F391207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 175 | 290 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300050515|nmdc:mga0a205_301163_c1|nmdc:mga0a205_301163_c1_549_1301 |
| Length | 250 |
| Sequence | MVFDTAAVRWPTADIFRPLCAEKPSVTLLPQLEIKHQWKKNMAHELPPLPYPKDALEPHIDAMTMEIHHDKHHNAYVTNLNKAIAGNAALESKTIEALIGDLGSVPENIRGAVRNNGGGHANHSMFWKLLAPKAGGAPTGKLADDLKAAFGSFDAFKEKLEAAGVGRFGSGWAWLVVNGGKLEIVSTANQDSPLMGKAVAGCEGKPILGVDVWEHAYYLKYQNRRPDYLKAIWNVINWTEVAKNYEAAGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 2 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 56 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 85 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 86 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 88 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 89 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 90 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 92 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 93 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 94 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 95 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 96 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 106 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 109 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 114 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 115 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 116 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 125 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 126 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 127 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 166 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 174 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 175 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.95 |
| Metatranscriptomes | 1.37 |
| Isolates | 0.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.68 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 95.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000056 | 3300003203 | Bacteria | 51828 |
| 2 | rootH1_10146062 | 3300003316 | Bacteria | 3646 |
| 3 | Ga0058862_12643340 | 3300004803 | Bacteria | 921 |
| 4 | Ga0070658_10004736 | 3300005327 | Bacteria | 11067 |
| 5 | Ga0070658_10123998 | 3300005327 | Bacteria | 2149 |
| 6 | Ga0070658_10580550 | 3300005327 | Bacteria | 971 |
| 7 | Ga0070683_100045102 | 3300005329 | Bacteria | 4069 |
| 8 | Ga0070683_100079932 | 3300005329 | Bacteria | 3060 |
| 9 | Ga0070660_100287108 | 3300005339 | Bacteria | 1347 |
| 10 | Ga0070689_100108846 | 3300005340 | Bacteria | 2202 |
| 11 | Ga0070689_100381955 | 3300005340 | Bacteria | 1187 |
| 12 | Ga0070691_10097695 | 3300005341 | Bacteria | 1455 |
| 13 | Ga0070687_100537726 | 3300005343 | Bacteria | 793 |
| 14 | Ga0070709_10711797 | 3300005434 | Bacteria | 782 |
| 15 | Ga0070709_10929795 | 3300005434 | Bacteria | 689 |
| 16 | Ga0070713_100776012 | 3300005436 | Bacteria | 918 |
| 17 | Ga0070710_10344515 | 3300005437 | Bacteria | 985 |
| 18 | Ga0070710_10345142 | 3300005437 | Bacteria | 984 |
| 19 | Ga0070701_10051398 | 3300005438 | Bacteria | 2138 |
| 20 | Ga0070711_100013623 | 3300005439 | Bacteria | 5109 |
| 21 | Ga0070694_100030410 | 3300005444 | Bacteria | 3532 |
| 22 | Ga0070681_10091085 | 3300005458 | Bacteria | 3000 |
| 23 | Ga0070681_10325124 | 3300005458 | Bacteria | 1448 |
| 24 | Ga0070679_100067144 | 3300005530 | Bacteria | 3576 |
| 25 | Ga0070684_100228318 | 3300005535 | Bacteria | 1699 |
| 26 | Ga0068853_100007548 | 3300005539 | Bacteria | 8704 |
| 27 | Ga0068853_100240485 | 3300005539 | Bacteria | 1659 |
| 28 | Ga0070686_100319092 | 3300005544 | Bacteria | 1158 |
| 29 | Ga0070686_100422078 | 3300005544 | Bacteria | 1019 |
| 30 | Ga0070704_100109747 | 3300005549 | Bacteria | 2097 |
| 31 | Ga0070704_101134644 | 3300005549 | Bacteria | 711 |
| 32 | Ga0068855_100030998 | 3300005563 | Bacteria | 6391 |
| 33 | Ga0068857_100846614 | 3300005577 | Bacteria | 875 |
| 34 | Ga0068856_100000264 | 3300005614 | Bacteria | 57155 |
| 35 | Ga0068856_100116103 | 3300005614 | Bacteria | 2677 |
| 36 | Ga0068856_100858888 | 3300005614 | Bacteria | 927 |
| 37 | Ga0068856_101221917 | 3300005614 | Bacteria | 768 |
| 38 | Ga0068852_100259976 | 3300005616 | Bacteria | 1667 |
| 39 | Ga0068859_100003005 | 3300005617 | Bacteria | 17101 |
| 40 | Ga0068859_100835022 | 3300005617 | Bacteria | 1008 |
| 41 | Ga0068863_100318249 | 3300005841 | Bacteria | 1511 |
| 42 | Ga0068858_100115442 | 3300005842 | Bacteria | 2509 |
| 43 | Ga0068858_100432719 | 3300005842 | Bacteria | 1266 |
| 44 | Ga0068858_100769504 | 3300005842 | Bacteria | 939 |
| 45 | Ga0068858_101157372 | 3300005842 | Bacteria | 760 |
| 46 | Ga0068862_100231924 | 3300005844 | Bacteria | 1675 |
| 47 | Ga0068862_101155797 | 3300005844 | Bacteria | 771 |
| 48 | Ga0081455_10076250 | 3300005937 | Bacteria | 2763 |
| 49 | Ga0081539_10000098 | 3300005985 | Bacteria | 202400 |
| 50 | Ga0081539_10007177 | 3300005985 | Bacteria | 10270 |
| 51 | Ga0097621_100047179 | 3300006237 | Bacteria | 3490 |
| 52 | Ga0097621_100428125 | 3300006237 | Bacteria | 1189 |
| 53 | Ga0075428_100164991 | 3300006844 | Bacteria | 2403 |
| 54 | Ga0075431_100059780 | 3300006847 | Bacteria | 3933 |
| 55 | Ga0075434_100090015 | 3300006871 | Bacteria | 3070 |
