F391214

General Info

Members Datasets Scaffolds Average Seq Length
292 226 584 145

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_049726|Ga0500595_049726_634_1134
Length 166
Sequence MPRVASKALAKIRAESRMPAPNFMEMALDQARAAAARGEVPVGCVVVRDGAVIASAGNRTLADKDPTAHAEMLAIRAAASTLGSERLTGCDLYVTLEPCAMCAAAMSFARIRRLYFGAADPKGGAVENGGRFFAQPTCHHRPEVYGGINESDATVLLKDFFAARRV

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
41 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
95 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
96 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
110 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
217 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
225 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
226 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.22
Nodule 0.34
Rhizoplane 9.25
Rhizosphere 77.05
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_049726 3300053119 Bacteria 1304
2 rootL2_10000087 3300003322 Bacteria 2407
3 Ga0070690_100182209 3300005330 Bacteria 1452
4 Ga0070670_100070546 3300005331 Bacteria 2999
5 Ga0070666_10157864 3300005335 Bacteria 1584
6 Ga0070689_100360951 3300005340 Bacteria 1221
7 Ga0070671_100055042 3300005355 Bacteria 3309
8 Ga0070667_100031464 3300005367 Bacteria 4425
9 Ga0070709_10045410 3300005434 Bacteria 2726
10 Ga0070714_100045948 3300005435 Bacteria 3703
11 Ga0070713_100068274 3300005436 Bacteria 2995
12 Ga0070713_100813696 3300005436 Bacteria 896
13 Ga0070710_10022100 3300005437 Bacteria 3324
14 Ga0070711_100047067 3300005439 Bacteria 2942
15 Ga0070681_10433982 3300005458 Bacteria 1226
16 Ga0068867_100820664 3300005459 Bacteria 831
17 Ga0070707_100573458 3300005468 Bacteria 1091
18 Ga0070679_100570127 3300005530 Bacteria 1075
19 Ga0070684_100754385 3300005535 Bacteria 909
20 Ga0070686_100652856 3300005544 Bacteria 834
21 Ga0068855_100125953 3300005563 Bacteria 2929
22 Ga0070664_100567526 3300005564 Bacteria 1050
23 Ga0068859_100610204 3300005617 Bacteria 1184
24 Ga0068863_100084638 3300005841 Bacteria 3005
25 Ga0068858_100739291 3300005842 Bacteria 958
26 Ga0070717_10001949 3300006028 Bacteria 14418
27 Ga0070717_10596361 3300006028 Bacteria 1002
28 Ga0075368_10037659 3300006042 Bacteria 1892
29 Ga0075363_100199859 3300006048 Bacteria 1142
30 Ga0070716_100007159 3300006173 Bacteria 5483
31 Ga0070716_100575115 3300006173 Bacteria 844
32 Ga0075367_10025504 3300006178 Bacteria 3344
33 Ga0075366_10007515 3300006195 Bacteria 6024
34 Ga0097621_100252907 3300006237 Bacteria 1543
35 Ga0075436_100069854 3300006914 Bacteria 2427
36 Ga0097620_100610191 3300006931 Bacteria 1184
37 Ga0075435_100073657 3300007076 Bacteria 2792
38 Ga0105240_10091640 3300009093 Bacteria 3713
39 Ga0111539_10633988 3300009094 Bacteria 1244
40 Ga0105245_12529404 3300009098 Bacteria 567
41 Ga0105242_11070720 3300009176 Bacteria 818
