F391363

General Info

Members Datasets Scaffolds Average Seq Length
293 148 586 659

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10015019|Ga0070709_100150192
Length 771
Sequence MCLAAGMLARAISCWMASLPTAAGRATLHVVMQGIAVGAGWGRGVDGTGNLSLPTGDLCVGPQAGAPQADWQWGVAMRAWTVRLVSPAAALVLGGVTLALMIADVPLAGLAHQSLNASGGSLPVWVSAPFAVVGFVVAWRKPGNPLGWIILGTAVFFALSEDASFYAVADYRLRHGGLPFGWVALLAQPGWAPGIALFGLAVLLFPDGRPPSPRLRWVVWVFAAVALLWIGSAVTITVGAIIGHHTQVDSGGNLLLLDSTFHQSPAWWTVLSTVALGLGVVCWLVSLAAQALSYRRSSGERRQQLKWLMAGSAVALVSFMTAAAILRGGPAGFIAPXXXLAIPLSIGVAVMRYRLFDIDVVISKAVLYGSLAVFITAVYAGLVVGIGALVGNQRSPLLVAFQPARQWAGRLANRVVYGRRATPYQVLSDFARRLGGTYADEDVLPQMAQIVAAGTGAEQVVVWLRIDDQLRPEASSDGSPPAGPLPVDGHQLPPLPGIDLSVPVVHQGDLLGAISVKMPKDEPLRPAGQQLVADVASQAGLVLVNAGLIEDLRASRQRLVAAQDEERRRLERNLHDGAQQDLVALAIKVRLGASAEDLAQAKEIFGELQADAAGALENLRDLARGIYPPLLADLGLAAALDAQAAKSPLPVTVEADGVGRFGQDTEAAVYFCCLEALQNTAKYAHATQASICLQKQDETLRFTISDDGTGYNTSRTPIGSGLRNMADRLAALGGRLQVRSAPGQGTAITGDLPLPSRAPVGTRSQGVVATS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.19
Rhizosphere 91.81
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10015019 3300005434 Bacteria 4396
2 JGI24751J29686_10000433 3300002459 Bacteria 12947
3 Ga0070670_100006843 3300005331 Bacteria 9659
4 Ga0070682_100022782 3300005337 Bacteria 3714
5 Ga0070709_10004540 3300005434 Bacteria 7492
6 Ga0070709_10005396 3300005434 Bacteria 6923
7 Ga0070714_100014551 3300005435 Bacteria 6323
8 Ga0070714_100016548 3300005435 Bacteria 5959
9 Ga0070714_100026972 3300005435 Bacteria 4752
10 Ga0070714_100033782 3300005435 Bacteria 4279
11 Ga0070714_100056575 3300005435 Bacteria 3355
12 Ga0070713_100014633 3300005436 Bacteria 5835
13 Ga0070713_100057142 3300005436 Bacteria 3247
14 Ga0070713_100061092 3300005436 Bacteria 3152
15 Ga0070710_10002987 3300005437 Bacteria 8035
16 Ga0070710_10015855 3300005437 Bacteria 3822
17 Ga0070710_10017098 3300005437 Bacteria 3705
18 Ga0070710_10060707 3300005437 Bacteria 2151
19 Ga0070711_100006320 3300005439 Bacteria 7133
20 Ga0070711_100018191 3300005439 Bacteria 4482
21 Ga0070694_100011660 3300005444 Bacteria 5444
22 Ga0070708_100007012 3300005445 Bacteria 8986
23 Ga0070707_100000210 3300005468 Bacteria 58596
24 Ga0070698_100010407 3300005471 Bacteria 9934
25 Ga0070697_100000817 3300005536 Bacteria 23340
26 Ga0070696_100015805 3300005546 Bacteria 5073
27 Ga0068856_100055536 3300005614 Bacteria 3908
28 Ga0068856_100078263 3300005614 Bacteria 3278
29 Ga0068864_100078616 3300005618 Bacteria 2887
30 Ga0068870_10000109 3300005840 Bacteria 28042
31 Ga0068863_100038893 3300005841 Bacteria 4526
32 Ga0068860_100083414 3300005843 Bacteria 3040
33 Ga0081455_10001504 3300005937 Bacteria 28803
34 Ga0081455_10001870 3300005937 Bacteria 25319
35 Ga0081540_1001635 3300005983 Bacteria 19096