| 56 | Ga0097620_100003005 | 3300006931 | Bacteria | 17101 |
| 57 | Ga0097620_100835061 | 3300006931 | Bacteria | 1008 |
| 58 | Ga0099794_10059275 | 3300007265 | Bacteria | 1857 |
| 59 | Ga0105240_10000550 | 3300009093 | Bacteria | 69293 |
| 60 | Ga0105240_10000800 | 3300009093 | Bacteria | 56989 |
| 61 | Ga0105240_10112661 | 3300009093 | Bacteria | 3288 |
| 62 | Ga0105240_10228652 | 3300009093 | Bacteria | 2163 |
| 63 | Ga0105240_10682556 | 3300009093 | Bacteria | 1123 |
| 64 | Ga0111539_10007727 | 3300009094 | Bacteria | 13733 |
| 65 | Ga0111539_10199072 | 3300009094 | Bacteria | 2336 |
| 66 | Ga0111539_10387858 | 3300009094 | Bacteria | 1626 |
| 67 | Ga0111539_10742996 | 3300009094 | Bacteria | 1142 |
| 68 | Ga0105241_10007561 | 3300009174 | Bacteria | 7990 |
| 69 | Ga0105241_10612378 | 3300009174 | Bacteria | 985 |
| 70 | Ga0105242_10005448 | 3300009176 | Bacteria | 9831 |
| 71 | Ga0105237_10000453 | 3300009545 | Bacteria | 58200 |
| 72 | Ga0105237_10007396 | 3300009545 | Bacteria | 12027 |
| 73 | Ga0105237_10013605 | 3300009545 | Bacteria | 8525 |
| 74 | Ga0105238_10000592 | 3300009551 | Bacteria | 38095 |
| 75 | Ga0105238_10241645 | 3300009551 | Bacteria | 1783 |
| 76 | Ga0105238_10745209 | 3300009551 | Bacteria | 993 |
| 77 | Ga0105249_11140849 | 3300009553 | Bacteria | 850 |
| 78 | Ga0105239_10001405 | 3300010375 | Bacteria | 32195 |
| 79 | Ga0105239_10133521 | 3300010375 | Bacteria | 2762 |
| 80 | Ga0157369_10750280 | 3300013105 | Bacteria | 1004 |
| 81 | Ga0157369_10935170 | 3300013105 | Bacteria | 888 |
| 82 | Ga0157374_10239504 | 3300013296 | Bacteria | 1784 |
| 83 | Ga0163162_10317935 | 3300013306 | Bacteria | 1689 |
| 84 | Ga0157379_10074264 | 3300014968 | Bacteria | 3044 |
| 85 | Ga0157376_10004723 | 3300014969 | Bacteria | 9491 |
| 86 | Ga0157376_10150118 | 3300014969 | Unclassified | 2101 |
| 87 | Ga0206356_10100362 | 3300020070 | Bacteria | 871 |
| 88 | Ga0206356_10362423 | 3300020070 | Bacteria | 887 |
| 89 | Ga0213876_10008413 | 3300021384 | Bacteria | 5583 |
| 90 | Ga0213875_10174760 | 3300021388 | Bacteria | 1009 |
| 91 | Ga0224712_10193319 | 3300022467 | Bacteria | 922 |
| 92 | Ga0207699_10051072 | 3300025906 | Bacteria | 2442 |
| 93 | Ga0207705_10023793 | 3300025909 | Bacteria | 4370 |
| 94 | Ga0207654_10003375 | 3300025911 | Bacteria | 8086 |
| 95 | Ga0207707_10234267 | 3300025912 | Bacteria | 1597 |
| 96 | Ga0207707_10442772 | 3300025912 | Bacteria | 1112 |
| 97 | Ga0207695_10000644 | 3300025913 | Bacteria | 69302 |
| 98 | Ga0207695_10001230 | 3300025913 | Bacteria | 43841 |
| 99 | Ga0207695_10007581 | 3300025913 | Bacteria | 13760 |
| 100 | Ga0207671_10000311 | 3300025914 | Bacteria | 71753 |
| 101 | Ga0207671_10006411 | 3300025914 | Bacteria | 10481 |
| 102 | Ga0207671_10284466 | 3300025914 | Bacteria | 1305 |
| 103 | Ga0207663_10024703 | 3300025916 | Bacteria | 3464 |
| 104 | Ga0207657_10071393 | 3300025919 | Bacteria | 2940 |
| 105 | Ga0207652_10051747 | 3300025921 | Bacteria | 3522 |
| 106 | Ga0207694_10074632 | 3300025924 | Bacteria | 2654 |
| 107 | Ga0207694_10881203 | 3300025924 | Bacteria | 757 |
| 108 | Ga0207700_10367809 | 3300025928 | Unclassified | 1255 |
| 109 | Ga0207664_10232791 | 3300025929 | Bacteria | 1602 |
| 110 | Ga0207686_10705281 | 3300025934 | Bacteria | 802 |
| 111 | Ga0207686_10932542 | 3300025934 | Bacteria | 702 |
| 112 | Ga0207670_10051616 | 3300025936 | Bacteria | 2762 |
| 113 | Ga0207670_10123629 | 3300025936 | Bacteria | 1885 |
| 114 | Ga0207670_10441420 | 3300025936 | Bacteria | 1048 |
| 115 | Ga0207665_10145516 | 3300025939 | Bacteria | 1693 |
| 116 | Ga0207661_10503641 | 3300025944 | Bacteria | 1106 |
| 117 | Ga0207667_10008712 | 3300025949 | Bacteria | 12024 |
| 118 | Ga0207667_10043352 | 3300025949 | Bacteria | 4775 |
| 119 | Ga0207667_11338619 | 3300025949 | Bacteria | 691 |
| 120 | Ga0207712_10111709 | 3300025961 | Bacteria | 2051 |
| 121 | Ga0207703_10489710 | 3300026035 | Bacteria | 1153 |
| 122 | Ga0207639_10027496 | 3300026041 | Bacteria | 4145 |
| 123 | Ga0207639_10221049 | 3300026041 | Bacteria | 1636 |
| 124 | Ga0207702_10094504 | 3300026078 | Bacteria | 2624 |
| 125 | Ga0207702_10660274 | 3300026078 | Bacteria | 1029 |
| 126 | Ga0207674_10001580 | 3300026116 | Bacteria | 29324 |
| 127 | Ga0207674_10543106 | 3300026116 | Bacteria | 1123 |
| 128 | Ga0207698_10682781 | 3300026142 | Bacteria | 1020 |
| 129 | Ga0268266_10461020 | 3300028379 | Bacteria | 1209 |
| 130 | Ga0268265_10382302 | 3300028380 | Bacteria | 1296 |
| 131 | Ga0268264_10087177 | 3300028381 | Bacteria | 2684 |
| 132 | Ga0268264_10719069 | 3300028381 | Bacteria | 993 |
| 133 | Ga0265337_1000857 | 3300028556 | Bacteria | 15970 |
| 134 | Ga0265337_1003425 | 3300028556 | Bacteria | 6880 |
| 135 | Ga0265326_10028447 | 3300028558 | Bacteria | 1592 |
| 136 | Ga0265326_10111551 | 3300028558 | Bacteria | 777 |
| 137 | Ga0265319_1048852 | 3300028563 | Bacteria | 1403 |
| 138 | Ga0265334_10008684 | 3300028573 | Bacteria | 4313 |
| 139 | Ga0265318_10045392 | 3300028577 | Bacteria | 1661 |
| 140 | Ga0265323_10023621 | 3300028653 | Bacteria | 2343 |
| 141 | Ga0265336_10000642 | 3300028666 | Bacteria | 19093 |
| 142 | Ga0265338_10000312 | 3300028800 | Bacteria | 87999 |
| 143 | Ga0265338_10000533 | 3300028800 | Bacteria | 66710 |