42 Ga0105248_10037683 3300009177 Bacteria 5410
43 Ga0157341_1010153 3300012494 Bacteria 795
44 Ga0157326_1033224 3300012513 Bacteria 693
45 Ga0157369_10773979 3300013105 Bacteria 987
46 Ga0157369_10799033 3300013105 Bacteria 969
47 Ga0157369_11828742 3300013105 Bacteria 617
48 Ga0163162_10234969 3300013306 Bacteria 1964
49 Ga0157372_10366008 3300013307 Bacteria 1680
50 Ga0163163_10585140 3300014325 Bacteria 1179
51 Ga0157376_10241135 3300014969 Bacteria 1684
52 Ga0182007_10298299 3300015262 Bacteria 591
53 Ga0213874_10103202 3300021377 Bacteria 950
54 Ga0213876_10001133 3300021384 Bacteria 16987
55 Ga0213876_10005996 3300021384 Bacteria 6644
56 Ga0213875_10008000 3300021388 Bacteria 5432
57 Ga0209257_1078800 3300025304 Bacteria 850
58 Ga0207692_10355289 3300025898 Bacteria 904
59 Ga0207688_10157571 3300025901 Bacteria 1344
60 Ga0207685_10190446 3300025905 Bacteria 957
61 Ga0207699_10001781 3300025906 Bacteria 10137
62 Ga0207707_10086764 3300025912 Bacteria 2734
63 Ga0207707_10137487 3300025912 Bacteria 2136
64 Ga0207707_10637076 3300025912 Bacteria 899
65 Ga0207695_10148178 3300025913 Bacteria 2288
66 Ga0207695_10460293 3300025913 Bacteria 1155
67 Ga0207693_10058676 3300025915 Bacteria 3015
68 Ga0207693_10193744 3300025915 Bacteria 1599
69 Ga0207663_10541233 3300025916 Bacteria 909
70 Ga0207657_10124892 3300025919 Bacteria 2114
71 Ga0207652_10052015 3300025921 Bacteria 3514
72 Ga0207652_11470720 3300025921 Bacteria 585
73 Ga0207646_10548350 3300025922 Bacteria 1040
74 Ga0207687_10067961 3300025927 Bacteria 2537
75 Ga0207700_10003874 3300025928 Bacteria 8743
76 Ga0207664_10070364 3300025929 Bacteria 2815
77 Ga0207644_10006874 3300025931 Bacteria 7412
78 Ga0207686_10050525 3300025934 Bacteria 2586
79 Ga0207709_10255273 3300025935 Bacteria 1283
80 Ga0207670_10227368 3300025936 Bacteria 1431
81 Ga0207704_10592630 3300025938 Bacteria 906
82 Ga0207665_10001038 3300025939 Bacteria 18711
83 Ga0207665_10158490 3300025939 Bacteria 1626
84 Ga0207711_10180655 3300025941 Bacteria 1918
85 Ga0207679_10278923 3300025945 Bacteria 1432
86 Ga0207651_10046766 3300025960 Bacteria 2913
87 Ga0207712_10410109 3300025961 Bacteria 1141
88 Ga0207640_11116801 3300025981 Bacteria 698
89 Ga0207658_10164302 3300025986 Bacteria 1822
90 Ga0207703_10502101 3300026035 Bacteria 1139
91 Ga0207703_11088099 3300026035 Bacteria 768
92 Ga0207703_12222715 3300026035 Bacteria 524
93 Ga0207708_10065622 3300026075 Bacteria 2775
94 Ga0207702_10129776 3300026078 Bacteria 2267
95 Ga0207641_10199584 3300026088 Bacteria 1843
96 Ga0207648_10776152 3300026089 Bacteria 891
97 Ga0207683_10009299 3300026121 Bacteria 8373
98 Ga0209813_10029102 3300027866 Bacteria 1615
99 Ga0268266_10042222 3300028379 Bacteria 3894
100 Ga0268264_10150262 3300028381 Bacteria 2087
101 Ga0307408_100749307 3300031548 Bacteria 882
102 Ga0265314_10000419 3300031711 Bacteria 57263