36 Ga0070717_10034995 3300006028 Bacteria 4062
37 Ga0070717_10037537 3300006028 Bacteria 3934
38 Ga0070717_10067326 3300006028 Bacteria 2979
39 Ga0070715_10001057 3300006163 Bacteria 7794
40 Ga0070715_10005693 3300006163 Bacteria 4180
41 Ga0070716_100007873 3300006173 Bacteria 5272
42 Ga0070716_100008183 3300006173 Bacteria 5182
43 Ga0070712_100009246 3300006175 Bacteria 6207
44 Ga0070712_100040222 3300006175 Bacteria 3204
45 Ga0070712_100067053 3300006175 Bacteria 2553
46 Ga0075428_100120019 3300006844 Bacteria 2862
47 Ga0075433_10018129 3300006852 Bacteria 5845
48 Ga0075433_10040350 3300006852 Bacteria 4040
49 Ga0075433_10058400 3300006852 Bacteria 3374
50 Ga0075434_100001768 3300006871 Bacteria 18603
51 Ga0075434_100006830 3300006871 Bacteria 10503
52 Ga0075434_100037368 3300006871 Bacteria 4807
53 Ga0075434_100079019 3300006871 Bacteria 3286
54 Ga0075429_100035284 3300006880 Bacteria 4349
55 Ga0075436_100013389 3300006914 Bacteria 5619
56 Ga0075435_100004171 3300007076 Bacteria 9914
57 Ga0075435_100010448 3300007076 Bacteria 6793
58 Ga0075435_100020711 3300007076 Bacteria 5046
59 Ga0075435_100043287 3300007076 Bacteria 3604
60 Ga0075435_100066625 3300007076 Bacteria 2930
61 Ga0111539_10041746 3300009094 Bacteria 5513
62 Ga0111539_10095330 3300009094 Bacteria 3495
63 Ga0114129_10025906 3300009147 Bacteria 8305
64 Ga0114129_10028261 3300009147 Bacteria 7946
65 Ga0114129_10037704 3300009147 Bacteria 6823
66 Ga0114129_10053818 3300009147 Bacteria 5645
67 Ga0114129_10085791 3300009147 Bacteria 4368
68 Ga0114129_10158762 3300009147 Bacteria 3091
69 Ga0105249_10009894 3300009553 Bacteria 8359
70 Ga0105249_10050330 3300009553 Bacteria 3798
71 Ga0105246_10019307 3300011119 Bacteria 4353
72 Ga0157369_10068885 3300013105 Bacteria 3802
73 Ga0157375_10006378 3300013308 Bacteria 10284
74 Ga0157380_10057385 3300014326 Bacteria 3100
75 Ga0207692_10001826 3300025898 Bacteria 8090
76 Ga0207692_10035251 3300025898 Bacteria 2430
77 Ga0207685_10003170 3300025905 Bacteria 3946
78 Ga0207699_10000736 3300025906 Bacteria 15610
79 Ga0207699_10004180 3300025906 Bacteria 6914
80 Ga0207699_10006139 3300025906 Bacteria 5795
81 Ga0207699_10007052 3300025906 Bacteria 5476
82 Ga0207699_10007378 3300025906 Bacteria 5379
83 Ga0207699_10010256 3300025906 Bacteria 4694
84 Ga0207699_10029866 3300025906 Bacteria 3044
85 Ga0207643_10000165 3300025908 Bacteria 45606
86 Ga0207693_10007393 3300025915 Bacteria 9035
87 Ga0207693_10009578 3300025915 Bacteria 7888
88 Ga0207693_10028453 3300025915 Bacteria 4416
89 Ga0207693_10029952 3300025915 Bacteria 4295
90 Ga0207693_10066072 3300025915 Bacteria 2832
91 Ga0207693_10078903 3300025915 Bacteria 2576
92 Ga0207663_10006589 3300025916 Bacteria 5962
93 Ga0207663_10044278 3300025916 Bacteria 2731