| 144 | Ga0265338_10000660 | 3300028800 | Bacteria | 59683 |
| 145 | Ga0265338_10000987 | 3300028800 | Bacteria | 47972 |
| 146 | Ga0265338_10004362 | 3300028800 | Bacteria | 19148 |
| 147 | Ga0265338_10009506 | 3300028800 | Bacteria | 11580 |
| 148 | Ga0265338_10049434 | 3300028800 | Bacteria | 3812 |
| 149 | Ga0265338_10050359 | 3300028800 | Bacteria | 3766 |
| 150 | Ga0265338_10344143 | 3300028800 | Bacteria | 1074 |
| 151 | Ga0265324_10001345 | 3300029957 | Bacteria | 14370 |
| 152 | Ga0265324_10001949 | 3300029957 | Bacteria | 11060 |
| 153 | Ga0265324_10010716 | 3300029957 | Bacteria | 3519 |
| 154 | Ga0265324_10039110 | 3300029957 | Bacteria | 1645 |
| 155 | Ga0307511_10000201 | 3300030521 | Bacteria | 60079 |
| 156 | Ga0265320_10004502 | 3300031240 | Bacteria | 9122 |
| 157 | Ga0265320_10019762 | 3300031240 | Bacteria | 3672 |
| 158 | Ga0265320_10019929 | 3300031240 | Bacteria | 3651 |
| 159 | Ga0265325_10062784 | 3300031241 | Bacteria | 1881 |
| 160 | Ga0265329_10002220 | 3300031242 | Bacteria | 8961 |
| 161 | Ga0265329_10051693 | 3300031242 | Bacteria | 1308 |
| 162 | Ga0265340_10001685 | 3300031247 | Bacteria | 12716 |
| 163 | Ga0265339_10095155 | 3300031249 | Bacteria | 1556 |
| 164 | Ga0265339_10161455 | 3300031249 | Bacteria | 1127 |
| 165 | Ga0265339_10220256 | 3300031249 | Bacteria | 928 |
| 166 | Ga0265327_10010061 | 3300031251 | Bacteria | 6712 |
| 167 | Ga0265327_10012797 | 3300031251 | Bacteria | 5630 |
| 168 | Ga0265327_10017929 | 3300031251 | Bacteria | 4415 |
| 169 | Ga0265316_10031706 | 3300031344 | Bacteria | 4319 |
| 170 | Ga0265314_10000284 | 3300031711 | Bacteria | 73660 |
| 171 | Ga0265314_10067256 | 3300031711 | Bacteria | 2414 |
| 172 | Ga0265314_10083701 | 3300031711 | Bacteria | 2096 |
| 173 | Ga0265314_10236605 | 3300031711 | Bacteria | 1056 |
| 174 | Ga0265342_10024928 | 3300031712 | Bacteria | 3769 |
| 175 | Ga0265342_10153294 | 3300031712 | Bacteria | 1278 |
| 176 | Ga0307516_10003458 | 3300031730 | Bacteria | 20249 |
| 177 | Ga0307516_10125096 | 3300031730 | Bacteria | 2357 |
| 178 | Ga0307409_100960045 | 3300031995 | Bacteria | 871 |
| 179 | Ga0307416_100243490 | 3300032002 | Bacteria | 1745 |
| 180 | Ga0373929_0003301 | 3300035085 | Bacteria | 2915 |
| 181 | Ga0373934_0002377 | 3300035086 | Bacteria | 6922 |
| 182 | Ga0373944_0000132 | 3300035089 | Bacteria | 14214 |
| 183 | Ga0373944_0035078 | 3300035089 | Bacteria | 1527 |
| 184 | Ga0373949_0002990 | 3300035090 | Bacteria | 4153 |
| 185 | Ga0373923_0058848 | 3300035111 | Bacteria | 1628 |
| 186 | Ga0373923_0222990 | 3300035111 | Bacteria | 877 |
| 187 | Ga0373932_0000002 | 3300035112 | Bacteria | 711821 |
| 188 | Ga0373945_0003202 | 3300035116 | Bacteria | 5136 |
| 189 | Ga0373945_0135890 | 3300035116 | Bacteria | 988 |
| 190 | Ga0373954_0005071 | 3300035118 | Bacteria | 5682 |
| 191 | Ga0373954_0043974 | 3300035118 | Bacteria | 2083 |
| 192 | Ga0373957_0008643 | 3300035120 | Bacteria | 3309 |
| 193 | Ga0373962_0000288 | 3300035242 | Bacteria | 10795 |
| 194 | Ga0373924_0001343 | 3300035410 | Bacteria | 7929 |
| 195 | Ga0373931_0000012 | 3300035691 | Bacteria | 267735 |
| 196 | Ga0373935_0082725 | 3300035692 | Bacteria | 2089 |
| 197 | Ga0373927_0007114 | 3300035695 | Bacteria | 7592 |
| 198 | Ga0373927_0039605 | 3300035695 | Bacteria | 3059 |
| 199 | Ga0373933_0110133 | 3300035724 | Bacteria | 1717 |
| 200 | Ga0373947_0007695 | 3300035725 | Bacteria | 6226 |
| 201 | Ga0373947_0048406 | 3300035725 | Bacteria | 2551 |
| 202 | Ga0373947_0248187 | 3300035725 | Bacteria | 1176 |
| 203 | Ga0373937_0001967 | 3300036401 | Bacteria | 17189 |
| 204 | Ga0373937_0031750 | 3300036401 | Bacteria | 4787 |
| 205 | Ga0373937_0057666 | 3300036401 | Bacteria | 3568 |
| 206 | Ga0373937_0122049 | 3300036401 | Bacteria | 2429 |
| 207 | Ga0373925_0000233 | 3300037068 | Bacteria | 58605 |
| 208 | Ga0373925_0003298 | 3300037068 | Bacteria | 12546 |
| 209 | Ga0373925_0373094 | 3300037068 | Bacteria | 1161 |
| 210 | Ga0436365_0099926 | 3300039437 | Bacteria | 10247 |
| 211 | Ga0436360_0258315 | 3300039438 | Bacteria | 2845 |
| 212 | Ga0436360_0434891 | 3300039438 | Bacteria | 3721 |
| 213 | Ga0436361_0216155 | 3300039447 | Bacteria | 8025 |
| 214 | Ga0436362_0149729 | 3300039453 | Bacteria | 2421 |
| 215 | Ga0436362_0436962 | 3300039453 | Bacteria | 2611 |
| 216 | Ga0451804_1146158 | 3300041463 | Bacteria | 887 |
| 217 | Ga0451577_0006166 | 3300042876 | Bacteria | 12047 |
| 218 | Ga0451577_0959112 | 3300042876 | Bacteria | 769 |
| 219 | Ga0466972_0042511 | 3300044658 | Bacteria | 2209 |
| 220 | Ga0453684_0003504 | 3300044712 | Bacteria | 35230 |
| 221 | Ga0453684_0058137 | 3300044712 | Bacteria | 4997 |
| 222 | Ga0453684_0205429 | 3300044712 | Bacteria | 2293 |
| 223 | Ga0453684_0206052 | 3300044712 | Bacteria | 2289 |
| 224 | Ga0453684_0889452 | 3300044712 | Bacteria | 954 |
| 225 | Ga0466959_0038894 | 3300045049 | Bacteria | 3515 |
| 226 | Ga0451576_0090760 | 3300045051 | Bacteria | 3178 |
| 227 | Ga0451576_0322981 | 3300045051 | Bacteria | 1615 |
| 228 | Ga0451576_0378426 | 3300045051 | Bacteria | 1484 |
| 229 | Ga0495592_0000101 | 3300046454 | Bacteria | 75856 |
| 230 | Ga0495592_0211409 | 3300046454 | Bacteria | 1302 |
| 231 | Ga0495590_0182104 | 3300046457 | Bacteria | 768 |
| 232 | Ga0495629_0097325 | 3300046459 | Bacteria | 2053 |