103 Ga0265314_10116653 3300031711 Bacteria 1688
104 Ga0307405_10597310 3300031731 Bacteria 900
105 Ga0307406_10282998 3300031901 Bacteria 1266
106 Ga0307412_10144544 3300031911 Bacteria 1746
107 Ga0307412_10534280 3300031911 Bacteria 982
108 Ga0307416_102970855 3300032002 Bacteria 567
109 Ga0307411_11281929 3300032005 Bacteria 667
110 Ga0307411_11628811 3300032005 Bacteria 596
111 Ga0373948_0011571 3300034817 Bacteria 1563
112 Ga0373958_0048239 3300034819 Bacteria 892
113 Ga0373938_0004634 3300034957 Bacteria 2308
114 Ga0373928_0016232 3300035084 Bacteria 1522
115 Ga0373934_0026793 3300035086 Bacteria 2237
116 Ga0373940_0039465 3300035088 Bacteria 1292
117 Ga0373944_0011031 3300035089 Bacteria 2471
118 Ga0373951_0100304 3300035091 Bacteria 769
119 Ga0373932_0380314 3300035112 Bacteria 542
120 Ga0373939_0027507 3300035114 Bacteria 1611
121 Ga0373945_0097923 3300035116 Bacteria 1144
122 Ga0373956_0154930 3300035119 Bacteria 1078
123 Ga0373960_0193004 3300035121 Bacteria 716
124 Ga0373943_0072936 3300035170 Bacteria 1742
125 Ga0373946_0220609 3300035171 Bacteria 915
126 Ga0373961_0003891 3300035241 Bacteria 3643
127 Ga0373962_0100309 3300035242 Bacteria 902
128 Ga0373931_0129182 3300035691 Bacteria 1452
129 Ga0373935_0168625 3300035692 Bacteria 1496
130 Ga0373927_0008842 3300035695 Bacteria 6766
131 Ga0373933_0035063 3300035724 Bacteria 2928
132 Ga0373933_0182152 3300035724 Bacteria 1340
133 Ga0373947_0001056 3300035725 Bacteria 16816
134 Ga0373937_0010950 3300036401 Bacteria 7943
135 Ga0373937_0107059 3300036401 Bacteria 2599
136 Ga0373937_1352087 3300036401 Bacteria 660
137 Ga0373925_0078658 3300037068 Bacteria 2504
138 Ga0395899_0671604 3300037312 Bacteria 653
139 Ga0395898_1037874 3300037466 Bacteria 755
140 Ga0395901_0290362 3300038443 Bacteria 1697
141 Ga0395901_0850585 3300038443 Bacteria 898
142 Ga0395901_1082619 3300038443 Bacteria 773
143 Ga0436365_0167783 3300039437 Bacteria 30845
144 Ga0436365_0693504 3300039437 Bacteria 82758
145 Ga0436360_1011453 3300039438 Bacteria 1296
146 Ga0436360_1020396 3300039438 Bacteria 744
147 Ga0436363_0194010 3300039450 Bacteria 5533
148 Ga0436362_1066435 3300039453 Bacteria 3566
149 Ga0439461_0000083 3300041410 Bacteria 12407
150 Ga0439431_0001511 3300041997 Bacteria 5135
151 Ga0439442_004239 3300042002 Bacteria 2843
152 Ga0439445_0002403 3300042004 Bacteria 4170
153 Ga0439432_000391 3300042006 Bacteria 16191
154 Ga0439462_0000163 3300042015 Bacteria 11098
155 Ga0439434_0000796 3300042435 Bacteria 9092
156 Ga0439459_0113727 3300042438 Bacteria 675
157 Ga0466968_0310160 3300044735 Bacteria 760
158 Ga0466960_0321269 3300044901 Bacteria 877
159 Ga0466960_0684877 3300044901 Bacteria 614
160 Ga0466960_0894326 3300044901 Bacteria 541
161 Ga0466958_0788320 3300045836 Bacteria 620
162 Ga0466967_0189105 3300045976 Bacteria 1945
