacteria 1710
109 Ga0157374_10003571 3300013296 Bacteria 13092
110 Ga0157372_10323555 3300013307 Bacteria 1795
111 Ga0157375_10011106 3300013308 Bacteria 7942
112 Ga0157375_10031548 3300013308 Bacteria 5011
113 Ga0157375_10426885 3300013308 Bacteria 1491
114 Ga0157380_10185559 3300014326 Bacteria 1831
115 Ga0157380_10225005 3300014326 Bacteria 1681
116 Ga0157380_10285040 3300014326 Bacteria 1513
117 Ga0157379_10080722 3300014968 Bacteria 2914
118 Ga0157379_10267617 3300014968 Bacteria 1554
119 Ga0157376_10207367 3300014969 Bacteria 1807
120 Ga0213876_10003704 3300021384 Bacteria 8669
121 Ga0207642_10017136 3300025899 Bacteria 2748
122 Ga0207680_10058366 3300025903 Bacteria 2339
123 Ga0207645_10064620 3300025907 Bacteria 2338
124 Ga0207645_10112017 3300025907 Bacteria 1767
125 Ga0207643_10048162 3300025908 Bacteria 2414
126 Ga0207705_10113852 3300025909 Bacteria 2000
127 Ga0207695_10073142 3300025913 Bacteria 3494
128 Ga0207660_10103094 3300025917 Bacteria 2134
129 Ga0207662_10053093 3300025918 Bacteria 2413
130 Ga0207657_10008780 3300025919 Bacteria 10228
131 Ga0207681_10024009 3300025923 Bacteria 3907
132 Ga0207681_10070133 3300025923 Bacteria 2440
133 Ga0207681_10208130 3300025923 Bacteria 1506
134 Ga0207659_10000005 3300025926 Bacteria 405839
135 Ga0207659_10000250 3300025926 Bacteria 32723
136 Ga0207659_10013661 3300025926 Bacteria 5210
137 Ga0207659_10021745 3300025926 Bacteria 4264
138 Ga0207659_10025840 3300025926 Bacteria 3953
139 Ga0207687_10010844 3300025927 Bacteria 5957
140 Ga0207700_10014619 3300025928 Bacteria 5149
141 Ga0207644_10006107 3300025931 Bacteria 7854
142 Ga0207686_10028700 3300025934 Bacteria 3274
143 Ga0207686_10063601 3300025934 Bacteria 2347
144 Ga0207709_10013248 3300025935 Bacteria 4548
145 Ga0207709_10076843 3300025935 Bacteria 2138
146 Ga0207670_10080072 3300025936 Bacteria 2282
147 Ga0207669_10062188 3300025937 Bacteria 2298
148 Ga0207669_10175009 3300025937 Bacteria 1532
149 Ga0207704_10094660 3300025938 Bacteria 1973
150 Ga0207711_10060442 3300025941 Bacteria 3266
151 Ga0207711_10303961 3300025941 Bacteria 1472
152 Ga0207711_10318943 3300025941 Bacteria 1436
153 Ga0207711_10405051 3300025941 Bacteria 1268
154 Ga0207689_10062717 3300025942 Bacteria 3057
155 Ga0207689_10093396 3300025942 Bacteria 2471
156 Ga0207651_10009020 3300025960 Bacteria 5425
157 Ga0207651_10036277 3300025960 Bacteria 3217
158 Ga0207668_10055790 3300025972 Bacteria 2748
159 Ga0207668_10105667 3300025972 Bacteria 2102
160 Ga0207640_10006620 3300025981 Bacteria 6367
161 Ga0207677_10195321 3300026023 Bacteria 1604
162 Ga0207677_10307137 3300026023 Bacteria 1313
163 Ga0207708_10011554 3300026075 Bacteria 6579
164 Ga0207702_10467171 3300026078 Bacteria 1226
165 Ga0207641_10007217 3300026088 Bacteria 9261
166 Ga0207648_10005742 3300026089 Bacteria 12439
167 Ga0207648_10107379 3300026089 Bacteria 2450
168 Ga0207676_10118122 3300026095 Bacteria 2231
169 Ga0207676_10150041 3300026095 Bacteria 2007
170 Ga0207676_10343999 3300026095 Bacteria 1377
171 Ga0207676_10497275 3300026095 Bacteria 1157
172 Ga0207675_100012084 3300026118 Bacteria 8067
173 Ga0207675_100015354 3300026118 Bacteria 7144
174 Ga0207675_100063703 3300026118 Bacteria 3445
175 Ga0207675_100467321 3300026118 Bacteria 1252
176 Ga0207683_10016887 3300026121 Bacteria 6210
177 Ga0207683_10204571 3300026121 Bacteria 1795
178 Ga0207698_10420998 3300026142 Bacteria 1282
179 Ga0209971_1019854 3300027682 Bacteria 1596
180 Ga0207428_10015348 3300027907 Bacteria 6628
181 Ga0207428_10098133 3300027907 Bacteria 2267
182 Ga0207428_10135959 3300027907 Bacteria 1879
183 Ga0268266_10006779 3300028379 Bacteria 10440
184 Ga0268266_10023090 3300028379 Bacteria 5294
185 Ga0268265_10004330 3300028380 Bacteria 9888
186 Ga0268265_10346226 3300028380 Bacteria 1355
187 Ga0268264_10011674 3300028381 Bacteria 7245
188 Ga0307408_100097918 3300031548 Bacteria 2229
189 Ga0265314_10134793 3300031711 Bacteria 1535
190 Ga0307416_100111122 3300032002 Bacteria 2415
191 Ga0307411_10083647 3300032005 Bacteria 2205
192 Ga0373930_0003212 3300034816 Bacteria 2583
193 Ga0373948_0009498 3300034817 Bacteria 1678
194 Ga0373938_0003346 3300034957 Bacteria 2623
195 Ga0373929_0000161 3300035085 Bacteria 11652
196 Ga0373949_0001358 3300035090 Bacteria 7048
197 Ga0373932_0007288 3300035112 Bacteria 2632
198 Ga0373939_0002128 3300035114 Bacteria 4714
199 Ga0373941_0001039 3300035115 Bacteria 5775
200 Ga0373956_0049809 3300035119 Bacteria 1879
201 Ga0373943_0004777 3300035170 Bacteria 6124
202 Ga0373942_0000021 3300035207 Bacteria 30804
203 Ga0373961_0003318 3300035241 Bacteria 4000
204 Ga0373931_0001288 3300035691 Bacteria 10722
205 Ga0373937_0139437 3300036401 Bacteria 2268
206 Ga0436365_0140503 3300039437 Bacteria 8669
207 Ga0439435_0052982 3300042436 Bacteria 1165
208 Ga0451577_0146294 3300042876 Bacteria 2125
209 Ga0453684_0301526 3300044712 Bacteria 1821
210 Ga0451576_0263026 3300045051 Bacteria 1803
211 Ga0495580_0114144 3300046472 Bacteria 1876
212 Ga0495580_0123542 3300046472 Bacteria 1797
213 Ga0495628_0037456 3300046516 Bacteria 3889
214 Ga0495628_0068017 3300046516 Bacteria 2780
215 Ga0495667_0086903 3300046559 Bacteria 2028
216 Ga0495656_0078636 3300046615 Bacteria 1483
217 Ga0495599_0117892 3300046678 Bacteria 1651
218 Ga0495647_0007971 3300046681 Bacteria 3560
219 Ga0495658_0040379 3300046683 Bacteria 2594
220 Ga0495672_0064976 3300047320 Bacteria 2087
221 Ga0495684_0071706 3300047471 Bacteria 2632
222 Ga0496102_0419732 3300048905 Bacteria 1257
223 Ga0496104_0039943 3300048907 Bacteria 4396
224 Ga0496106_0102946 3300048909 Bacteria 2215
225 Ga0496109_0219213 3300048912 Bacteria 1789
226 Ga0496112_0036731 3300048915 Bacteria 4780
227 Ga0496112_0449499 3300048915 Bacteria 1226
228 Ga0496113_0070913 3300048916 Bacteria 2650
229 Ga0496113_0307916 3300048916 Bacteria 1269
230 Ga0496114_0039743 3300048917 Bacteria 3893
231 Ga0496114_0115699 3300048917 Bacteria 2301
232 Ga0501032_0048754 3300049569 Bacteria 2859
233 Ga0501033_0016563 3300049570 Bacteria 5577
234 Ga0501036_0007074 3300049572 Bacteria 9128
235 Ga0501036_0027418 3300049572 Bacteria 4813
236 Ga0501037_0013896 3300049573 Bacteria 5932
237 Ga0501038_0010612 3300049574 Bacteria 8420
238 Ga0501038_0018679 3300049574 Bacteria 6260
239 Ga0501039_0017528 3300049575 Bacteria 5493
240 Ga0501040_0005148 3300049576 Bacteria 8458
241 Ga0501041_0001817 3300049577 Bacteria 11963
242 Ga0501042_0001003 3300049578 Bacteria 16037
243 Ga0501043_0224999 3300049579 Bacteria 1450
244 Ga0501046_0045153 3300049580 Bacteria 3501
245 Ga0501046_0087083 3300049580 Bacteria 2407
246 Ga0501047_0001185 3300049581 Bacteria 25820
247 Ga0501048_0004858 3300049582 Bacteria 10248
248 Ga0501048_0028827 3300049582 Bacteria 4029
249 Ga0501067_0000172 3300049583 Bacteria 36346
250 Ga0501069_0000114 3300049585 Bacteria 36063
251 Ga0501071_0002044 3300049587 Bacteria 12076
252 Ga0501071_0028554 3300049587 Bacteria 3933
253 Ga0501072_0290394 3300049588 Bacteria 1300
254 Ga0501073_0000590 3300049589 Bacteria 25627
255 Ga0501073_0001281 3300049589 Bacteria 18456
256 Ga0501074_0007391 3300049590 Bacteria 7946
257 Ga0501075_0000613 3300049591 Bacteria 21822
258 Ga0501076_0035722 3300049592 Bacteria 3888
259 Ga0501079_0004498 3300049741 Bacteria 10344
260 Ga0501081_0003667 3300049743 Bacteria 9829
261 Ga0501083_0081676 3300049744 Bacteria 2142
262 Ga0501044_0062423 3300049823 Bacteria 3808
263 Ga0501045_0001473 3300049824 Bacteria 15651
264 Ga0501045_0057857 3300049824 Bacteria 2837
265 nmdc:mga00v17_22429_c1 3300050491 Bacteria 3642
266 nmdc:mga0k408_15623_c1 3300050493 Bacteria 4200
267 nmdc:mga05p37_14261_c1 3300050507 Bacteria 9543
268 nmdc:mga05p37_16728_c1 3300050507 Bacteria 8841
269 nmdc:mga05p37_18959_c1 3300050507 Bacteria 8320
270 nmdc:mga05p37_202930_c1 3300050507 Bacteria 2400
271 nmdc:mga05p37_207428_c1 3300050507 Bacteria 2370
272 nmdc:mga05p37_25310_c1 3300050507 Bacteria 7218
273 nmdc:mga09592_146322_c1 3300050508 Bacteria 2037
274 nmdc:mga06r32_42043_c1 3300050510 Bacteria 4344
275 nmdc:mga06r32_46877_c1 3300050510 Bacteria 4125
276 nmdc:mga08y16_285285_c1 3300050511 Bacteria 1702
277 nmdc:mga08y16_3605_c1 3300050511 Bacteria 16075
278 nmdc:mga08y16_55197_c1 3300050511 Bacteria 4152
279 nmdc:mga08y16_5939_c1 3300050511 Bacteria 12799
280 nmdc:mga0n895_38851_c1 3300050512 Bacteria 4614
281 nmdc:mga0n895_5669_c1 3300050512 Bacteria 10464
282 nmdc:mga0rr50_1949_c1 3300050513 Bacteria 11453
283 nmdc:mga0a205_102643_c1 3300050515 Bacteria 2758
284 nmdc:mga0a205_23821_c1 3300050515 Bacteria 5809
285 nmdc:mga0a205_241002_c1 3300050515 Bacteria 1689
286 nmdc:mga0a205_49638_c1 3300050515 Bacteria 4051
287 Ga0500568_0011916 3300053139 Bacteria 4012
288 Ga0500616_0025772 3300053153 Bacteria 3260
289 Ga0500599_002834 3300053736 Bacteria 2099
290 Ga0501084_0051389 3300054114 Bacteria 3449
291 Ga0501082_0001188 3300060353 Bacteria 22878
292 Ga0501082_0003658 3300060353 Bacteria 13429
293 Ga0530510_0002964 3300061734 Bacteria 11645
294 Ga0070698_100058275
295 Ga0065712_10159531
296 Ga0070658_10306470
297 Ga0070676_10073430
298 Ga0068869_100056741
299 Ga0068869_100090306
300 Ga0070666_10114809
301 Ga0070669_100015331
302 Ga0070675_100000002
303 Ga0070675_100073512
304 Ga0070675_100188156
305 Ga0070675_100276551
306 Ga0070674_100000436
307 Ga0070667_100090023
308 Ga0070714_100012482
309 Ga0070701_10005458
310 Ga0070705_100026804
311 Ga0070705_100060361
312 Ga0070694_100030039
313 Ga0070694_100071068
314 Ga0070708_100025282
315 Ga0070678_100199309
316 Ga0070681_10055440
317 Ga0068867_100007694
318 Ga0070698_100049636
319 Ga0070698_100183398
320 Ga0070698_100264478
321 Ga0070699_100008257
322 Ga0070699_100411906
323 Ga0070679_100181985
324 Ga0070697_100047613
325 Ga0068853_100201768
326 Ga0070672_100020167
327 Ga0070686_100109910
328 Ga0070686_100281014
329 Ga0070696_100148726
330 Ga0070665_100005699
331 Ga0070665_100007748
332 Ga0070665_100066719
333 Ga0070704_100022694
334 Ga0068855_100150281
335 Ga0068854_100033732
336 Ga0068856_100117051
337 Ga0070702_100019418
338 Ga0068859_100144770
339 Ga0068859_100415342
340 Ga0068864_100004407
341 Ga0068861_100002889
342 Ga0068861_100011289
343 Ga0068861_100040916
344 Ga0068861_100243233
345 Ga0068870_10103573
346 Ga0068863_100058029
347 Ga0068858_100004715
348 Ga0068858_100075422
349 Ga0068858_100465024
350 Ga0068860_100067710
351 Ga0068860_100240510
352 Ga0068860_100275350
353 Ga0068862_100261518
354 Ga0068862_100288663
355 Ga0081455_10106818
356 Ga0081539_10014297
357 Ga0075367_10001025
358 Ga0075366_10002598
359 Ga0097621_100019360
360 Ga0075370_10017125
361 Ga0068871_100000536
362 Ga0068871_100014957
363 Ga0068871_100107610
364 Ga0068871_100251550
365 Ga0075431_100045939
366 Ga0075433_10170157
367 Ga0075434_100035133
368 Ga0075434_100165348
369 Ga0068865_100151762
370 Ga0075436_100011841
371 Ga0097620_100144774
372 Ga0097620_100241387
373 Ga0097620_100415361
374 Ga0075435_100002678
375 Ga0105240_10384799
376 Ga0111539_10007861
377 Ga0111539_10011957
378 Ga0111539_10100646
379 Ga0111539_10193929
380 Ga0105247_10049886
381 Ga0114129_10000192
382 Ga0114129_10001078
383 Ga0114129_10011484
384 Ga0114129_10011875
385 Ga0114129_10036233
386 Ga0105243_10014967
387 Ga0105243_10032420
388 Ga0105241_10429951
389 Ga0105242_10000662
390 Ga0105242_10004280
391 Ga0105242_10019339
392 Ga0105242_10094075
393 Ga0105242_10201217
394 Ga0105242_10262655
395 Ga0105248_10005231
396 Ga0105248_10060281
397 Ga0105248_10065371
398 Ga0105248_10144528
399 Ga0105248_10258518
400 Ga0105248_10512028
401 Ga0105237_10268327
402 Ga0157374_10003571
403 Ga0157372_10323555
404 Ga0157375_10011106
405 Ga0157375_10031548
406 Ga0157375_10426885
407 Ga0157380_10185559
408 Ga0157380_10225005
409 Ga0157380_10285040
410 Ga0157379_10080722
411 Ga0157379_10267617
412 Ga0157376_10207367
413 Ga0213876_10003704
414 Ga0207642_10017136
415 Ga0207680_10058366
416 Ga0207645_10064620
417 Ga0207645_10112017
418 Ga0207643_10048162
419 Ga0207705_10113852
420 Ga0207695_10073142
421 Ga0207660_10103094
422 Ga0207662_10053093
423 Ga0207657_10008780
424 Ga0207681_10024009
425 Ga0207681_10070133
426 Ga0207681_10208130
427 Ga0207659_10000005
428 Ga0207659_10000250
429 Ga0207659_10013661
430 Ga0207659_10021745
431 Ga0207659_10025840
432 Ga0207687_10010844
433 Ga0207700_10014619
434 Ga0207644_10006107
435 Ga0207686_10028700
436 Ga0207686_10063601
437 Ga0207709_10013248
438 Ga0207709_10076843
439 Ga0207670_10080072
440 Ga0207669_10062188
441 Ga0207669_10175009
442 Ga0207704_10094660
443 Ga0207711_10060442
444 Ga0207711_10303961
445 Ga0207711_10318943
446 Ga0207711_10405051
447 Ga0207689_10062717
448 Ga0207689_10093396
449 Ga0207651_10009020
450 Ga0207651_10036277
451 Ga0207668_10055790
452 Ga0207668_10105667
453 Ga0207640_10006620
454 Ga0207677_10195321
455 Ga0207677_10307137
456 Ga0207708_10011554
457 Ga0207702_10467171
458 Ga0207641_10007217
459 Ga0207648_10005742
460 Ga0207648_10107379
461 Ga0207676_10118122
462 Ga0207676_10150041
463 Ga0207676_10343999
464 Ga0207676_10497275
465 Ga0207675_100012084
466 Ga0207675_100015354
467 Ga0207675_100063703
468 Ga0207675_100467321
469 Ga0207683_10016887
470 Ga0207683_10204571
471 Ga0207698_10420998
472 Ga0209971_1019854
473 Ga0207428_10015348
474 Ga0207428_10098133
475 Ga0207428_10135959
476 Ga0268266_10006779
477 Ga0268266_10023090
478 Ga0268265_10004330
479 Ga0268265_10346226
480 Ga0268264_10011674
481 Ga0307408_100097918
482 Ga0265314_10134793
483 Ga0307416_100111122
484 Ga0307411_10083647
485 Ga0373930_0003212
486 Ga0373948_0009498
487 Ga0373938_0003346
488 Ga0373929_0000161
489 Ga0373949_0001358
490 Ga0373932_0007288
491 Ga0373939_0002128
492 Ga0373941_0001039
493 Ga0373956_0049809
494 Ga0373943_0004777
495 Ga0373942_0000021
496 Ga0373961_0003318
497 Ga0373931_0001288
498 Ga0373937_0139437
499 Ga0436365_0140503
500 Ga0439435_0052982
501 Ga0451577_0146294
502 Ga0453684_0301526
503 Ga0451576_0263026
504 Ga0495580_0114144
505 Ga0495580_0123542
506 Ga0495628_0037456
507 Ga0495628_0068017
508 Ga0495667_0086903
509 Ga0495656_0078636
510 Ga0495599_0117892
511 Ga0495647_0007971
512 Ga0495658_0040379
513 Ga0495672_0064976
514 Ga0495684_0071706
515 Ga0496102_0419732
516 Ga0496104_0039943
517 Ga0496106_0102946
518 Ga0496109_0219213
519 Ga0496112_0036731
520 Ga0496112_0449499
521 Ga0496113_0070913
522 Ga0496113_0307916
523 Ga0496114_0039743
524 Ga0496114_0115699
525 Ga0501032_0048754
526 Ga0501033_0016563
527 Ga0501036_0007074
528 Ga0501036_0027418
529 Ga0501037_0013896
530 Ga0501038_0010612
531 Ga0501038_0018679
532 Ga0501039_0017528
533 Ga0501040_0005148
534 Ga0501041_0001817
535 Ga0501042_0001003
536 Ga0501043_0224999
537 Ga0501046_0045153
538 Ga0501046_0087083
539 Ga0501047_0001185
540 Ga0501048_0004858
541 Ga0501048_0028827
542 Ga0501067_0000172
543 Ga0501069_0000114
544 Ga0501071_0002044
545 Ga0501071_0028554
546 Ga0501072_0290394
547 Ga0501073_0000590
548 Ga0501073_0001281
549 Ga0501074_0007391
550 Ga0501075_0000613
551 Ga0501076_0035722
552 Ga0501079_0004498
553 Ga0501081_0003667
554 Ga0501083_0081676
555 Ga0501044_0062423
556 Ga0501045_0001473
557 Ga0501045_0057857
558 nmdc:mga00v17_22429_c1
559 nmdc:mga0k408_15623_c1
560 nmdc:mga05p37_14261_c1
561 nmdc:mga05p37_16728_c1
562 nmdc:mga05p37_18959_c1
563 nmdc:mga05p37_202930_c1
564 nmdc:mga05p37_207428_c1
565 nmdc:mga05p37_25310_c1
566 nmdc:mga09592_146322_c1
567 nmdc:mga06r32_42043_c1
568 nmdc:mga06r32_46877_c1
569 nmdc:mga08y16_285285_c1
570 nmdc:mga08y16_3605_c1
571 nmdc:mga08y16_55197_c1
572 nmdc:mga08y16_5939_c1
573 nmdc:mga0n895_38851_c1
574 nmdc:mga0n895_5669_c1
575 nmdc:mga0rr50_1949_c1
576 nmdc:mga0a205_102643_c1
577 nmdc:mga0a205_23821_c1
578 nmdc:mga0a205_241002_c1
579 nmdc:mga0a205_49638_c1
580 Ga0500568_0011916
581 Ga0500616_0025772
582 Ga0500599_002834
583 Ga0501084_0051389
584 Ga0501082_0001188
585 Ga0501082_0003658
586 Ga0530510_0002964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

153

261

0.89

PF03462

PCRF

PCRF domain

1

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.8734 103 210
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.8521 103 210
6bok-assembly2.cif.gz_HD e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.8487 103 351
5u4j-assembly1.cif.gz_v structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.8481 110 309
5j30-assembly1.cif.gz_QY thermus thermophilus 70s termination complex containing e. coli rf1 0.8469 103 349
ID Description Score Start End Superfamily
1gqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9503 108 347 3.30.70.1660
2b3tB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9491 106 351 3.30.70.1660
af_P30775_152_262_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9338 108 212 3.30.70.1660
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.933 107 208 3.30.70.1660
1gqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9311 108 347 3.30.70.1660
ID Description Score Start End GO Terms
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9481 100 201 GO:0006415
AF-X1NS20-F1-model_v4 Peptide chain release factor domain-containing protein 0.9193 56 208 GO:0006415
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9133 100 201 GO:0006415
AF-V4J6B3-F1-model_v4 deleted 0.9088 52 347
AF-V4J6B3-F1-model_v4 deleted 0.8946 52 347

Map