| 233 | Ga0495629_0595963 | 3300046459 | Bacteria | 739 |
| 234 | Ga0495651_0260314 | 3300046462 | Bacteria | 1181 |
| 235 | Ga0495580_0060736 | 3300046472 | Bacteria | 2655 |
| 236 | Ga0495664_0047785 | 3300046477 | Bacteria | 2540 |
| 237 | Ga0495618_0003223 | 3300046514 | Bacteria | 10223 |
| 238 | Ga0495618_0005077 | 3300046514 | Bacteria | 8040 |
| 239 | Ga0495628_0003986 | 3300046516 | Bacteria | 13155 |
| 240 | Ga0495628_0061346 | 3300046516 | Bacteria | 2949 |
| 241 | Ga0495630_0040765 | 3300046517 | Bacteria | 3470 |
| 242 | Ga0495630_0046837 | 3300046517 | Bacteria | 3233 |
| 243 | Ga0495630_0463168 | 3300046517 | Bacteria | 971 |
| 244 | Ga0495652_0079736 | 3300046529 | Bacteria | 2706 |
| 245 | Ga0495652_0132110 | 3300046529 | Bacteria | 1975 |
| 246 | Ga0495640_0024279 | 3300046533 | Bacteria | 4412 |
| 247 | Ga0495586_0007681 | 3300046535 | Bacteria | 5749 |
| 248 | Ga0495586_0014007 | 3300046535 | Bacteria | 4256 |
| 249 | Ga0495586_0097051 | 3300046535 | Bacteria | 1633 |
| 250 | Ga0495587_0159491 | 3300046536 | Bacteria | 1284 |
| 251 | Ga0495645_0119801 | 3300046543 | Bacteria | 1854 |
| 252 | Ga0495645_0258692 | 3300046543 | Bacteria | 1154 |
| 253 | Ga0495645_0354669 | 3300046543 | Bacteria | 944 |
| 254 | Ga0495622_0034206 | 3300046557 | Bacteria | 2371 |
| 255 | Ga0495667_0187125 | 3300046559 | Bacteria | 1328 |
| 256 | Ga0495634_0004225 | 3300046642 | Bacteria | 11337 |
| 257 | Ga0495634_0297078 | 3300046642 | Bacteria | 977 |
| 258 | Ga0495611_0001026 | 3300046648 | Bacteria | 14788 |
| 259 | Ga0495657_0218207 | 3300046675 | Bacteria | 1157 |
| 260 | Ga0495599_0015275 | 3300046678 | Bacteria | 4763 |
| 261 | Ga0495658_0080271 | 3300046683 | Bacteria | 1913 |
| 262 | Ga0495658_0199793 | 3300046683 | Bacteria | 1246 |
| 263 | Ga0495613_0007942 | 3300046689 | Bacteria | 7896 |
| 264 | Ga0495581_0215575 | 3300047315 | Bacteria | 1122 |
| 265 | Ga0495581_0236234 | 3300047315 | Bacteria | 1069 |
| 266 | Ga0495604_0129932 | 3300047317 | Bacteria | 1812 |
| 267 | Ga0495604_0622830 | 3300047317 | Bacteria | 690 |
| 268 | Ga0495674_0074120 | 3300047319 | Bacteria | 2933 |
| 269 | Ga0495674_0148682 | 3300047319 | Bacteria | 1965 |
| 270 | Ga0495676_0653485 | 3300047321 | Bacteria | 682 |
| 271 | Ga0495680_0009671 | 3300047322 | Bacteria | 8651 |
| 272 | Ga0495675_0204496 | 3300047444 | Bacteria | 1201 |
| 273 | Ga0495684_0012249 | 3300047471 | Bacteria | 6616 |
| 274 | Ga0495684_0124479 | 3300047471 | Bacteria | 1940 |
| 275 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 276 | Ga0495602_0475813 | 3300048088 | Eukaryota | 877 |
| 277 | Ga0496112_0104739 | 3300048915 | Bacteria | 2799 |
| 278 | Ga0496115_0211702 | 3300048918 | Bacteria | 1601 |
| 279 | Ga0496125_0144331 | 3300048928 | Bacteria | 1649 |
| 280 | Ga0501043_0217037 | 3300049579 | Bacteria | 1481 |
| 281 | nmdc:mga08y16_10985_c1 | 3300050511 | Bacteria | 9506 |
| 282 | nmdc:mga08y16_609884_c1 | 3300050511 | Bacteria | 1099 |
| 283 | nmdc:mga08y16_642618_c1 | 3300050511 | Bacteria | 1066 |
| 284 | nmdc:mga0n895_801957_c1 | 3300050512 | Bacteria | 932 |
| 285 | nmdc:mga0a205_301163_c1 | 3300050515 | Bacteria | 1476 |
| 286 | Ga0495612_0140916 | 3300053078 | Bacteria | 1046 |
| 287 | Ga0495619_0597268 | 3300053085 | Eukaryota | 755 |
| 288 | Ga0500643_013526 | 3300053087 | Bacteria | 2878 |
| 289 | Ga0500616_0103885 | 3300053153 | Bacteria | 1384 |
| 290 | Ga0590077_067773 | 3300059426 | Bacteria | 813 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0060736 | Ga0495580_0060736_153_698 | 176 |
| 2 | 3300003316 | rootH1_10146062 | rootH1_101460626 | 191 |
| 3 | 3300005341 | Ga0070691_10097695 | Ga0070691_100976952 | 191 |
| 4 | 3300005539 | Ga0068853_100007548 | Ga0068853_1000075489 | 191 |
| 5 | 3300005539 | Ga0068853_100240485 | Ga0068853_1002404852 | 191 |
| 6 | 3300005614 | Ga0068856_100116103 | Ga0068856_1001161031 | 191 |
| 7 | 3300005616 | Ga0068852_100259976 | Ga0068852_1002599762 | 191 |
| 8 | 3300009093 | Ga0105240_10000800 | Ga0105240_1000080032 | 191 |
| 9 | 3300009093 | Ga0105240_10228652 | Ga0105240_102286522 | 191 |
| 10 | 3300009174 | Ga0105241_10007561 | Ga0105241_100075612 | 191 |
| 11 | 3300009174 | Ga0105241_10612378 | Ga0105241_106123782 | 191 |
| 12 | 3300009545 | Ga0105237_10000453 | Ga0105237_1000045360 | 191 |
| 13 | 3300009545 | Ga0105237_10013605 | Ga0105237_100136052 | 191 |
| 14 | 3300009551 | Ga0105238_10000592 | Ga0105238_1000059213 | 191 |
| 15 | 3300009551 | Ga0105238_10241645 | Ga0105238_102416452 | 191 |
| 16 | 3300010375 | Ga0105239_10001405 | Ga0105239_1000140520 | 191 |
| 17 | 3300010375 | Ga0105239_10133521 | Ga0105239_101335214 | 191 |
| 18 | 3300013105 | Ga0157369_10750280 | Ga0157369_107502802 | 191 |
| 19 | 3300021384 | Ga0213876_10008413 | Ga0213876_100084132 | 191 |
| 20 | 3300025911 | Ga0207654_10003375 | Ga0207654_100033756 | 191 |
| 21 | 3300025913 | Ga0207695_10001230 | Ga0207695_1000123036 | 191 |
| 22 | 3300025914 | Ga0207671_10000311 | Ga0207671_1000031117 | 191 |
| 23 | 3300025914 | Ga0207671_10284466 | Ga0207671_102844661 | 191 |
| 24 | 3300025924 | Ga0207694_10074632 | Ga0207694_100746324 | 191 |
| 25 | 3300025934 | Ga0207686_10932542 | Ga0207686_109325421 | 191 |
| 26 | 3300026041 | Ga0207639_10027496 | Ga0207639_100274964 | 191 |