94 Ga0207646_10000944 3300025922 Bacteria 37384
95 Ga0207646_10056142 3300025922 Unclassified 3521
96 Ga0207700_10001057 3300025928 Bacteria 15844
97 Ga0207700_10006784 3300025928 Bacteria 6956
98 Ga0207700_10007213 3300025928 Bacteria 6778
99 Ga0207664_10007996 3300025929 Bacteria 7353
100 Ga0207664_10060191 3300025929 Bacteria 3026
101 Ga0207664_10071904 3300025929 Bacteria 2787
102 Ga0207670_10069169 3300025936 Bacteria 2435
103 Ga0207665_10004543 3300025939 Bacteria 9209
104 Ga0207665_10005706 3300025939 Bacteria 8291
105 Ga0207665_10023207 3300025939 Bacteria 4087
106 Ga0207665_10023974 3300025939 Bacteria 4021
107 Ga0207665_10078070 3300025939 Bacteria 2273
108 Ga0207667_10087753 3300025949 Bacteria 3218
109 Ga0207708_10029532 3300026075 Bacteria 4156
110 Ga0207702_10022773 3300026078 Bacteria 5197
111 Ga0207702_10042458 3300026078 Bacteria 3815
112 Ga0207676_10001761 3300026095 Bacteria 15864
113 Ga0207428_10005410 3300027907 Bacteria 11911
114 Ga0207428_10013662 3300027907 Bacteria 7083
115 Ga0207428_10014136 3300027907 Bacteria 6950
116 Ga0265326_10005827 3300028558 Bacteria 3868
117 Ga0265318_10011464 3300028577 Bacteria 3815
118 Ga0265324_10008639 3300029957 Bacteria 4031
119 Ga0265320_10008803 3300031240 Bacteria 6141
120 Ga0265340_10005343 3300031247 Bacteria 7135
121 Ga0265313_10014523 3300031595 Bacteria 4648
122 Ga0265314_10017151 3300031711 Bacteria 5690
123 Ga0373923_0011124 3300035111 Bacteria 3293
124 Ga0373935_0014924 3300035692 Bacteria 4691
125 Ga0373933_0012461 3300035724 Bacteria 4695
126 Ga0373947_0030035 3300035725 Bacteria 3191
127 Ga0373937_0003815 3300036401 Bacteria 12735
128 Ga0373937_0016474 3300036401 Bacteria 6565
129 Ga0373937_0107124 3300036401 Bacteria 2598
130 Ga0373925_0020392 3300037068 Bacteria 4825
131 Ga0373925_0061968 3300037068 Bacteria 2811
132 Ga0395900_0004096 3300037418 Bacteria 15542
133 Ga0395900_0023443 3300037418 Bacteria 6317
134 Ga0395898_0007311 3300037466 Bacteria 11724
135 Ga0395905_0001908 3300037471 Bacteria 23991
136 Ga0395905_0030369 3300037471 Bacteria 5092
137 Ga0395901_0001453 3300038443 Bacteria 24679
138 Ga0395901_0072613 3300038443 Bacteria 3587
139 Ga0451791_1026458 3300041451 Unclassified 2578
140 Ga0451793_0016362 3300041452 Bacteria 12073
141 Ga0451797_0238961 3300041453 Unclassified 3173
142 Ga0495592_0035257 3300046454 Bacteria 3770
143 Ga0495592_0062424 3300046454 Bacteria 2735
144 Ga0495629_0012837 3300046459 Bacteria 6060
145 Ga0495629_0022183 3300046459 Bacteria 4528
146 Ga0495641_0009928 3300046461 Bacteria 5597
147 Ga0495641_0032892 3300046461 Bacteria 2465
148 Ga0495651_0003863 3300046462 Bacteria 11453
149 Ga0495651_0015611 3300046462 Bacteria 5878
150 Ga0495651_0046916 3300046462 Bacteria 3342
151 Ga0495653_0020226 3300046463 Bacteria 5397
152 Ga0495653_0026688 3300046463 Bacteria 4628
153 Ga0495582_0004939 3300046473 Bacteria 7475
154 Ga0495582_0026504 3300046473 Bacteria 3177
155 Ga0495639_0037852 3300046475 Bacteria 2164
156 Ga0495662_0008144 3300046476 Bacteria 5164
157 Ga0495594_0056809 3300046499 Bacteria 2161
158 Ga0495608_0010685 3300046511 Bacteria 6404
159 Ga0495608_0025071 3300046511 Bacteria 4072
160 Ga0495608_0044906 3300046511 Bacteria 2947
161 Ga0495618_0013164 3300046514 Bacteria 5033
162 Ga0495628_0022231 3300046516 Bacteria 5211
163 Ga0495628_0065100 3300046516 Bacteria 2852
164 Ga0495630_0011946 3300046517 Bacteria 6296
165 Ga0495652_0016078 3300046529 Bacteria 6694
166 Ga0495652_0055843 3300046529 Bacteria 3356
167 Ga0495665_0011713 3300046531 Bacteria 4751
168 Ga0495640_0034967 3300046533 Bacteria 3558
169 Ga0495587_0024892 3300046536 Bacteria 3663
170 Ga0495667_0013017 3300046559 Bacteria 5635
171 Ga0495667_0016408 3300046559 Bacteria 5005
172 Ga0495667_0036181 3300046559 Bacteria 3296
173 Ga0495667_0037435 3300046559 Bacteria 3233
174 Ga0495634_0017652 3300046642 Bacteria 5089
175 Ga0495634_0028990 3300046642 Bacteria 3836
176 Ga0495635_0016301 3300046663 Bacteria 5188
177 Ga0495635_0017346 3300046663 Bacteria 5030
178 Ga0495657_0008118 3300046675 Bacteria 8049
179 Ga0495657_0051529 3300046675 Bacteria 2763
180 Ga0495599_0013372 3300046678 Bacteria 5072
181 Ga0495658_0008057 3300046683 Bacteria 5218
182 Ga0495658_0014898 3300046683 Bacteria 3981
183 Ga0495613_0065404 3300046689 Unclassified 2657
184 Ga0495624_0050220 3300046690 Bacteria 2643
185 Ga0495624_0071471 3300046690 Bacteria 2159
186 Ga0495600_0016308 3300046809 Bacteria 4713
187 Ga0495600_0032896 3300046809 Bacteria 3365
188 Ga0495604_0008054 3300047317 Bacteria 8348
189 Ga0495604_0052417 3300047317 Bacteria 3159
190 Ga0495674_0012321 3300047319 Bacteria 8055
191 Ga0495674_0059259 3300047319 Bacteria 3344
192 Ga0495674_0078733 3300047319 Bacteria 2832
193 Ga0495674_0080781 3300047319 Bacteria 2789
194 Ga0495676_0022764 3300047321 Bacteria 5447
195 Ga0495676_0061265 3300047321 Bacteria 2944
196 Ga0495676_0062806 3300047321 Bacteria 2898
197 Ga0495680_0005340 3300047322 Bacteria 12121
198 Ga0495680_0019524 3300047322 Bacteria 5718
199 Ga0495680_0064871 3300047322 Bacteria 2799
200 Ga0495684_0011634 3300047471 Bacteria 6793
201 Ga0495684_0021797 3300047471 Bacteria 4931
202 Ga0495684_0060079 3300047471 Bacteria 2894
203 Ga0495684_0099891 3300047471 Bacteria 2194
204 Ga0495593_0006586 3300047673 Bacteria 6797
205 Ga0495593_0019426 3300047673 Bacteria 3810
206 Ga0496104_0011700 3300048907 Bacteria 7868
207 Ga0496104_0019465 3300048907 Bacteria 6211
208 Ga0496104_0023781 3300048907 Bacteria 5634
209 Ga0496104_0031757 3300048907 Bacteria 4912
210 Ga0496104_0161059 3300048907 Bacteria 2152
211 Ga0496105_0003863 3300048908 Bacteria 11197
212 Ga0496105_0017994 3300048908 Bacteria 5671
213 Ga0496105_0026864 3300048908 Bacteria 4698
214 Ga0496108_0052184 3300048911 Bacteria 3426
215 Ga0496108_0096099 3300048911 Bacteria 2523
216 Ga0496109_0089944 3300048912 Bacteria 2839
217 Ga0496109_0105211 3300048912 Bacteria 2621
218 Ga0496112_0023783 3300048915 Bacteria 5861
219 Ga0496112_0030384 3300048915 Bacteria 5228
220 Ga0496112_0043506 3300048915 Bacteria 4397
221 Ga0496112_0109815 3300048915 Bacteria 2728
222 Ga0496113_0086492 3300048916 Bacteria 2409
223 Ga0496114_0054976 3300048917 Bacteria 3319
224 Ga0496115_0006945 3300048918 Bacteria 8321
225 Ga0496115_0012896 3300048918 Bacteria 6303
226 Ga0496115_0092448 3300048918 Bacteria 2473
227 Ga0501031_0008061 3300049568 Bacteria 6860
228 Ga0501031_0016543 3300049568 Bacteria 4791
229 Ga0501032_0008013 3300049569 Bacteria 7700
230 Ga0501034_0040287 3300049571 Bacteria 4728
231 Ga0501036_0011174 3300049572 Bacteria 7429
232 Ga0501036_0020153 3300049572 Bacteria 5599
233 Ga0501036_0025527 3300049572 Bacteria 4986
234 Ga0501037_0023730 3300049573 Bacteria 4534
235 Ga0501038_0011800 3300049574 Bacteria 7973
236 Ga0501038_0030972 3300049574 Bacteria 4730
237 Ga0501039_0016343 3300049575 Bacteria 5687
238 Ga0501040_0011511 3300049576 Bacteria 5790
239 Ga0501040_0048801 3300049576 Bacteria 2893
240 Ga0501046_0031340 3300049580 Bacteria 4310
241 Ga0501046_0051121 3300049580 Bacteria 3262
242 Ga0501069_0018360 3300049585 Bacteria 3774
243 Ga0501069_0047904 3300049585 Bacteria 2373
244 Ga0501070_0016520 3300049586 Bacteria 6199
245 Ga0501071_0010080 3300049587 Bacteria 6317
246 Ga0501071_0029266 3300049587 Bacteria 3886
247 Ga0501071_0043942 3300049587 Bacteria 3205
248 Ga0501071_0045597 3300049587 Bacteria 3147
249 Ga0501072_0046485 3300049588 Bacteria 3416
250 Ga0501074_0016855 3300049590 Bacteria 5301
251 Ga0501074_0045375 3300049590 Bacteria 3180
252 Ga0501074_0084988 3300049590 Bacteria 2268
253 Ga0501075_0010188 3300049591 Bacteria 6599
254 Ga0501076_0044992 3300049592 Bacteria 3483
255 Ga0501076_0062644 3300049592 Bacteria 2962
256 Ga0501077_0025319 3300049593 Bacteria 3769
257 Ga0501079_0047180 3300049741 Bacteria 3323
258 Ga0501081_0009864 3300049743 Bacteria 6221
259 Ga0501081_0011387 3300049743 Bacteria 5821
260 Ga0501083_0012348 3300049744 Bacteria 5975
261 Ga0501035_0022890 3300049822 Bacteria 5737
262 Ga0501035_0047394 3300049822 Bacteria 3858
263 Ga0501044_0005084 3300049823 Bacteria 14671
264 nmdc:mga05p37_157524_c1 3300050507 Bacteria 2775
265 nmdc:mga05p37_26312_c1 3300050507 Bacteria 7077
266 nmdc:mga05p37_27056_c1 3300050507 Bacteria 6981
267 nmdc:mga09592_32502_c1 3300050508 Bacteria 4350
268 nmdc:mga09592_42936_c1 3300050508 Bacteria 3804
269 nmdc:mga09592_97836_c1 3300050508 Bacteria 2511
270 nmdc:mga08y16_19842_c1 3300050511 Bacteria 7089
271 nmdc:mga08y16_36700_c1 3300050511 Bacteria 5147
272 nmdc:mga0n895_136470_c1 3300050512 Bacteria 2480
273 nmdc:mga0n895_18642_c1 3300050512 Bacteria 6427
274 nmdc:mga0n895_31352_c1 3300050512 Bacteria 5089
275 nmdc:mga0n895_40317_c1 3300050512 Bacteria 4535
276 nmdc:mga0n895_52904_c1 3300050512 Bacteria 3988
277 nmdc:mga0n895_59831_c1 3300050512 Bacteria 3759
278 nmdc:mga0rr50_10105_c1 3300050513 Bacteria 5972
279 nmdc:mga0rr50_10873_c1 3300050513 Bacteria 5803
280 nmdc:mga0rr50_50608_c1 3300050513 Bacteria 3079
281 nmdc:mga08x19_18916_c1 3300050514 Bacteria 4223
282 nmdc:mga0a205_16564_c1 3300050515 Bacteria 6905
283 nmdc:mga0a205_18543_c1 3300050515 Bacteria 6545
284 Ga0495601_0049125 3300053077 Bacteria 2659
285 Ga0495619_0043262 3300053085 Bacteria 2952
286 Ga0501084_0004748 3300054114 Bacteria 11105
287 Ga0501084_0024314 3300054114 Bacteria 5052
288 Ga0501084_0036086 3300054114 Bacteria 4131
289 Ga0501082_0049266 3300060353 Bacteria 3632
290 Ga0501082_0052377 3300060353 Bacteria 3518
291 Ga0530510_0016886 3300061734 Bacteria 5170
292 Ga0530510_0021144 3300061734 Bacteria 4628
293 Ga0530510_0044216 3300061734 Bacteria 3218
294 Ga0070709_10015019
295 JGI24751J29686_10000433
296 Ga0070670_100006843
297 Ga0070682_100022782
298 Ga0070709_10004540
299 Ga0070709_10005396
300 Ga0070714_100014551
301 Ga0070714_100016548
302 Ga0070714_100026972
303 Ga0070714_100033782
304 Ga0070714_100056575
305 Ga0070713_100014633
306 Ga0070713_100057142
307 Ga0070713_100061092
308 Ga0070710_10002987
309 Ga0070710_10015855
310 Ga0070710_10017098
311 Ga0070710_10060707
312 Ga0070711_100006320
313 Ga0070711_100018191
314 Ga0070694_100011660
315 Ga0070708_100007012
316 Ga0070707_100000210
317 Ga0070698_100010407
318 Ga0070697_100000817
319 Ga0070696_100015805
320 Ga0068856_100055536
321 Ga0068856_100078263
322 Ga0068864_100078616
323 Ga0068870_10000109
324 Ga0068863_100038893
325 Ga0068860_100083414
326 Ga0081455_10001504
327 Ga0081455_10001870
328 Ga0081540_1001635
329 Ga0070717_10034995
330 Ga0070717_10037537
331 Ga0070717_10067326
332 Ga0070715_10001057
333 Ga0070715_10005693
334 Ga0070716_100007873
335 Ga0070716_100008183
336 Ga0070712_100009246
337 Ga0070712_100040222
338 Ga0070712_100067053
339 Ga0075428_100120019
340 Ga0075433_10018129
341 Ga0075433_10040350
342 Ga0075433_10058400
343 Ga0075434_100001768
344 Ga0075434_100006830
345 Ga0075434_100037368
346 Ga0075434_100079019
347 Ga0075429_100035284
348 Ga0075436_100013389
349 Ga0075435_100004171
350 Ga0075435_100010448
351 Ga0075435_100020711
352 Ga0075435_100043287
353 Ga0075435_100066625
354 Ga0111539_10041746
355 Ga0111539_10095330
356 Ga0114129_10025906
357 Ga0114129_10028261
358 Ga0114129_10037704
359 Ga0114129_10053818
360 Ga0114129_10085791
361 Ga0114129_10158762
362 Ga0105249_10009894
363 Ga0105249_10050330
364 Ga0105246_10019307
365 Ga0157369_10068885
366 Ga0157375_10006378
367 Ga0157380_10057385
368 Ga0207692_10001826
369 Ga0207692_10035251
370 Ga0207685_10003170
371 Ga0207699_10000736
372 Ga0207699_10004180
373 Ga0207699_10006139
374 Ga0207699_10007052
375 Ga0207699_10007378
376 Ga0207699_10010256
377 Ga0207699_10029866
378 Ga0207643_10000165
379 Ga0207693_10007393
380 Ga0207693_10009578
381 Ga0207693_10028453
382 Ga0207693_10029952
383 Ga0207693_10066072
384 Ga0207693_10078903
385 Ga0207663_10006589
386 Ga0207663_10044278
387 Ga0207646_10000944
388 Ga0207646_10056142
389 Ga0207700_10001057
390 Ga0207700_10006784
391 Ga0207700_10007213
392 Ga0207664_10007996
393 Ga0207664_10060191
394 Ga0207664_10071904
395 Ga0207670_10069169
396 Ga0207665_10004543
397 Ga0207665_10005706
398 Ga0207665_10023207
399 Ga0207665_10023974
400 Ga0207665_10078070
401 Ga0207667_10087753
402 Ga0207708_10029532
403 Ga0207702_10022773
404 Ga0207702_10042458
405 Ga0207676_10001761
406 Ga0207428_10005410
407 Ga0207428_10013662
408 Ga0207428_10014136
409 Ga0265326_10005827
410 Ga0265318_10011464
411 Ga0265324_10008639
412 Ga0265320_10008803
413 Ga0265340_10005343
414 Ga0265313_10014523
415 Ga0265314_10017151
416 Ga0373923_0011124
417 Ga0373935_0014924
418 Ga0373933_0012461
419 Ga0373947_0030035
420 Ga0373937_0003815
421 Ga0373937_0016474
422 Ga0373937_0107124
423 Ga0373925_0020392
424 Ga0373925_0061968
425 Ga0395900_0004096
426 Ga0395900_0023443
427 Ga0395898_0007311
428 Ga0395905_0001908
429 Ga0395905_0030369
430 Ga0395901_0001453
431 Ga0395901_0072613
432 Ga0451791_1026458
433 Ga0451793_0016362
434 Ga0451797_0238961
435 Ga0495592_0035257
436 Ga0495592_0062424
437 Ga0495629_0012837
438 Ga0495629_0022183
439 Ga0495641_0009928
440 Ga0495641_0032892
441 Ga0495651_0003863
442 Ga0495651_0015611
443 Ga0495651_0046916
444 Ga0495653_0020226
445 Ga0495653_0026688
446 Ga0495582_0004939
447 Ga0495582_0026504
448 Ga0495639_0037852
449 Ga0495662_0008144
450 Ga0495594_0056809
451 Ga0495608_0010685
452 Ga0495608_0025071
453 Ga0495608_0044906
454 Ga0495618_0013164
455 Ga0495628_0022231
456 Ga0495628_0065100
457 Ga0495630_0011946
458 Ga0495652_0016078
459 Ga0495652_0055843
460 Ga0495665_0011713
461 Ga0495640_0034967
462 Ga0495587_0024892
463 Ga0495667_0013017
464 Ga0495667_0016408
465 Ga0495667_0036181
466 Ga0495667_0037435
467 Ga0495634_0017652
468 Ga0495634_0028990
469 Ga0495635_0016301
470 Ga0495635_0017346
471 Ga0495657_0008118
472 Ga0495657_0051529
473 Ga0495599_0013372
474 Ga0495658_0008057
475 Ga0495658_0014898
476 Ga0495613_0065404
477 Ga0495624_0050220
478 Ga0495624_0071471
479 Ga0495600_0016308
480 Ga0495600_0032896
481 Ga0495604_0008054
482 Ga0495604_0052417
483 Ga0495674_0012321
484 Ga0495674_0059259
485 Ga0495674_0078733
486 Ga0495674_0080781
487 Ga0495676_0022764
488 Ga0495676_0061265
489 Ga0495676_0062806
490 Ga0495680_0005340
491 Ga0495680_0019524
492 Ga0495680_0064871
493 Ga0495684_0011634
494 Ga0495684_0021797
495 Ga0495684_0060079
496 Ga0495684_0099891
497 Ga0495593_0006586
498 Ga0495593_0019426
499 Ga0496104_0011700
500 Ga0496104_0019465
501 Ga0496104_0023781
502 Ga0496104_0031757
503 Ga0496104_0161059
504 Ga0496105_0003863
505 Ga0496105_0017994
506 Ga0496105_0026864
507 Ga0496108_0052184
508 Ga0496108_0096099
509 Ga0496109_0089944
510 Ga0496109_0105211
511 Ga0496112_0023783
512 Ga0496112_0030384
513 Ga0496112_0043506
514 Ga0496112_0109815
515 Ga0496113_0086492
516 Ga0496114_0054976
517 Ga0496115_0006945
518 Ga0496115_0012896
519 Ga0496115_0092448
520 Ga0501031_0008061
521 Ga0501031_0016543
522 Ga0501032_0008013
523 Ga0501034_0040287
524 Ga0501036_0011174
525 Ga0501036_0020153
526 Ga0501036_0025527
527 Ga0501037_0023730
528 Ga0501038_0011800
529 Ga0501038_0030972
530 Ga0501039_0016343
531 Ga0501040_0011511
532 Ga0501040_0048801
533 Ga0501046_0031340
534 Ga0501046_0051121
535 Ga0501069_0018360
536 Ga0501069_0047904
537 Ga0501070_0016520
538 Ga0501071_0010080
539 Ga0501071_0029266
540 Ga0501071_0043942
541 Ga0501071_0045597
542 Ga0501072_0046485
543 Ga0501074_0016855
544 Ga0501074_0045375
545 Ga0501074_0084988
546 Ga0501075_0010188
547 Ga0501076_0044992
548 Ga0501076_0062644
549 Ga0501077_0025319
550 Ga0501079_0047180
551 Ga0501081_0009864
552 Ga0501081_0011387
553 Ga0501083_0012348
554 Ga0501035_0022890
555 Ga0501035_0047394
556 Ga0501044_0005084
557 nmdc:mga05p37_157524_c1
558 nmdc:mga05p37_26312_c1
559 nmdc:mga05p37_27056_c1
560 nmdc:mga09592_32502_c1
561 nmdc:mga09592_42936_c1
562 nmdc:mga09592_97836_c1
563 nmdc:mga08y16_19842_c1
564 nmdc:mga08y16_36700_c1
565 nmdc:mga0n895_136470_c1
566 nmdc:mga0n895_18642_c1
567 nmdc:mga0n895_31352_c1
568 nmdc:mga0n895_40317_c1
569 nmdc:mga0n895_52904_c1
570 nmdc:mga0n895_59831_c1
571 nmdc:mga0rr50_10105_c1
572 nmdc:mga0rr50_10873_c1
573 nmdc:mga0rr50_50608_c1
574 nmdc:mga08x19_18916_c1
575 nmdc:mga0a205_16564_c1
576 nmdc:mga0a205_18543_c1
577 Ga0495601_0049125
578 Ga0495619_0043262
579 Ga0501084_0004748
580 Ga0501084_0024314
581 Ga0501084_0036086
582 Ga0501082_0049266
583 Ga0501082_0052377
584 Ga0530510_0016886
585 Ga0530510_0021144
586 Ga0530510_0044216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07730

HisKA_3

Histidine kinase

566

631

0.94

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

664

756

0.89

Map