163 Ga0495603_0005715 3300046455 Bacteria 7435
164 Ga0495629_0001065 3300046459 Bacteria 21903
165 Ga0495638_0113299 3300046460 Bacteria 1609
166 Ga0495638_0242403 3300046460 Bacteria 997
167 Ga0495641_0143137 3300046461 Bacteria 1068
168 Ga0495653_0359723 3300046463 Bacteria 934
169 Ga0495582_0000905 3300046473 Bacteria 16500
170 Ga0495594_0002426 3300046499 Bacteria 9707
171 Ga0495583_0001022 3300046506 Bacteria 31806
172 Ga0495665_0575834 3300046531 Bacteria 564
173 Ga0495634_0184004 3300046642 Bacteria 1307
174 Ga0495625_0160242 3300046660 Bacteria 1508
175 Ga0495635_0300553 3300046663 Bacteria 1076
176 Ga0495588_0242031 3300046674 Bacteria 952
177 Ga0495647_0025108 3300046681 Bacteria 2174
178 Ga0495658_0000875 3300046683 Bacteria 16175
179 Ga0495613_0008603 3300046689 Bacteria 7575
180 Ga0495671_0021292 3300046692 Bacteria 3408
181 Ga0495671_0501514 3300046692 Bacteria 579
182 Ga0495581_0254814 3300047315 Bacteria 1026
183 Ga0495676_0032081 3300047321 Bacteria 4438
184 Ga0495680_0038957 3300047322 Bacteria 3795
185 Ga0495684_0083359 3300047471 Bacteria 2425
186 Ga0495593_0002137 3300047673 Bacteria 11809
187 Ga0496101_0017906 3300048904 Bacteria 4808
188 Ga0496102_0068394 3300048905 Bacteria 3258
189 Ga0496102_0108169 3300048905 Bacteria 2589
190 Ga0496102_0253474 3300048905 Bacteria 1659
191 Ga0496103_0033904 3300048906 Bacteria 3120
192 Ga0496103_0055194 3300048906 Bacteria 2463
193 Ga0496104_0625023 3300048907 Bacteria 986
194 Ga0496105_0075658 3300048908 Bacteria 2780
195 Ga0496105_0184852 3300048908 Bacteria 1705
196 Ga0496107_0037517 3300048910 Bacteria 3477
197 Ga0496107_0382889 3300048910 Bacteria 1046
198 Ga0496107_0833419 3300048910 Bacteria 674
199 Ga0496108_0061484 3300048911 Bacteria 3160
200 Ga0496108_0145166 3300048911 Bacteria 2045
201 Ga0496109_0054476 3300048912 Bacteria 3648
202 Ga0496110_0692154 3300048913 Bacteria 920
203 Ga0496111_0005620 3300048914 Bacteria 8065
204 Ga0496111_0190759 3300048914 Bacteria 1523
205 Ga0496112_0083365 3300048915 Bacteria 3161
206 Ga0496112_0730078 3300048915 Bacteria 917
207 Ga0496112_1247595 3300048915 Bacteria 659
208 Ga0496113_0133641 3300048916 Bacteria 1948
209 Ga0496113_0174395 3300048916 Bacteria 1703
210 Ga0496114_0065881 3300048917 Bacteria 3035
211 Ga0496115_0034714 3300048918 Bacteria 3986
212 Ga0496115_0074872 3300048918 Bacteria 2749
213 Ga0496115_0737305 3300048918 Bacteria 771
214 Ga0496118_0001479 3300048921 Bacteria 35188
215 Ga0496124_0103914 3300048927 Bacteria 2297
216 Ga0496125_0025160 3300048928 Bacteria 5459
217 Ga0496125_0160760 3300048928 Bacteria 1526
218 Ga0496125_0443980 3300048928 Bacteria 745
219 Ga0495682_0279714 3300049460 Bacteria 589
220 Ga0501031_0007127 3300049568 Bacteria 7298
221 Ga0501032_0007059 3300049569 Bacteria 8236
222 Ga0501033_0003515 3300049570 Bacteria 12833
223 Ga0501034_0005911 3300049571 Bacteria 13279
224 Ga0501034_1035577 3300049571 Bacteria 704
225 Ga0501036_0006953 3300049572 Bacteria 9201
226 Ga0501036_0806345 3300049572 Bacteria 773
227 Ga0501037_0058116 3300049573 Bacteria 2822
228 Ga0501038_0111035 3300049574 Bacteria 2271
229 Ga0501038_0477259 3300049574 Bacteria 956
230 Ga0501039_0002162 3300049575 Bacteria 14524
231 Ga0501040_0713346 3300049576 Bacteria 725
232 Ga0501042_0046228 3300049578 Bacteria 3103
233 Ga0501043_0005563 3300049579 Bacteria 10159
234 Ga0501043_0320814 3300049579 Bacteria 1181
235 Ga0501046_0005172 3300049580 Bacteria 11689
236 Ga0501046_0246166 3300049580 Bacteria 1317
237 Ga0501047_0013831 3300049581 Bacteria 7661
238 Ga0501047_0079231 3300049581 Bacteria 3159
239 Ga0501047_0172439 3300049581 Bacteria 2032
240 Ga0501047_0665341 3300049581 Bacteria 860
241 Ga0501047_1128384 3300049581 Bacteria 597
242 Ga0501048_0001760 3300049582 Bacteria 16472
243 Ga0501048_0404624 3300049582 Bacteria 976
244 Ga0501067_0023707 3300049583 Bacteria 3401
245 Ga0501068_0001173 3300049584 Bacteria 13923
246 Ga0501069_0001030 3300049585 Bacteria 13312
247 Ga0501069_0098582 3300049585 Bacteria 1658
248 Ga0501070_0018636 3300049586 Bacteria 5823
249 Ga0501071_0011763 3300049587 Bacteria 5906
250 Ga0501072_0131734 3300049588 Bacteria 1993
251 Ga0501073_0005204 3300049589 Bacteria 9752
252 Ga0501074_0006692 3300049590 Bacteria 8319
253 Ga0501079_0018554 3300049741 Bacteria 5315
254 Ga0501080_0009660 3300049742 Bacteria 8809
255 Ga0501083_0004793 3300049744 Bacteria 9557
256 Ga0501282_001826 3300049778 Bacteria 2347
257 Ga0501035_0007345 3300049822 Bacteria 10298
258 Ga0501044_0015797 3300049823 Bacteria 8127
259 Ga0501044_1219128 3300049823 Bacteria 620
260 Ga0501045_0064469 3300049824 Bacteria 2689
261 nmdc:mga0k408_3082_c1 3300050493 Bacteria 4706
262 nmdc:mga04h51_34618_c1 3300050495 Bacteria 1614
263 nmdc:mga08y16_397052_c1 3300050511 Bacteria 1412
264 nmdc:mga0n895_195082_c1 3300050512 Bacteria 2056
265 nmdc:mga0n895_297354_c1 3300050512 Bacteria 1637
266 nmdc:mga0rr50_398886_c1 3300050513 Bacteria 1162
267 nmdc:mga08x19_58674_c1 3300050514 Bacteria 2490
268 nmdc:mga0a205_741352_c1 3300050515 Bacteria 831
269 Ga0495619_0000361 3300053085 Bacteria 31625
270 Ga0500643_003970 3300053087 Bacteria 6843
271 Ga0500643_037262 3300053087 Bacteria 1449
272 Ga0500644_0000432 3300053088 Bacteria 19529
273 Ga0500555_079604 3300053103 Bacteria 854
274 Ga0500555_122587 3300053103 Bacteria 648
275 Ga0500595_000055 3300053119 Bacteria 84205
276 Ga0500655_031102 3300053133 Bacteria 1029
277 Ga0500577_0033215 3300053142 Bacteria 1822
278 Ga0500616_0000001 3300053153 Bacteria 1986011
279 Ga0500616_0004940 3300053153 Bacteria 9258
280 Ga0500616_0046448 3300053153 Bacteria 2308
281 Ga0500616_0058016 3300053153 Bacteria 2015
282 Ga0500636_0213183 3300053177 Unclassified 1012
283 Ga0500645_000122 3300053730 Bacteria 61591
284 Ga0500645_015799 3300053730 Bacteria 2387
285 Ga0501084_0181754 3300054114 Bacteria 1775
286 Ga0501084_0207827 3300054114 Bacteria 1652
287 Ga0501082_0018508 3300060353 Bacteria 6001
288 Ga0501082_0110307 3300060353 Bacteria 2382
289 Ga0501082_0434771 3300060353 Bacteria 1146
290 2524466377 2524023210 Bacteria 9029266
291 2643755118 2643221547 Bacteria 4740017
292 2903778011 2903768456 Bacteria 9749579
293 Ga0500595_049726
294 rootL2_10000087
295 Ga0070690_100182209
296 Ga0070670_100070546
297 Ga0070666_10157864
298 Ga0070689_100360951
299 Ga0070671_100055042
300 Ga0070667_100031464
301 Ga0070709_10045410
302 Ga0070714_100045948
303 Ga0070713_100068274
304 Ga0070713_100813696
305 Ga0070710_10022100
306 Ga0070711_100047067
307 Ga0070681_10433982
308 Ga0068867_100820664
309 Ga0070707_100573458
310 Ga0070679_100570127
311 Ga0070684_100754385
312 Ga0070686_100652856
313 Ga0068855_100125953
314 Ga0070664_100567526
315 Ga0068859_100610204
316 Ga0068863_100084638
317 Ga0068858_100739291
318 Ga0070717_10001949
319 Ga0070717_10596361
320 Ga0075368_10037659
321 Ga0075363_100199859
322 Ga0070716_100007159
323 Ga0070716_100575115
324 Ga0075367_10025504
325 Ga0075366_10007515
326 Ga0097621_100252907
327 Ga0075436_100069854
328 Ga0097620_100610191
329 Ga0075435_100073657
330 Ga0105240_10091640
331 Ga0111539_10633988
332 Ga0105245_12529404
333 Ga0105242_11070720
334 Ga0105248_10037683
335 Ga0157341_1010153
336 Ga0157326_1033224
337 Ga0157369_10773979
338 Ga0157369_10799033
339 Ga0157369_11828742
340 Ga0163162_10234969
341 Ga0157372_10366008
342 Ga0163163_10585140
343 Ga0157376_10241135
344 Ga0182007_10298299
345 Ga0213874_10103202
346 Ga0213876_10001133
347 Ga0213876_10005996
348 Ga0213875_10008000
349 Ga0209257_1078800
350 Ga0207692_10355289
351 Ga0207688_10157571
352 Ga0207685_10190446
353 Ga0207699_10001781
354 Ga0207707_10086764
355 Ga0207707_10137487
356 Ga0207707_10637076
357 Ga0207695_10148178
358 Ga0207695_10460293
359 Ga0207693_10058676
360 Ga0207693_10193744
361 Ga0207663_10541233
362 Ga0207657_10124892
363 Ga0207652_10052015
364 Ga0207652_11470720
365 Ga0207646_10548350
366 Ga0207687_10067961
367 Ga0207700_10003874
368 Ga0207664_10070364
369 Ga0207644_10006874
370 Ga0207686_10050525
371 Ga0207709_10255273
372 Ga0207670_10227368
373 Ga0207704_10592630
374 Ga0207665_10001038
375 Ga0207665_10158490
376 Ga0207711_10180655
377 Ga0207679_10278923
378 Ga0207651_10046766
379 Ga0207712_10410109
380 Ga0207640_11116801
381 Ga0207658_10164302
382 Ga0207703_10502101
383 Ga0207703_11088099
384 Ga0207703_12222715
385 Ga0207708_10065622
386 Ga0207702_10129776
387 Ga0207641_10199584
388 Ga0207648_10776152
389 Ga0207683_10009299
390 Ga0209813_10029102
391 Ga0268266_10042222
392 Ga0268264_10150262
393 Ga0307408_100749307
394 Ga0265314_10000419
395 Ga0265314_10116653
396 Ga0307405_10597310
397 Ga0307406_10282998
398 Ga0307412_10144544
399 Ga0307412_10534280
400 Ga0307416_102970855
401 Ga0307411_11281929
402 Ga0307411_11628811
403 Ga0373948_0011571
404 Ga0373958_0048239
405 Ga0373938_0004634
406 Ga0373928_0016232
407 Ga0373934_0026793
408 Ga0373940_0039465
409 Ga0373944_0011031
410 Ga0373951_0100304
411 Ga0373932_0380314
412 Ga0373939_0027507
413 Ga0373945_0097923
414 Ga0373956_0154930
415 Ga0373960_0193004
416 Ga0373943_0072936
417 Ga0373946_0220609
418 Ga0373961_0003891
419 Ga0373962_0100309
420 Ga0373931_0129182
421 Ga0373935_0168625
422 Ga0373927_0008842
423 Ga0373933_0035063
424 Ga0373933_0182152
425 Ga0373947_0001056
426 Ga0373937_0010950
427 Ga0373937_0107059
428 Ga0373937_1352087
429 Ga0373925_0078658
430 Ga0395899_0671604
431 Ga0395898_1037874
432 Ga0395901_0290362
433 Ga0395901_0850585
434 Ga0395901_1082619
435 Ga0436365_0167783
436 Ga0436365_0693504
437 Ga0436360_1011453
438 Ga0436360_1020396
439 Ga0436363_0194010
440 Ga0436362_1066435
441 Ga0439461_0000083
442 Ga0439431_0001511
443 Ga0439442_004239
444 Ga0439445_0002403
445 Ga0439432_000391
446 Ga0439462_0000163
447 Ga0439434_0000796
448 Ga0439459_0113727
449 Ga0466968_0310160
450 Ga0466960_0321269
451 Ga0466960_0684877
452 Ga0466960_0894326
453 Ga0466958_0788320
454 Ga0466967_0189105
455 Ga0495603_0005715
456 Ga0495629_0001065
457 Ga0495638_0113299
458 Ga0495638_0242403
459 Ga0495641_0143137
460 Ga0495653_0359723
461 Ga0495582_0000905
462 Ga0495594_0002426
463 Ga0495583_0001022
464 Ga0495665_0575834
465 Ga0495634_0184004
466 Ga0495625_0160242
467 Ga0495635_0300553
468 Ga0495588_0242031
469 Ga0495647_0025108
470 Ga0495658_0000875
471 Ga0495613_0008603
472 Ga0495671_0021292
473 Ga0495671_0501514
474 Ga0495581_0254814
475 Ga0495676_0032081
476 Ga0495680_0038957
477 Ga0495684_0083359
478 Ga0495593_0002137
479 Ga0496101_0017906
480 Ga0496102_0068394
481 Ga0496102_0108169
482 Ga0496102_0253474
483 Ga0496103_0033904
484 Ga0496103_0055194
485 Ga0496104_0625023
486 Ga0496105_0075658
487 Ga0496105_0184852
488 Ga0496107_0037517
489 Ga0496107_0382889
490 Ga0496107_0833419
491 Ga0496108_0061484
492 Ga0496108_0145166
493 Ga0496109_0054476
494 Ga0496110_0692154
495 Ga0496111_0005620
496 Ga0496111_0190759
497 Ga0496112_0083365
498 Ga0496112_0730078
499 Ga0496112_1247595
500 Ga0496113_0133641
501 Ga0496113_0174395
502 Ga0496114_0065881
503 Ga0496115_0034714
504 Ga0496115_0074872
505 Ga0496115_0737305
506 Ga0496118_0001479
507 Ga0496124_0103914
508 Ga0496125_0025160
509 Ga0496125_0160760
510 Ga0496125_0443980
511 Ga0495682_0279714
512 Ga0501031_0007127
513 Ga0501032_0007059
514 Ga0501033_0003515
515 Ga0501034_0005911
516 Ga0501034_1035577
517 Ga0501036_0006953
518 Ga0501036_0806345
519 Ga0501037_0058116
520 Ga0501038_0111035
521 Ga0501038_0477259
522 Ga0501039_0002162
523 Ga0501040_0713346
524 Ga0501042_0046228
525 Ga0501043_0005563
526 Ga0501043_0320814
527 Ga0501046_0005172
528 Ga0501046_0246166
529 Ga0501047_0013831
530 Ga0501047_0079231
531 Ga0501047_0172439
532 Ga0501047_0665341
533 Ga0501047_1128384
534 Ga0501048_0001760
535 Ga0501048_0404624
536 Ga0501067_0023707
537 Ga0501068_0001173
538 Ga0501069_0001030
539 Ga0501069_0098582
540 Ga0501070_0018636
541 Ga0501071_0011763
542 Ga0501072_0131734
543 Ga0501073_0005204
544 Ga0501074_0006692
545 Ga0501079_0018554
546 Ga0501080_0009660
547 Ga0501083_0004793
548 Ga0501282_001826
549 Ga0501035_0007345
550 Ga0501044_0015797
551 Ga0501044_1219128
552 Ga0501045_0064469
553 nmdc:mga0k408_3082_c1
554 nmdc:mga04h51_34618_c1
555 nmdc:mga08y16_397052_c1
556 nmdc:mga0n895_195082_c1
557 nmdc:mga0n895_297354_c1
558 nmdc:mga0rr50_398886_c1
559 nmdc:mga08x19_58674_c1
560 nmdc:mga0a205_741352_c1
561 Ga0495619_0000361
562 Ga0500643_003970
563 Ga0500643_037262
564 Ga0500644_0000432
565 Ga0500555_079604
566 Ga0500555_122587
567 Ga0500595_000055
568 Ga0500655_031102
569 Ga0500577_0033215
570 Ga0500616_0000001
571 Ga0500616_0004940
572 Ga0500616_0046448
573 Ga0500616_0058016
574 Ga0500636_0213183
575 Ga0500645_000122
576 Ga0500645_015799
577 Ga0501084_0181754
578 Ga0501084_0207827
579 Ga0501082_0018508
580 Ga0501082_0110307
581 Ga0501082_0434771
582 2524466377
583 2643755118
584 2903778011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

19

118

0.97

PF14437

MafB19-deam

MafB19-like deaminase

18

165

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8n-assembly1.cif.gz_B biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9846 1 134
2a8n-assembly1.cif.gz_A biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.983 1 124
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.983 1 139
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9806 2 142
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9786 2 142
ID Description Score Start End Superfamily
af_A0A0P0V8T3_34_180_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 1.004 19 32 2.60.40.1820
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9898 36 95 3.40.140.10
2a8nA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.983 1 124 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9807 2 142 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9783 2 142 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A2V5DDK3-F1-model_v4 deleted 0.9954 1 142
AF-A0A1W1YK26-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9947 1 142 GO:0002100
GO:0008270
GO:0052717
AF-A0A1M7ZI22-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9946 2 142 GO:0002100
GO:0008270
GO:0052717
AF-A0A258RII7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9944 1 142 GO:0002100
GO:0008270
GO:0052717
AF-D6ZZJ2-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9944 2 142 GO:0002100
GO:0008270
GO:0052717

Map