| 27 | 3300026041 | Ga0207639_10221049 | Ga0207639_102210491 | 191 |
| 28 | 3300026078 | Ga0207702_10660274 | Ga0207702_106602742 | 191 |
| 29 | 3300026142 | Ga0207698_10682781 | Ga0207698_106827812 | 191 |
| 30 | 3300028381 | Ga0268264_10719069 | Ga0268264_107190692 | 191 |
| 31 | 3300030521 | Ga0307511_10000201 | Ga0307511_1000020157 | 191 |
| 32 | 3300031730 | Ga0307516_10003458 | Ga0307516_1000345810 | 191 |
| 33 | 3300031730 | Ga0307516_10125096 | Ga0307516_101250964 | 191 |
| 34 | 3300039437 | Ga0436365_0099926 | Ga0436365_0099926_471_1103 | 191 |
| 35 | 3300039453 | Ga0436362_0149729 | Ga0436362_0149729_1144_1776 | 191 |
| 36 | 3300046648 | Ga0495611_0001026 | Ga0495611_0001026_5836_6441 | 191 |
| 37 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_529795_530400 | 191 |
| 38 | 3300006237 | Ga0097621_100047179 | Ga0097621_1000471794 | 192 |
| 39 | 3300014969 | Ga0157376_10004723 | Ga0157376_100047237 | 192 |
| 40 | 3300014969 | Ga0157376_10150118 | Ga0157376_101501181 | 192 |
| 41 | 3300035111 | Ga0373923_0222990 | Ga0373923_0222990_128_733 | 192 |
| 42 | 3300035725 | Ga0373947_0248187 | Ga0373947_0248187_509_1114 | 192 |
| 43 | 3300036401 | Ga0373937_0057666 | Ga0373937_0057666_980_1585 | 192 |
| 44 | 3300036401 | Ga0373937_0122049 | Ga0373937_0122049_1220_1825 | 192 |
| 45 | 3300046462 | Ga0495651_0260314 | Ga0495651_0260314_43_648 | 192 |
| 46 | 3300046517 | Ga0495630_0046837 | Ga0495630_0046837_1722_2327 | 192 |
| 47 | 3300046529 | Ga0495652_0132110 | Ga0495652_0132110_660_1265 | 192 |
| 48 | 3300046535 | Ga0495586_0097051 | Ga0495586_0097051_333_938 | 192 |
| 49 | 3300046543 | Ga0495645_0258692 | Ga0495645_0258692_31_636 | 192 |
| 50 | 3300046559 | Ga0495667_0187125 | Ga0495667_0187125_493_1098 | 192 |
| 51 | 3300046683 | Ga0495658_0080271 | Ga0495658_0080271_631_1236 | 192 |
| 52 | 3300047317 | Ga0495604_0129932 | Ga0495604_0129932_557_1162 | 192 |
| 53 | 3300047319 | Ga0495674_0148682 | Ga0495674_0148682_1099_1704 | 192 |
| 54 | 3300047471 | Ga0495684_0124479 | Ga0495684_0124479_555_1160 | 192 |
| 55 | 3300048088 | Ga0495602_0475813 | Ga0495602_0475813_186_791 | 192 |
| 56 | 3300048918 | Ga0496115_0211702 | Ga0496115_0211702_550_1155 | 192 |
| 57 | 3300053085 | Ga0495619_0597268 | Ga0495619_0597268_77_682 | 192 |
| 58 | iso_pu_bacteria | 2524614857 | 2526061020 | 192 |
| 59 | iso_pu_bacteria | 2739367875 | 2740062484 | 192 |
| 60 | 3300005327 | Ga0070658_10580550 | Ga0070658_105805501 | 195 |
| 61 | 3300005614 | Ga0068856_100000264 | Ga0068856_10000026447 | 195 |
| 62 | 3300026078 | Ga0207702_10094504 | Ga0207702_100945042 | 195 |
| 63 | 3300028558 | Ga0265326_10028447 | Ga0265326_100284471 | 195 |
| 64 | 3300029957 | Ga0265324_10001345 | Ga0265324_100013452 | 195 |
| 65 | 3300031241 | Ga0265325_10062784 | Ga0265325_100627842 | 195 |
| 66 | 3300031251 | Ga0265327_10010061 | Ga0265327_100100614 | 195 |
| 67 | 3300035085 | Ga0373929_0003301 | Ga0373929_0003301_2215_2823 | 195 |
| 68 | 3300035089 | Ga0373944_0000132 | Ga0373944_0000132_8531_9253 | 195 |
| 69 | 3300035090 | Ga0373949_0002990 | Ga0373949_0002990_1032_1754 | 195 |
| 70 | 3300035112 | Ga0373932_0000002 | Ga0373932_0000002_213913_214635 | 195 |
| 71 | 3300035116 | Ga0373945_0135890 | Ga0373945_0135890_189_911 | 195 |
| 72 | 3300035242 | Ga0373962_0000288 | Ga0373962_0000288_4645_5367 | 195 |
| 73 | 3300035691 | Ga0373931_0000012 | Ga0373931_0000012_213932_214654 | 195 |
| 74 | 3300035695 | Ga0373927_0007114 | Ga0373927_0007114_461_1183 | 195 |
| 75 | 3300035725 | Ga0373947_0048406 | Ga0373947_0048406_738_1460 | 195 |
| 76 | 3300037068 | Ga0373925_0000233 | Ga0373925_0000233_18958_19680 | 195 |
| 77 | 3300041463 | Ga0451804_1146158 | Ga0451804_1146158_157_765 | 195 |
| 78 | 3300044712 | Ga0453684_0206052 | Ga0453684_0206052_1128_1736 | 195 |
| 79 | 3300005544 | Ga0070686_100422078 | Ga0070686_1004220781 | 196 |
| 80 | 3300007265 | Ga0099794_10059275 | Ga0099794_100592752 | 196 |
| 81 | 3300031251 | Ga0265327_10012797 | Ga0265327_100127976 | 196 |
| 82 | 3300046536 | Ga0495587_0159491 | Ga0495587_0159491_186_812 | 196 |
| 83 | 3300046543 | Ga0495645_0354669 | Ga0495645_0354669_104_730 | 196 |
| 84 | 3300047317 | Ga0495604_0622830 | Ga0495604_0622830_10_636 | 196 |
| 85 | 3300047444 | Ga0495675_0204496 | Ga0495675_0204496_520_1146 | 196 |
| 86 | 3300049579 | Ga0501043_0217037 | Ga0501043_0217037_349_966 | 196 |
| 87 | 3300005327 | Ga0070658_10004736 | Ga0070658_100047365 | 197 |
| 88 | 3300005327 | Ga0070658_10123998 | Ga0070658_101239983 | 197 |
| 89 | 3300005329 | Ga0070683_100045102 | Ga0070683_1000451021 | 197 |
| 90 | 3300005339 | Ga0070660_100287108 | Ga0070660_1002871081 | 197 |
| 91 | 3300005340 | Ga0070689_100108846 | Ga0070689_1001088463 | 197 |
| 92 | 3300005340 | Ga0070689_100381955 | Ga0070689_1003819552 | 197 |
| 93 | 3300005343 | Ga0070687_100537726 | Ga0070687_1005377261 | 197 |
| 94 | 3300005438 | Ga0070701_10051398 | Ga0070701_100513983 | 197 |
| 95 | 3300005439 | Ga0070711_100013623 | Ga0070711_1000136235 | 197 |
| 96 | 3300005444 | Ga0070694_100030410 | Ga0070694_1000304101 | 197 |
| 97 | 3300005458 | Ga0070681_10325124 | Ga0070681_103251241 | 197 |
| 98 | 3300005535 | Ga0070684_100228318 | Ga0070684_1002283182 | 197 |
| 99 | 3300005544 | Ga0070686_100319092 | Ga0070686_1003190921 | 197 |
| 100 | 3300005549 | Ga0070704_100109747 | Ga0070704_1001097472 | 197 |
| 101 | 3300005549 | Ga0070704_101134644 | Ga0070704_1011346441 | 197 |
| 102 | 3300005563 | Ga0068855_100030998 | Ga0068855_1000309984 | 197 |
| 103 | 3300005577 | Ga0068857_100846614 | Ga0068857_1008466142 | 197 |
| 104 | 3300005614 | Ga0068856_100858888 | Ga0068856_1008588882 | 197 |
| 105 | 3300005614 | Ga0068856_101221917 | Ga0068856_1012219172 | 197 |
| 106 | 3300005617 | Ga0068859_100003005 | Ga0068859_10000300517 | 197 |
| 107 | 3300005617 | Ga0068859_100835022 | Ga0068859_1008350221 | 197 |
| 108 | 3300005841 | Ga0068863_100318249 | Ga0068863_1003182492 | 197 |
| 109 | 3300005842 | Ga0068858_100769504 | Ga0068858_1007695041 | 197 |
| 110 | 3300005842 | Ga0068858_101157372 | Ga0068858_1011573721 | 197 |
| 111 | 3300005844 | Ga0068862_100231924 | Ga0068862_1002319242 | 197 |
| 112 | 3300005844 | Ga0068862_101155797 | Ga0068862_1011557971 | 197 |
| 113 | 3300005937 | Ga0081455_10076250 | Ga0081455_100762502 | 197 |
| 114 | 3300005985 | Ga0081539_10007177 | Ga0081539_100071776 | 197 |
| 115 | 3300006237 | Ga0097621_100428125 | Ga0097621_1004281252 | 197 |
| 116 | 3300006871 | Ga0075434_100090015 | Ga0075434_1000900151 | 197 |
| 117 | 3300006931 | Ga0097620_100003005 | Ga0097620_10000300517 | 197 |
| 118 | 3300006931 | Ga0097620_100835061 | Ga0097620_1008350611 | 197 |
| 119 | 3300009093 | Ga0105240_10000550 | Ga0105240_100005506 | 197 |
| 120 | 3300009093 | Ga0105240_10112661 | Ga0105240_101126612 | 197 |
| 121 | 3300009093 | Ga0105240_10682556 | Ga0105240_106825561 | 197 |
| 122 | 3300009094 | Ga0111539_10199072 | Ga0111539_101990721 | 197 |
| 123 | 3300009094 | Ga0111539_10742996 | Ga0111539_107429962 | 197 |
| 124 | 3300009176 | Ga0105242_10005448 | Ga0105242_100054488 | 197 |
| 125 | 3300009545 | Ga0105237_10007396 | Ga0105237_1000739615 | 197 |
| 126 | 3300009551 | Ga0105238_10745209 | Ga0105238_107452092 | 197 |
| 127 | 3300009553 | Ga0105249_11140849 | Ga0105249_111408491 | 197 |
| 128 | 3300013105 | Ga0157369_10935170 | Ga0157369_109351701 | 197 |
| 129 | 3300014968 | Ga0157379_10074264 | Ga0157379_100742644 | 197 |
| 130 | 3300020070 | Ga0206356_10362423 | Ga0206356_103624232 | 197 |
| 131 | 3300025909 | Ga0207705_10023793 | Ga0207705_100237932 | 197 |
| 132 | 3300025912 | Ga0207707_10442772 | Ga0207707_104427722 | 197 |
| 133 | 3300025913 | Ga0207695_10000644 | Ga0207695_100006446 | 197 |
| 134 | 3300025913 | Ga0207695_10007581 | Ga0207695_100075818 | 197 |
| 135 | 3300025914 | Ga0207671_10006411 | Ga0207671_100064112 | 197 |
| 136 | 3300025916 | Ga0207663_10024703 | Ga0207663_100247033 | 197 |
| 137 | 3300025919 | Ga0207657_10071393 | Ga0207657_100713933 | 197 |
| 138 | 3300025924 | Ga0207694_10881203 | Ga0207694_108812031 | 197 |
| 139 | 3300025928 | Ga0207700_10367809 | Ga0207700_103678092 | 197 |
| 140 | 3300025929 | Ga0207664_10232791 | Ga0207664_102327912 | 197 |
| 141 | 3300025934 | Ga0207686_10705281 | Ga0207686_107052812 | 197 |
| 142 | 3300025936 | Ga0207670_10051616 | Ga0207670_100516162 | 197 |
| 143 | 3300025936 | Ga0207670_10123629 | Ga0207670_101236291 | 197 |
| 144 | 3300025936 | Ga0207670_10441420 | Ga0207670_104414201 | 197 |
| 145 | 3300025944 | Ga0207661_10503641 | Ga0207661_105036411 | 197 |
| 146 | 3300025949 | Ga0207667_10008712 | Ga0207667_100087129 | 197 |
| 147 | 3300025949 | Ga0207667_10043352 | Ga0207667_100433522 | 197 |
| 148 | 3300025949 | Ga0207667_11338619 | Ga0207667_113386191 | 197 |
| 149 | 3300025961 | Ga0207712_10111709 | Ga0207712_101117092 | 197 |
| 150 | 3300026116 | Ga0207674_10001580 | Ga0207674_1000158021 | 197 |
| 151 | 3300026116 | Ga0207674_10543106 | Ga0207674_105431063 | 197 |
| 152 | 3300028379 | Ga0268266_10461020 | Ga0268266_104610201 | 197 |
| 153 | 3300028380 | Ga0268265_10382302 | Ga0268265_103823022 | 197 |
| 154 | 3300028381 | Ga0268264_10087177 | Ga0268264_100871772 | 197 |
| 155 | 3300028556 | Ga0265337_1000857 | Ga0265337_100085726 | 197 |
| 156 | 3300028556 | Ga0265337_1003425 | Ga0265337_10034255 | 197 |
| 157 | 3300028558 | Ga0265326_10111551 | Ga0265326_101115511 | 197 |
| 158 | 3300028563 | Ga0265319_1048852 | Ga0265319_10488522 | 197 |
| 159 | 3300028573 | Ga0265334_10008684 | Ga0265334_100086844 | 197 |
| 160 | 3300028577 | Ga0265318_10045392 | Ga0265318_100453922 | 197 |
| 161 | 3300028653 | Ga0265323_10023621 | Ga0265323_100236212 | 197 |
| 162 | 3300028666 | Ga0265336_10000642 | Ga0265336_100006423 | 197 |
| 163 | 3300028800 | Ga0265338_10000312 | Ga0265338_1000031237 | 197 |
| 164 | 3300028800 | Ga0265338_10000533 | Ga0265338_1000053362 | 197 |
| 165 | 3300028800 | Ga0265338_10000660 | Ga0265338_1000066037 | 197 |
| 166 | 3300028800 | Ga0265338_10000987 | Ga0265338_100009872 | 197 |
| 167 | 3300028800 | Ga0265338_10004362 | Ga0265338_1000436213 | 197 |
| 168 | 3300028800 | Ga0265338_10009506 | Ga0265338_100095067 | 197 |
| 169 | 3300028800 | Ga0265338_10049434 | Ga0265338_100494342 | 197 |
| 170 | 3300028800 | Ga0265338_10050359 | Ga0265338_100503592 | 197 |
| 171 | 3300028800 | Ga0265338_10344143 | Ga0265338_103441432 | 197 |
| 172 | 3300029957 | Ga0265324_10001949 | Ga0265324_100019495 | 197 |
| 173 | 3300029957 | Ga0265324_10010716 | Ga0265324_100107164 | 197 |
| 174 | 3300029957 | Ga0265324_10039110 | Ga0265324_100391102 | 197 |
| 175 | 3300031240 | Ga0265320_10004502 | Ga0265320_100045025 | 197 |
| 176 | 3300031240 | Ga0265320_10019762 | Ga0265320_100197625 | 197 |
| 177 | 3300031240 | Ga0265320_10019929 | Ga0265320_100199293 | 197 |
| 178 | 3300031242 | Ga0265329_10051693 | Ga0265329_100516932 | 197 |
| 179 | 3300031247 | Ga0265340_10001685 | Ga0265340_1000168515 | 197 |
| 180 | 3300031249 | Ga0265339_10095155 | Ga0265339_100951552 | 197 |
| 181 | 3300031249 | Ga0265339_10161455 | Ga0265339_101614552 | 197 |
| 182 | 3300031249 | Ga0265339_10220256 | Ga0265339_102202562 | 197 |
| 183 | 3300031251 | Ga0265327_10017929 | Ga0265327_100179294 | 197 |
| 184 | 3300031711 | Ga0265314_10083701 | Ga0265314_100837011 | 197 |
| 185 | 3300031711 | Ga0265314_10236605 | Ga0265314_102366051 | 197 |
| 186 | 3300031712 | Ga0265342_10024928 | Ga0265342_100249282 | 197 |
| 187 | 3300031712 | Ga0265342_10153294 | Ga0265342_101532943 | 197 |
| 188 | 3300035089 | Ga0373944_0035078 | Ga0373944_0035078_609_1238 | 197 |
| 189 | 3300035118 | Ga0373954_0043974 | Ga0373954_0043974_1268_1882 | 197 |
| 190 | 3300035695 | Ga0373927_0039605 | Ga0373927_0039605_791_1420 | 197 |
| 191 | 3300035724 | Ga0373933_0110133 | Ga0373933_0110133_599_1213 | 197 |
| 192 | 3300035725 | Ga0373947_0007695 | Ga0373947_0007695_1623_2252 | 197 |
| 193 | 3300036401 | Ga0373937_0031750 | Ga0373937_0031750_795_1409 | 197 |
| 194 | 3300037068 | Ga0373925_0003298 | Ga0373925_0003298_10241_10870 | 197 |
| 195 | 3300037068 | Ga0373925_0373094 | Ga0373925_0373094_507_1136 | 197 |
| 196 | 3300042876 | Ga0451577_0006166 | Ga0451577_0006166_6638_7258 | 197 |
| 197 | 3300042876 | Ga0451577_0959112 | Ga0451577_0959112_64_693 | 197 |
| 198 | 3300044658 | Ga0466972_0042511 | Ga0466972_0042511_212_817 | 197 |
| 199 | 3300044712 | Ga0453684_0003504 | Ga0453684_0003504_26144_26773 | 197 |
| 200 | 3300044712 | Ga0453684_0205429 | Ga0453684_0205429_489_1109 | 197 |
| 201 | 3300044712 | Ga0453684_0889452 | Ga0453684_0889452_159_779 | 197 |
| 202 | 3300045049 | Ga0466959_0038894 | Ga0466959_0038894_1800_2405 | 197 |
| 203 | 3300045051 | Ga0451576_0090760 | Ga0451576_0090760_2160_2780 | 197 |
| 204 | 3300045051 | Ga0451576_0322981 | Ga0451576_0322981_222_836 | 197 |
| 205 | 3300045051 | Ga0451576_0378426 | Ga0451576_0378426_644_1273 | 197 |
| 206 | 3300046454 | Ga0495592_0000101 | Ga0495592_0000101_8264_8893 | 197 |
| 207 | 3300046454 | Ga0495592_0211409 | Ga0495592_0211409_314_928 | 197 |
| 208 | 3300046459 | Ga0495629_0097325 | Ga0495629_0097325_33_647 | 197 |
| 209 | 3300046459 | Ga0495629_0595963 | Ga0495629_0595963_35_664 | 197 |
| 210 | 3300046477 | Ga0495664_0047785 | Ga0495664_0047785_47_676 | 197 |
| 211 | 3300046514 | Ga0495618_0003223 | Ga0495618_0003223_6791_7420 | 197 |
| 212 | 3300046514 | Ga0495618_0005077 | Ga0495618_0005077_1763_2377 | 197 |
| 213 | 3300046516 | Ga0495628_0003986 | Ga0495628_0003986_2286_2915 | 197 |
| 214 | 3300046516 | Ga0495628_0061346 | Ga0495628_0061346_1668_2282 | 197 |
| 215 | 3300046517 | Ga0495630_0040765 | Ga0495630_0040765_2549_3163 | 197 |
| 216 | 3300046517 | Ga0495630_0463168 | Ga0495630_0463168_46_675 | 197 |
| 217 | 3300046529 | Ga0495652_0079736 | Ga0495652_0079736_1883_2512 | 197 |
| 218 | 3300046533 | Ga0495640_0024279 | Ga0495640_0024279_44_673 | 197 |
| 219 | 3300046535 | Ga0495586_0007681 | Ga0495586_0007681_4922_5551 | 197 |
| 220 | 3300046535 | Ga0495586_0014007 | Ga0495586_0014007_1663_2277 | 197 |
| 221 | 3300046543 | Ga0495645_0119801 | Ga0495645_0119801_159_773 | 197 |
| 222 | 3300046557 | Ga0495622_0034206 | Ga0495622_0034206_617_1231 | 197 |
| 223 | 3300046642 | Ga0495634_0004225 | Ga0495634_0004225_6390_7004 | 197 |
| 224 | 3300046642 | Ga0495634_0297078 | Ga0495634_0297078_42_671 | 197 |
| 225 | 3300046675 | Ga0495657_0218207 | Ga0495657_0218207_71_685 | 197 |
| 226 | 3300046678 | Ga0495599_0015275 | Ga0495599_0015275_515_1144 | 197 |
| 227 | 3300046683 | Ga0495658_0199793 | Ga0495658_0199793_16_645 | 197 |
| 228 | 3300046689 | Ga0495613_0007942 | Ga0495613_0007942_2978_3592 | 197 |
| 229 | 3300047315 | Ga0495581_0215575 | Ga0495581_0215575_462_1091 | 197 |
| 230 | 3300047315 | Ga0495581_0236234 | Ga0495581_0236234_157_771 | 197 |
| 231 | 3300047319 | Ga0495674_0074120 | Ga0495674_0074120_1158_1787 | 197 |
| 232 | 3300047321 | Ga0495676_0653485 | Ga0495676_0653485_35_664 | 197 |
| 233 | 3300047322 | Ga0495680_0009671 | Ga0495680_0009671_2087_2701 | 197 |
| 234 | 3300048928 | Ga0496125_0144331 | Ga0496125_0144331_190_795 | 197 |
| 235 | 3300050511 | nmdc:mga08y16_642618_c1 | nmdc:mga08y16_642618_c1_188_817 | 197 |
| 236 | 3300050512 | nmdc:mga0n895_801957_c1 | nmdc:mga0n895_801957_c1_19_633 | 197 |
| 237 | 3300050515 | nmdc:mga0a205_301163_c1 | nmdc:mga0a205_301163_c1_549_1301 | 197 |
| 238 | 3300053153 | Ga0500616_0103885 | Ga0500616_0103885_10_624 | 197 |
| 239 | 3300004803 | Ga0058862_12643340 | Ga0058862_126433401 | 198 |
| 240 | 3300005329 | Ga0070683_100079932 | Ga0070683_1000799322 | 198 |
| 241 | 3300005434 | Ga0070709_10929795 | Ga0070709_109297951 | 198 |
| 242 | 3300005458 | Ga0070681_10091085 | Ga0070681_100910851 | 198 |
| 243 | 3300005530 | Ga0070679_100067144 | Ga0070679_1000671443 | 198 |
| 244 | 3300005842 | Ga0068858_100115442 | Ga0068858_1001154422 | 198 |
| 245 | 3300006844 | Ga0075428_100164991 | Ga0075428_1001649912 | 198 |
| 246 | 3300006847 | Ga0075431_100059780 | Ga0075431_1000597804 | 198 |
| 247 | 3300009094 | Ga0111539_10007727 | Ga0111539_100077277 | 198 |
| 248 | 3300013296 | Ga0157374_10239504 | Ga0157374_102395042 | 198 |
| 249 | 3300013306 | Ga0163162_10317935 | Ga0163162_103179352 | 198 |
| 250 | 3300020070 | Ga0206356_10100362 | Ga0206356_101003622 | 198 |
| 251 | 3300022467 | Ga0224712_10193319 | Ga0224712_101933191 | 198 |
| 252 | 3300025912 | Ga0207707_10234267 | Ga0207707_102342672 | 198 |
| 253 | 3300025921 | Ga0207652_10051747 | Ga0207652_100517472 | 198 |
| 254 | 3300026035 | Ga0207703_10489710 | Ga0207703_104897101 | 198 |
| 255 | 3300031242 | Ga0265329_10002220 | Ga0265329_100022207 | 198 |
| 256 | 3300031344 | Ga0265316_10031706 | Ga0265316_100317062 | 198 |
| 257 | 3300031711 | Ga0265314_10000284 | Ga0265314_1000028422 | 198 |
| 258 | 3300031711 | Ga0265314_10067256 | Ga0265314_100672563 | 198 |
| 259 | 3300031995 | Ga0307409_100960045 | Ga0307409_1009600451 | 198 |
| 260 | 3300032002 | Ga0307416_100243490 | Ga0307416_1002434902 | 198 |
| 261 | 3300035086 | Ga0373934_0002377 | Ga0373934_0002377_3358_3966 | 198 |
| 262 | 3300035111 | Ga0373923_0058848 | Ga0373923_0058848_650_1258 | 198 |
| 263 | 3300035116 | Ga0373945_0003202 | Ga0373945_0003202_48_686 | 198 |
| 264 | 3300035118 | Ga0373954_0005071 | Ga0373954_0005071_294_902 | 198 |
| 265 | 3300035120 | Ga0373957_0008643 | Ga0373957_0008643_742_1350 | 198 |
| 266 | 3300035410 | Ga0373924_0001343 | Ga0373924_0001343_752_1390 | 198 |
| 267 | 3300035692 | Ga0373935_0082725 | Ga0373935_0082725_1165_1773 | 198 |
| 268 | 3300036401 | Ga0373937_0001967 | Ga0373937_0001967_1288_1896 | 198 |
| 269 | 3300044712 | Ga0453684_0058137 | Ga0453684_0058137_3341_3958 | 198 |
| 270 | 3300046457 | Ga0495590_0182104 | Ga0495590_0182104_60_668 | 198 |
| 271 | 3300047471 | Ga0495684_0012249 | Ga0495684_0012249_914_1522 | 198 |
| 272 | 3300048915 | Ga0496112_0104739 | Ga0496112_0104739_366_1004 | 198 |
| 273 | 3300050511 | nmdc:mga08y16_10985_c1 | nmdc:mga08y16_10985_c1_1385_1996 | 198 |
| 274 | 3300053078 | Ga0495612_0140916 | Ga0495612_0140916_243_881 | 198 |
| 275 | 3300053087 | Ga0500643_013526 | Ga0500643_013526_1707_2309 | 198 |
| 276 | 3300059426 | Ga0590077_067773 | Ga0590077_067773_48_662 | 198 |
| 277 | 3300003203 | JGI25406J46586_10000056 | JGI25406J46586_1000005645 | 199 |
| 278 | 3300005434 | Ga0070709_10711797 | Ga0070709_107117971 | 199 |
| 279 | 3300005436 | Ga0070713_100776012 | Ga0070713_1007760122 | 199 |
| 280 | 3300005437 | Ga0070710_10344515 | Ga0070710_103445152 | 199 |
| 281 | 3300005437 | Ga0070710_10345142 | Ga0070710_103451422 | 199 |
| 282 | 3300005842 | Ga0068858_100432719 | Ga0068858_1004327191 | 199 |
| 283 | 3300005985 | Ga0081539_10000098 | Ga0081539_1000009892 | 199 |
| 284 | 3300009094 | Ga0111539_10387858 | Ga0111539_103878581 | 199 |
| 285 | 3300021388 | Ga0213875_10174760 | Ga0213875_101747601 | 199 |
| 286 | 3300025906 | Ga0207699_10051072 | Ga0207699_100510723 | 199 |
| 287 | 3300025939 | Ga0207665_10145516 | Ga0207665_101455161 | 199 |
| 288 | 3300039438 | Ga0436360_0258315 | Ga0436360_0258315_1131_1739 | 199 |
| 289 | 3300039438 | Ga0436360_0434891 | Ga0436360_0434891_1054_1692 | 199 |
| 290 | 3300039447 | Ga0436361_0216155 | Ga0436361_0216155_2202_2807 | 199 |
| 291 | 3300039453 | Ga0436362_0436962 | Ga0436362_0436962_653_1261 | 199 |
| 292 | 3300050511 | nmdc:mga08y16_609884_c1 | nmdc:mga08y16_609884_c1_74_688 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rcv-assembly4.cif.gz_F | crystal structure of the bacillus subtilis superoxide dismutase | 0.9848 | 2 | 199 |
| 2rcv-assembly2.cif.gz_H | crystal structure of the bacillus subtilis superoxide dismutase | 0.9848 | 2 | 199 |
| 1xuq-assembly1.cif.gz_B | crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. | 0.9842 | 3 | 199 |
| 2rcv-assembly3.cif.gz_D | crystal structure of the bacillus subtilis superoxide dismutase | 0.9824 | 2 | 199 |
| 1jr9-assembly1.cif.gz_A-2 | crystal structure of manganese superoxide dismutases from bacillus halodenitrificans | 0.9762 | 4 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rcvH01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 1.003 | 20 | 86 | 1.10.287.990 |
| 1xuqA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 1.001 | 20 | 89 | 1.10.287.990 |
| 2rcvG01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 1 | 20 | 86 | 1.10.287.990 |
| 2rcvA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9999 | 20 | 86 | 1.10.287.990 |
| 2rcvB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.999 | 20 | 86 | 1.10.287.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A5HE80-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9941 | 19 | 164 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A3M0Z9H9-F1-model_v4 | deleted | 0.994 | 1 | 134 |
|
| AF-A0A257V8P3-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9934 | 1 | 132 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-Q6XZA6-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.993 | 9 | 160 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A6B1GVD3-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9914 | 3 | 109 |
GO:0004784
GO:0005737 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar