F391207

General Info

Members Datasets Scaffolds Average Seq Length
292 175 290 207

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_301163_c1|nmdc:mga0a205_301163_c1_549_1301
Length 250
Sequence MVFDTAAVRWPTADIFRPLCAEKPSVTLLPQLEIKHQWKKNMAHELPPLPYPKDALEPHIDAMTMEIHHDKHHNAYVTNLNKAIAGNAALESKTIEALIGDLGSVPENIRGAVRNNGGGHANHSMFWKLLAPKAGGAPTGKLADDLKAAFGSFDAFKEKLEAAGVGRFGSGWAWLVVNGGKLEIVSTANQDSPLMGKAVAGCEGKPILGVDVWEHAYYLKYQNRRPDYLKAIWNVINWTEVAKNYEAAGK

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
84 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 1.37
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.03
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000056 3300003203 Bacteria 51828
2 rootH1_10146062 3300003316 Bacteria 3646
3 Ga0058862_12643340 3300004803 Bacteria 921
4 Ga0070658_10004736 3300005327 Bacteria 11067
5 Ga0070658_10123998 3300005327 Bacteria 2149
6 Ga0070658_10580550 3300005327 Bacteria 971
7 Ga0070683_100045102 3300005329 Bacteria 4069
8 Ga0070683_100079932 3300005329 Bacteria 3060
9 Ga0070660_100287108 3300005339 Bacteria 1347
10 Ga0070689_100108846 3300005340 Bacteria 2202
11 Ga0070689_100381955 3300005340 Bacteria 1187
12 Ga0070691_10097695 3300005341 Bacteria 1455
13 Ga0070687_100537726 3300005343 Bacteria 793
14 Ga0070709_10711797 3300005434 Bacteria 782
15 Ga0070709_10929795 3300005434 Bacteria 689
16 Ga0070713_100776012 3300005436 Bacteria 918
17 Ga0070710_10344515 3300005437 Bacteria 985
18 Ga0070710_10345142 3300005437 Bacteria 984
19 Ga0070701_10051398 3300005438 Bacteria 2138
20 Ga0070711_100013623 3300005439 Bacteria 5109
21 Ga0070694_100030410 3300005444 Bacteria 3532
22 Ga0070681_10091085 3300005458 Bacteria 3000
23 Ga0070681_10325124 3300005458 Bacteria 1448
24 Ga0070679_100067144 3300005530 Bacteria 3576
25 Ga0070684_100228318 3300005535 Bacteria 1699
26 Ga0068853_100007548 3300005539 Bacteria 8704
27 Ga0068853_100240485 3300005539 Bacteria 1659
28 Ga0070686_100319092 3300005544 Bacteria 1158
29 Ga0070686_100422078 3300005544 Bacteria 1019
30 Ga0070704_100109747 3300005549 Bacteria 2097
31 Ga0070704_101134644 3300005549 Bacteria 711
32 Ga0068855_100030998 3300005563 Bacteria 6391
33 Ga0068857_100846614 3300005577 Bacteria 875
34 Ga0068856_100000264 3300005614 Bacteria 57155
35 Ga0068856_100116103 3300005614 Bacteria 2677
36 Ga0068856_100858888 3300005614 Bacteria 927
37 Ga0068856_101221917 3300005614 Bacteria 768
38 Ga0068852_100259976 3300005616 Bacteria 1667
39 Ga0068859_100003005 3300005617 Bacteria 17101
40 Ga0068859_100835022 3300005617 Bacteria 1008
41 Ga0068863_100318249 3300005841 Bacteria 1511
42 Ga0068858_100115442 3300005842 Bacteria 2509
43 Ga0068858_100432719 3300005842 Bacteria 1266
44 Ga0068858_100769504 3300005842 Bacteria 939
45 Ga0068858_101157372 3300005842 Bacteria 760
46 Ga0068862_100231924 3300005844 Bacteria 1675
47 Ga0068862_101155797 3300005844 Bacteria 771
48 Ga0081455_10076250 3300005937 Bacteria 2763
49 Ga0081539_10000098 3300005985 Bacteria 202400
50 Ga0081539_10007177 3300005985 Bacteria 10270
51 Ga0097621_100047179 3300006237 Bacteria 3490
52 Ga0097621_100428125 3300006237 Bacteria 1189
53 Ga0075428_100164991 3300006844 Bacteria 2403
54 Ga0075431_100059780 3300006847 Bacteria 3933
55 Ga0075434_100090015 3300006871 Bacteria 3070
56 Ga0097620_100003005 3300006931 Bacteria 17101
57 Ga0097620_100835061 3300006931 Bacteria 1008
58 Ga0099794_10059275 3300007265 Bacteria 1857
59 Ga0105240_10000550 3300009093 Bacteria 69293
60 Ga0105240_10000800 3300009093 Bacteria 56989
61 Ga0105240_10112661 3300009093 Bacteria 3288
62 Ga0105240_10228652 3300009093 Bacteria 2163
63 Ga0105240_10682556 3300009093 Bacteria 1123
64 Ga0111539_10007727 3300009094 Bacteria 13733
65 Ga0111539_10199072 3300009094 Bacteria 2336
66 Ga0111539_10387858 3300009094 Bacteria 1626
67 Ga0111539_10742996 3300009094 Bacteria 1142
68 Ga0105241_10007561 3300009174 Bacteria 7990
69 Ga0105241_10612378 3300009174 Bacteria 985
70 Ga0105242_10005448 3300009176 Bacteria 9831
71 Ga0105237_10000453 3300009545 Bacteria 58200
72 Ga0105237_10007396 3300009545 Bacteria 12027
73 Ga0105237_10013605 3300009545 Bacteria 8525
74 Ga0105238_10000592 3300009551 Bacteria 38095
75 Ga0105238_10241645 3300009551 Bacteria 1783
76 Ga0105238_10745209 3300009551 Bacteria 993
77 Ga0105249_11140849 3300009553 Bacteria 850
78 Ga0105239_10001405 3300010375 Bacteria 32195
79 Ga0105239_10133521 3300010375 Bacteria 2762
80 Ga0157369_10750280 3300013105 Bacteria 1004
81 Ga0157369_10935170 3300013105 Bacteria 888
82 Ga0157374_10239504 3300013296 Bacteria 1784
83 Ga0163162_10317935 3300013306 Bacteria 1689
84 Ga0157379_10074264 3300014968 Bacteria 3044
85 Ga0157376_10004723 3300014969 Bacteria 9491
86 Ga0157376_10150118 3300014969 Unclassified 2101
87 Ga0206356_10100362 3300020070 Bacteria 871
88 Ga0206356_10362423 3300020070 Bacteria 887
89 Ga0213876_10008413 3300021384 Bacteria 5583
90 Ga0213875_10174760 3300021388 Bacteria 1009
91 Ga0224712_10193319 3300022467 Bacteria 922
92 Ga0207699_10051072 3300025906 Bacteria 2442
93 Ga0207705_10023793 3300025909 Bacteria 4370
94 Ga0207654_10003375 3300025911 Bacteria 8086
95 Ga0207707_10234267 3300025912 Bacteria 1597
96 Ga0207707_10442772 3300025912 Bacteria 1112
97 Ga0207695_10000644 3300025913 Bacteria 69302
98 Ga0207695_10001230 3300025913 Bacteria 43841
99 Ga0207695_10007581 3300025913 Bacteria 13760
100 Ga0207671_10000311 3300025914 Bacteria 71753
101 Ga0207671_10006411 3300025914 Bacteria 10481
102 Ga0207671_10284466 3300025914 Bacteria 1305
103 Ga0207663_10024703 3300025916 Bacteria 3464
104 Ga0207657_10071393 3300025919 Bacteria 2940
105 Ga0207652_10051747 3300025921 Bacteria 3522
106 Ga0207694_10074632 3300025924 Bacteria 2654
107 Ga0207694_10881203 3300025924 Bacteria 757
108 Ga0207700_10367809 3300025928 Unclassified 1255
109 Ga0207664_10232791 3300025929 Bacteria 1602
110 Ga0207686_10705281 3300025934 Bacteria 802
111 Ga0207686_10932542 3300025934 Bacteria 702
112 Ga0207670_10051616 3300025936 Bacteria 2762
113 Ga0207670_10123629 3300025936 Bacteria 1885
114 Ga0207670_10441420 3300025936 Bacteria 1048
115 Ga0207665_10145516 3300025939 Bacteria 1693
116 Ga0207661_10503641 3300025944 Bacteria 1106
117 Ga0207667_10008712 3300025949 Bacteria 12024
118 Ga0207667_10043352 3300025949 Bacteria 4775
119 Ga0207667_11338619 3300025949 Bacteria 691
120 Ga0207712_10111709 3300025961 Bacteria 2051
121 Ga0207703_10489710 3300026035 Bacteria 1153
122 Ga0207639_10027496 3300026041 Bacteria 4145
123 Ga0207639_10221049 3300026041 Bacteria 1636
124 Ga0207702_10094504 3300026078 Bacteria 2624
125 Ga0207702_10660274 3300026078 Bacteria 1029
126 Ga0207674_10001580 3300026116 Bacteria 29324
127 Ga0207674_10543106 3300026116 Bacteria 1123
128 Ga0207698_10682781 3300026142 Bacteria 1020
129 Ga0268266_10461020 3300028379 Bacteria 1209
130 Ga0268265_10382302 3300028380 Bacteria 1296
131 Ga0268264_10087177 3300028381 Bacteria 2684
132 Ga0268264_10719069 3300028381 Bacteria 993
133 Ga0265337_1000857 3300028556 Bacteria 15970
134 Ga0265337_1003425 3300028556 Bacteria 6880
135 Ga0265326_10028447 3300028558 Bacteria 1592
136 Ga0265326_10111551 3300028558 Bacteria 777
137 Ga0265319_1048852 3300028563 Bacteria 1403
138 Ga0265334_10008684 3300028573 Bacteria 4313
139 Ga0265318_10045392 3300028577 Bacteria 1661
140 Ga0265323_10023621 3300028653 Bacteria 2343
141 Ga0265336_10000642 3300028666 Bacteria 19093
142 Ga0265338_10000312 3300028800 Bacteria 87999
143 Ga0265338_10000533 3300028800 Bacteria 66710
144 Ga0265338_10000660 3300028800 Bacteria 59683
145 Ga0265338_10000987 3300028800 Bacteria 47972
146 Ga0265338_10004362 3300028800 Bacteria 19148
147 Ga0265338_10009506 3300028800 Bacteria 11580
148 Ga0265338_10049434 3300028800 Bacteria 3812
149 Ga0265338_10050359 3300028800 Bacteria 3766
150 Ga0265338_10344143 3300028800 Bacteria 1074
151 Ga0265324_10001345 3300029957 Bacteria 14370
152 Ga0265324_10001949 3300029957 Bacteria 11060
153 Ga0265324_10010716 3300029957 Bacteria 3519
154 Ga0265324_10039110 3300029957 Bacteria 1645
155 Ga0307511_10000201 3300030521 Bacteria 60079
156 Ga0265320_10004502 3300031240 Bacteria 9122
157 Ga0265320_10019762 3300031240 Bacteria 3672
158 Ga0265320_10019929 3300031240 Bacteria 3651
159 Ga0265325_10062784 3300031241 Bacteria 1881
160 Ga0265329_10002220 3300031242 Bacteria 8961
161 Ga0265329_10051693 3300031242 Bacteria 1308
162 Ga0265340_10001685 3300031247 Bacteria 12716
163 Ga0265339_10095155 3300031249 Bacteria 1556
164 Ga0265339_10161455 3300031249 Bacteria 1127
165 Ga0265339_10220256 3300031249 Bacteria 928
166 Ga0265327_10010061 3300031251 Bacteria 6712
167 Ga0265327_10012797 3300031251 Bacteria 5630
168 Ga0265327_10017929 3300031251 Bacteria 4415
169 Ga0265316_10031706 3300031344 Bacteria 4319
170 Ga0265314_10000284 3300031711 Bacteria 73660
171 Ga0265314_10067256 3300031711 Bacteria 2414
172 Ga0265314_10083701 3300031711 Bacteria 2096
173 Ga0265314_10236605 3300031711 Bacteria 1056
174 Ga0265342_10024928 3300031712 Bacteria 3769
175 Ga0265342_10153294 3300031712 Bacteria 1278
176 Ga0307516_10003458 3300031730 Bacteria 20249
177 Ga0307516_10125096 3300031730 Bacteria 2357
178 Ga0307409_100960045 3300031995 Bacteria 871
179 Ga0307416_100243490 3300032002 Bacteria 1745
180 Ga0373929_0003301 3300035085 Bacteria 2915
181 Ga0373934_0002377 3300035086 Bacteria 6922
182 Ga0373944_0000132 3300035089 Bacteria 14214
183 Ga0373944_0035078 3300035089 Bacteria 1527
184 Ga0373949_0002990 3300035090 Bacteria 4153
185 Ga0373923_0058848 3300035111 Bacteria 1628
186 Ga0373923_0222990 3300035111 Bacteria 877
187 Ga0373932_0000002 3300035112 Bacteria 711821
188 Ga0373945_0003202 3300035116 Bacteria 5136
189 Ga0373945_0135890 3300035116 Bacteria 988
190 Ga0373954_0005071 3300035118 Bacteria 5682
191 Ga0373954_0043974 3300035118 Bacteria 2083
192 Ga0373957_0008643 3300035120 Bacteria 3309
193 Ga0373962_0000288 3300035242 Bacteria 10795
194 Ga0373924_0001343 3300035410 Bacteria 7929
195 Ga0373931_0000012 3300035691 Bacteria 267735
196 Ga0373935_0082725 3300035692 Bacteria 2089
197 Ga0373927_0007114 3300035695 Bacteria 7592
198 Ga0373927_0039605 3300035695 Bacteria 3059
199 Ga0373933_0110133 3300035724 Bacteria 1717
200 Ga0373947_0007695 3300035725 Bacteria 6226
201 Ga0373947_0048406 3300035725 Bacteria 2551
202 Ga0373947_0248187 3300035725 Bacteria 1176
203 Ga0373937_0001967 3300036401 Bacteria 17189
204 Ga0373937_0031750 3300036401 Bacteria 4787
205 Ga0373937_0057666 3300036401 Bacteria 3568
206 Ga0373937_0122049 3300036401 Bacteria 2429
207 Ga0373925_0000233 3300037068 Bacteria 58605
208 Ga0373925_0003298 3300037068 Bacteria 12546
209 Ga0373925_0373094 3300037068 Bacteria 1161
210 Ga0436365_0099926 3300039437 Bacteria 10247
211 Ga0436360_0258315 3300039438 Bacteria 2845
212 Ga0436360_0434891 3300039438 Bacteria 3721
213 Ga0436361_0216155 3300039447 Bacteria 8025
214 Ga0436362_0149729 3300039453 Bacteria 2421
215 Ga0436362_0436962 3300039453 Bacteria 2611
216 Ga0451804_1146158 3300041463 Bacteria 887
217 Ga0451577_0006166 3300042876 Bacteria 12047
218 Ga0451577_0959112 3300042876 Bacteria 769
219 Ga0466972_0042511 3300044658 Bacteria 2209
220 Ga0453684_0003504 3300044712 Bacteria 35230
221 Ga0453684_0058137 3300044712 Bacteria 4997
222 Ga0453684_0205429 3300044712 Bacteria 2293
223 Ga0453684_0206052 3300044712 Bacteria 2289
224 Ga0453684_0889452 3300044712 Bacteria 954
225 Ga0466959_0038894 3300045049 Bacteria 3515
226 Ga0451576_0090760 3300045051 Bacteria 3178
227 Ga0451576_0322981 3300045051 Bacteria 1615
228 Ga0451576_0378426 3300045051 Bacteria 1484
229 Ga0495592_0000101 3300046454 Bacteria 75856
230 Ga0495592_0211409 3300046454 Bacteria 1302
231 Ga0495590_0182104 3300046457 Bacteria 768
232 Ga0495629_0097325 3300046459 Bacteria 2053
233 Ga0495629_0595963 3300046459 Bacteria 739
234 Ga0495651_0260314 3300046462 Bacteria 1181
235 Ga0495580_0060736 3300046472 Bacteria 2655
236 Ga0495664_0047785 3300046477 Bacteria 2540
237 Ga0495618_0003223 3300046514 Bacteria 10223
238 Ga0495618_0005077 3300046514 Bacteria 8040
239 Ga0495628_0003986 3300046516 Bacteria 13155
240 Ga0495628_0061346 3300046516 Bacteria 2949
241 Ga0495630_0040765 3300046517 Bacteria 3470
242 Ga0495630_0046837 3300046517 Bacteria 3233
243 Ga0495630_0463168 3300046517 Bacteria 971
244 Ga0495652_0079736 3300046529 Bacteria 2706
245 Ga0495652_0132110 3300046529 Bacteria 1975
246 Ga0495640_0024279 3300046533 Bacteria 4412
247 Ga0495586_0007681 3300046535 Bacteria 5749
248 Ga0495586_0014007 3300046535 Bacteria 4256
249 Ga0495586_0097051 3300046535 Bacteria 1633
250 Ga0495587_0159491 3300046536 Bacteria 1284
251 Ga0495645_0119801 3300046543 Bacteria 1854
252 Ga0495645_0258692 3300046543 Bacteria 1154
253 Ga0495645_0354669 3300046543 Bacteria 944
254 Ga0495622_0034206 3300046557 Bacteria 2371
255 Ga0495667_0187125 3300046559 Bacteria 1328
256 Ga0495634_0004225 3300046642 Bacteria 11337
257 Ga0495634_0297078 3300046642 Bacteria 977
258 Ga0495611_0001026 3300046648 Bacteria 14788
259 Ga0495657_0218207 3300046675 Bacteria 1157
260 Ga0495599_0015275 3300046678 Bacteria 4763
261 Ga0495658_0080271 3300046683 Bacteria 1913
262 Ga0495658_0199793 3300046683 Bacteria 1246
263 Ga0495613_0007942 3300046689 Bacteria 7896
264 Ga0495581_0215575 3300047315 Bacteria 1122
265 Ga0495581_0236234 3300047315 Bacteria 1069
266 Ga0495604_0129932 3300047317 Bacteria 1812
267 Ga0495604_0622830 3300047317 Bacteria 690
268 Ga0495674_0074120 3300047319 Bacteria 2933
269 Ga0495674_0148682 3300047319 Bacteria 1965
270 Ga0495676_0653485 3300047321 Bacteria 682
271 Ga0495680_0009671 3300047322 Bacteria 8651
272 Ga0495675_0204496 3300047444 Bacteria 1201
273 Ga0495684_0012249 3300047471 Bacteria 6616
274 Ga0495684_0124479 3300047471 Bacteria 1940
275 Ga0495686_0000005 3300047472 Bacteria 827143
276 Ga0495602_0475813 3300048088 Eukaryota 877
277 Ga0496112_0104739 3300048915 Bacteria 2799
278 Ga0496115_0211702 3300048918 Bacteria 1601
279 Ga0496125_0144331 3300048928 Bacteria 1649
280 Ga0501043_0217037 3300049579 Bacteria 1481
281 nmdc:mga08y16_10985_c1 3300050511 Bacteria 9506
282 nmdc:mga08y16_609884_c1 3300050511 Bacteria 1099
283 nmdc:mga08y16_642618_c1 3300050511 Bacteria 1066
284 nmdc:mga0n895_801957_c1 3300050512 Bacteria 932
285 nmdc:mga0a205_301163_c1 3300050515 Bacteria 1476
286 Ga0495612_0140916 3300053078 Bacteria 1046
287 Ga0495619_0597268 3300053085 Eukaryota 755
288 Ga0500643_013526 3300053087 Bacteria 2878
289 Ga0500616_0103885 3300053153 Bacteria 1384
290 Ga0590077_067773 3300059426 Bacteria 813

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0060736 Ga0495580_0060736_153_698 176
2 3300003316 rootH1_10146062 rootH1_101460626 191
3 3300005341 Ga0070691_10097695 Ga0070691_100976952 191
4 3300005539 Ga0068853_100007548 Ga0068853_1000075489 191
5 3300005539 Ga0068853_100240485 Ga0068853_1002404852 191
6 3300005614 Ga0068856_100116103 Ga0068856_1001161031 191
7 3300005616 Ga0068852_100259976 Ga0068852_1002599762 191
8 3300009093 Ga0105240_10000800 Ga0105240_1000080032 191
9 3300009093 Ga0105240_10228652 Ga0105240_102286522 191
10 3300009174 Ga0105241_10007561 Ga0105241_100075612 191
11 3300009174 Ga0105241_10612378 Ga0105241_106123782 191
12 3300009545 Ga0105237_10000453 Ga0105237_1000045360 191
13 3300009545 Ga0105237_10013605 Ga0105237_100136052 191
14 3300009551 Ga0105238_10000592 Ga0105238_1000059213 191
15 3300009551 Ga0105238_10241645 Ga0105238_102416452 191
16 3300010375 Ga0105239_10001405 Ga0105239_1000140520 191
17 3300010375 Ga0105239_10133521 Ga0105239_101335214 191
18 3300013105 Ga0157369_10750280 Ga0157369_107502802 191
19 3300021384 Ga0213876_10008413 Ga0213876_100084132 191
20 3300025911 Ga0207654_10003375 Ga0207654_100033756 191
21 3300025913 Ga0207695_10001230 Ga0207695_1000123036 191
22 3300025914 Ga0207671_10000311 Ga0207671_1000031117 191
23 3300025914 Ga0207671_10284466 Ga0207671_102844661 191
24 3300025924 Ga0207694_10074632 Ga0207694_100746324 191
25 3300025934 Ga0207686_10932542 Ga0207686_109325421 191
26 3300026041 Ga0207639_10027496 Ga0207639_100274964 191
27 3300026041 Ga0207639_10221049 Ga0207639_102210491 191
28 3300026078 Ga0207702_10660274 Ga0207702_106602742 191
29 3300026142 Ga0207698_10682781 Ga0207698_106827812 191
30 3300028381 Ga0268264_10719069 Ga0268264_107190692 191
31 3300030521 Ga0307511_10000201 Ga0307511_1000020157 191
32 3300031730 Ga0307516_10003458 Ga0307516_1000345810 191
33 3300031730 Ga0307516_10125096 Ga0307516_101250964 191
34 3300039437 Ga0436365_0099926 Ga0436365_0099926_471_1103 191
35 3300039453 Ga0436362_0149729 Ga0436362_0149729_1144_1776 191
36 3300046648 Ga0495611_0001026 Ga0495611_0001026_5836_6441 191
37 3300047472 Ga0495686_0000005 Ga0495686_0000005_529795_530400 191
38 3300006237 Ga0097621_100047179 Ga0097621_1000471794 192
39 3300014969 Ga0157376_10004723 Ga0157376_100047237 192
40 3300014969 Ga0157376_10150118 Ga0157376_101501181 192
41 3300035111 Ga0373923_0222990 Ga0373923_0222990_128_733 192
42 3300035725 Ga0373947_0248187 Ga0373947_0248187_509_1114 192
43 3300036401 Ga0373937_0057666 Ga0373937_0057666_980_1585 192
44 3300036401 Ga0373937_0122049 Ga0373937_0122049_1220_1825 192
45 3300046462 Ga0495651_0260314 Ga0495651_0260314_43_648 192
46 3300046517 Ga0495630_0046837 Ga0495630_0046837_1722_2327 192
47 3300046529 Ga0495652_0132110 Ga0495652_0132110_660_1265 192
48 3300046535 Ga0495586_0097051 Ga0495586_0097051_333_938 192
49 3300046543 Ga0495645_0258692 Ga0495645_0258692_31_636 192
50 3300046559 Ga0495667_0187125 Ga0495667_0187125_493_1098 192
51 3300046683 Ga0495658_0080271 Ga0495658_0080271_631_1236 192
52 3300047317 Ga0495604_0129932 Ga0495604_0129932_557_1162 192
53 3300047319 Ga0495674_0148682 Ga0495674_0148682_1099_1704 192
54 3300047471 Ga0495684_0124479 Ga0495684_0124479_555_1160 192
55 3300048088 Ga0495602_0475813 Ga0495602_0475813_186_791 192
56 3300048918 Ga0496115_0211702 Ga0496115_0211702_550_1155 192
57 3300053085 Ga0495619_0597268 Ga0495619_0597268_77_682 192
58 iso_pu_bacteria 2524614857 2526061020 192
59 iso_pu_bacteria 2739367875 2740062484 192
60 3300005327 Ga0070658_10580550 Ga0070658_105805501 195
61 3300005614 Ga0068856_100000264 Ga0068856_10000026447 195
62 3300026078 Ga0207702_10094504 Ga0207702_100945042 195
63 3300028558 Ga0265326_10028447 Ga0265326_100284471 195
64 3300029957 Ga0265324_10001345 Ga0265324_100013452 195
65 3300031241 Ga0265325_10062784 Ga0265325_100627842 195
66 3300031251 Ga0265327_10010061 Ga0265327_100100614 195
67 3300035085 Ga0373929_0003301 Ga0373929_0003301_2215_2823 195
68 3300035089 Ga0373944_0000132 Ga0373944_0000132_8531_9253 195
69 3300035090 Ga0373949_0002990 Ga0373949_0002990_1032_1754 195
70 3300035112 Ga0373932_0000002 Ga0373932_0000002_213913_214635 195
71 3300035116 Ga0373945_0135890 Ga0373945_0135890_189_911 195
72 3300035242 Ga0373962_0000288 Ga0373962_0000288_4645_5367 195
73 3300035691 Ga0373931_0000012 Ga0373931_0000012_213932_214654 195
74 3300035695 Ga0373927_0007114 Ga0373927_0007114_461_1183 195
75 3300035725 Ga0373947_0048406 Ga0373947_0048406_738_1460 195
76 3300037068 Ga0373925_0000233 Ga0373925_0000233_18958_19680 195
77 3300041463 Ga0451804_1146158 Ga0451804_1146158_157_765 195
78 3300044712 Ga0453684_0206052 Ga0453684_0206052_1128_1736 195
79 3300005544 Ga0070686_100422078 Ga0070686_1004220781 196
80 3300007265 Ga0099794_10059275 Ga0099794_100592752 196
81 3300031251 Ga0265327_10012797 Ga0265327_100127976 196
82 3300046536 Ga0495587_0159491 Ga0495587_0159491_186_812 196
83 3300046543 Ga0495645_0354669 Ga0495645_0354669_104_730 196
84 3300047317 Ga0495604_0622830 Ga0495604_0622830_10_636 196
85 3300047444 Ga0495675_0204496 Ga0495675_0204496_520_1146 196
86 3300049579 Ga0501043_0217037 Ga0501043_0217037_349_966 196
87 3300005327 Ga0070658_10004736 Ga0070658_100047365 197
88 3300005327 Ga0070658_10123998 Ga0070658_101239983 197
89 3300005329 Ga0070683_100045102 Ga0070683_1000451021 197
90 3300005339 Ga0070660_100287108 Ga0070660_1002871081 197
91 3300005340 Ga0070689_100108846 Ga0070689_1001088463 197
92 3300005340 Ga0070689_100381955 Ga0070689_1003819552 197
93 3300005343 Ga0070687_100537726 Ga0070687_1005377261 197
94 3300005438 Ga0070701_10051398 Ga0070701_100513983 197
95 3300005439 Ga0070711_100013623 Ga0070711_1000136235 197
96 3300005444 Ga0070694_100030410 Ga0070694_1000304101 197
97 3300005458 Ga0070681_10325124 Ga0070681_103251241 197
98 3300005535 Ga0070684_100228318 Ga0070684_1002283182 197
99 3300005544 Ga0070686_100319092 Ga0070686_1003190921 197
100 3300005549 Ga0070704_100109747 Ga0070704_1001097472 197
101 3300005549 Ga0070704_101134644 Ga0070704_1011346441 197
102 3300005563 Ga0068855_100030998 Ga0068855_1000309984 197
103 3300005577 Ga0068857_100846614 Ga0068857_1008466142 197
104 3300005614 Ga0068856_100858888 Ga0068856_1008588882 197
105 3300005614 Ga0068856_101221917 Ga0068856_1012219172 197
106 3300005617 Ga0068859_100003005 Ga0068859_10000300517 197
107 3300005617 Ga0068859_100835022 Ga0068859_1008350221 197
108 3300005841 Ga0068863_100318249 Ga0068863_1003182492 197
109 3300005842 Ga0068858_100769504 Ga0068858_1007695041 197
110 3300005842 Ga0068858_101157372 Ga0068858_1011573721 197
111 3300005844 Ga0068862_100231924 Ga0068862_1002319242 197
112 3300005844 Ga0068862_101155797 Ga0068862_1011557971 197
113 3300005937 Ga0081455_10076250 Ga0081455_100762502 197
114 3300005985 Ga0081539_10007177 Ga0081539_100071776 197
115 3300006237 Ga0097621_100428125 Ga0097621_1004281252 197
116 3300006871 Ga0075434_100090015 Ga0075434_1000900151 197
117 3300006931 Ga0097620_100003005 Ga0097620_10000300517 197
118 3300006931 Ga0097620_100835061 Ga0097620_1008350611 197
119 3300009093 Ga0105240_10000550 Ga0105240_100005506 197
120 3300009093 Ga0105240_10112661 Ga0105240_101126612 197
121 3300009093 Ga0105240_10682556 Ga0105240_106825561 197
122 3300009094 Ga0111539_10199072 Ga0111539_101990721 197
123 3300009094 Ga0111539_10742996 Ga0111539_107429962 197
124 3300009176 Ga0105242_10005448 Ga0105242_100054488 197
125 3300009545 Ga0105237_10007396 Ga0105237_1000739615 197
126 3300009551 Ga0105238_10745209 Ga0105238_107452092 197
127 3300009553 Ga0105249_11140849 Ga0105249_111408491 197
128 3300013105 Ga0157369_10935170 Ga0157369_109351701 197
129 3300014968 Ga0157379_10074264 Ga0157379_100742644 197
130 3300020070 Ga0206356_10362423 Ga0206356_103624232 197
131 3300025909 Ga0207705_10023793 Ga0207705_100237932 197
132 3300025912 Ga0207707_10442772 Ga0207707_104427722 197
133 3300025913 Ga0207695_10000644 Ga0207695_100006446 197
134 3300025913 Ga0207695_10007581 Ga0207695_100075818 197
135 3300025914 Ga0207671_10006411 Ga0207671_100064112 197
136 3300025916 Ga0207663_10024703 Ga0207663_100247033 197
137 3300025919 Ga0207657_10071393 Ga0207657_100713933 197
138 3300025924 Ga0207694_10881203 Ga0207694_108812031 197
139 3300025928 Ga0207700_10367809 Ga0207700_103678092 197
140 3300025929 Ga0207664_10232791 Ga0207664_102327912 197
141 3300025934 Ga0207686_10705281 Ga0207686_107052812 197
142 3300025936 Ga0207670_10051616 Ga0207670_100516162 197
143 3300025936 Ga0207670_10123629 Ga0207670_101236291 197
144 3300025936 Ga0207670_10441420 Ga0207670_104414201 197
145 3300025944 Ga0207661_10503641 Ga0207661_105036411 197
146 3300025949 Ga0207667_10008712 Ga0207667_100087129 197
147 3300025949 Ga0207667_10043352 Ga0207667_100433522 197
148 3300025949 Ga0207667_11338619 Ga0207667_113386191 197
149 3300025961 Ga0207712_10111709 Ga0207712_101117092 197
150 3300026116 Ga0207674_10001580 Ga0207674_1000158021 197
151 3300026116 Ga0207674_10543106 Ga0207674_105431063 197
152 3300028379 Ga0268266_10461020 Ga0268266_104610201 197
153 3300028380 Ga0268265_10382302 Ga0268265_103823022 197
154 3300028381 Ga0268264_10087177 Ga0268264_100871772 197
155 3300028556 Ga0265337_1000857 Ga0265337_100085726 197
156 3300028556 Ga0265337_1003425 Ga0265337_10034255 197
157 3300028558 Ga0265326_10111551 Ga0265326_101115511 197
158 3300028563 Ga0265319_1048852 Ga0265319_10488522 197
159 3300028573 Ga0265334_10008684 Ga0265334_100086844 197
160 3300028577 Ga0265318_10045392 Ga0265318_100453922 197
161 3300028653 Ga0265323_10023621 Ga0265323_100236212 197
162 3300028666 Ga0265336_10000642 Ga0265336_100006423 197
163 3300028800 Ga0265338_10000312 Ga0265338_1000031237 197
164 3300028800 Ga0265338_10000533 Ga0265338_1000053362 197
165 3300028800 Ga0265338_10000660 Ga0265338_1000066037 197
166 3300028800 Ga0265338_10000987 Ga0265338_100009872 197
167 3300028800 Ga0265338_10004362 Ga0265338_1000436213 197
168 3300028800 Ga0265338_10009506 Ga0265338_100095067 197
169 3300028800 Ga0265338_10049434 Ga0265338_100494342 197
170 3300028800 Ga0265338_10050359 Ga0265338_100503592 197
171 3300028800 Ga0265338_10344143 Ga0265338_103441432 197
172 3300029957 Ga0265324_10001949 Ga0265324_100019495 197
173 3300029957 Ga0265324_10010716 Ga0265324_100107164 197
174 3300029957 Ga0265324_10039110 Ga0265324_100391102 197
175 3300031240 Ga0265320_10004502 Ga0265320_100045025 197
176 3300031240 Ga0265320_10019762 Ga0265320_100197625 197
177 3300031240 Ga0265320_10019929 Ga0265320_100199293 197
178 3300031242 Ga0265329_10051693 Ga0265329_100516932 197
179 3300031247 Ga0265340_10001685 Ga0265340_1000168515 197
180 3300031249 Ga0265339_10095155 Ga0265339_100951552 197
181 3300031249 Ga0265339_10161455 Ga0265339_101614552 197
182 3300031249 Ga0265339_10220256 Ga0265339_102202562 197
183 3300031251 Ga0265327_10017929 Ga0265327_100179294 197
184 3300031711 Ga0265314_10083701 Ga0265314_100837011 197
185 3300031711 Ga0265314_10236605 Ga0265314_102366051 197
186 3300031712 Ga0265342_10024928 Ga0265342_100249282 197
187 3300031712 Ga0265342_10153294 Ga0265342_101532943 197
188 3300035089 Ga0373944_0035078 Ga0373944_0035078_609_1238 197
189 3300035118 Ga0373954_0043974 Ga0373954_0043974_1268_1882 197
190 3300035695 Ga0373927_0039605 Ga0373927_0039605_791_1420 197
191 3300035724 Ga0373933_0110133 Ga0373933_0110133_599_1213 197
192 3300035725 Ga0373947_0007695 Ga0373947_0007695_1623_2252 197
193 3300036401 Ga0373937_0031750 Ga0373937_0031750_795_1409 197
194 3300037068 Ga0373925_0003298 Ga0373925_0003298_10241_10870 197
195 3300037068 Ga0373925_0373094 Ga0373925_0373094_507_1136 197
196 3300042876 Ga0451577_0006166 Ga0451577_0006166_6638_7258 197
197 3300042876 Ga0451577_0959112 Ga0451577_0959112_64_693 197
198 3300044658 Ga0466972_0042511 Ga0466972_0042511_212_817 197
199 3300044712 Ga0453684_0003504 Ga0453684_0003504_26144_26773 197
200 3300044712 Ga0453684_0205429 Ga0453684_0205429_489_1109 197
201 3300044712 Ga0453684_0889452 Ga0453684_0889452_159_779 197
202 3300045049 Ga0466959_0038894 Ga0466959_0038894_1800_2405 197
203 3300045051 Ga0451576_0090760 Ga0451576_0090760_2160_2780 197
204 3300045051 Ga0451576_0322981 Ga0451576_0322981_222_836 197
205 3300045051 Ga0451576_0378426 Ga0451576_0378426_644_1273 197
206 3300046454 Ga0495592_0000101 Ga0495592_0000101_8264_8893 197
207 3300046454 Ga0495592_0211409 Ga0495592_0211409_314_928 197
208 3300046459 Ga0495629_0097325 Ga0495629_0097325_33_647 197
209 3300046459 Ga0495629_0595963 Ga0495629_0595963_35_664 197
210 3300046477 Ga0495664_0047785 Ga0495664_0047785_47_676 197
211 3300046514 Ga0495618_0003223 Ga0495618_0003223_6791_7420 197
212 3300046514 Ga0495618_0005077 Ga0495618_0005077_1763_2377 197
213 3300046516 Ga0495628_0003986 Ga0495628_0003986_2286_2915 197
214 3300046516 Ga0495628_0061346 Ga0495628_0061346_1668_2282 197
215 3300046517 Ga0495630_0040765 Ga0495630_0040765_2549_3163 197
216 3300046517 Ga0495630_0463168 Ga0495630_0463168_46_675 197
217 3300046529 Ga0495652_0079736 Ga0495652_0079736_1883_2512 197
218 3300046533 Ga0495640_0024279 Ga0495640_0024279_44_673 197
219 3300046535 Ga0495586_0007681 Ga0495586_0007681_4922_5551 197
220 3300046535 Ga0495586_0014007 Ga0495586_0014007_1663_2277 197
221 3300046543 Ga0495645_0119801 Ga0495645_0119801_159_773 197
222 3300046557 Ga0495622_0034206 Ga0495622_0034206_617_1231 197
223 3300046642 Ga0495634_0004225 Ga0495634_0004225_6390_7004 197
224 3300046642 Ga0495634_0297078 Ga0495634_0297078_42_671 197
225 3300046675 Ga0495657_0218207 Ga0495657_0218207_71_685 197
226 3300046678 Ga0495599_0015275 Ga0495599_0015275_515_1144 197
227 3300046683 Ga0495658_0199793 Ga0495658_0199793_16_645 197
228 3300046689 Ga0495613_0007942 Ga0495613_0007942_2978_3592 197
229 3300047315 Ga0495581_0215575 Ga0495581_0215575_462_1091 197
230 3300047315 Ga0495581_0236234 Ga0495581_0236234_157_771 197
231 3300047319 Ga0495674_0074120 Ga0495674_0074120_1158_1787 197
232 3300047321 Ga0495676_0653485 Ga0495676_0653485_35_664 197
233 3300047322 Ga0495680_0009671 Ga0495680_0009671_2087_2701 197
234 3300048928 Ga0496125_0144331 Ga0496125_0144331_190_795 197
235 3300050511 nmdc:mga08y16_642618_c1 nmdc:mga08y16_642618_c1_188_817 197
236 3300050512 nmdc:mga0n895_801957_c1 nmdc:mga0n895_801957_c1_19_633 197
237 3300050515 nmdc:mga0a205_301163_c1 nmdc:mga0a205_301163_c1_549_1301 197
238 3300053153 Ga0500616_0103885 Ga0500616_0103885_10_624 197
239 3300004803 Ga0058862_12643340 Ga0058862_126433401 198
240 3300005329 Ga0070683_100079932 Ga0070683_1000799322 198
241 3300005434 Ga0070709_10929795 Ga0070709_109297951 198
242 3300005458 Ga0070681_10091085 Ga0070681_100910851 198
243 3300005530 Ga0070679_100067144 Ga0070679_1000671443 198
244 3300005842 Ga0068858_100115442 Ga0068858_1001154422 198
245 3300006844 Ga0075428_100164991 Ga0075428_1001649912 198
246 3300006847 Ga0075431_100059780 Ga0075431_1000597804 198
247 3300009094 Ga0111539_10007727 Ga0111539_100077277 198
248 3300013296 Ga0157374_10239504 Ga0157374_102395042 198
249 3300013306 Ga0163162_10317935 Ga0163162_103179352 198
250 3300020070 Ga0206356_10100362 Ga0206356_101003622 198
251 3300022467 Ga0224712_10193319 Ga0224712_101933191 198
252 3300025912 Ga0207707_10234267 Ga0207707_102342672 198
253 3300025921 Ga0207652_10051747 Ga0207652_100517472 198
254 3300026035 Ga0207703_10489710 Ga0207703_104897101 198
255 3300031242 Ga0265329_10002220 Ga0265329_100022207 198
256 3300031344 Ga0265316_10031706 Ga0265316_100317062 198
257 3300031711 Ga0265314_10000284 Ga0265314_1000028422 198
258 3300031711 Ga0265314_10067256 Ga0265314_100672563 198
259 3300031995 Ga0307409_100960045 Ga0307409_1009600451 198
260 3300032002 Ga0307416_100243490 Ga0307416_1002434902 198
261 3300035086 Ga0373934_0002377 Ga0373934_0002377_3358_3966 198
262 3300035111 Ga0373923_0058848 Ga0373923_0058848_650_1258 198
263 3300035116 Ga0373945_0003202 Ga0373945_0003202_48_686 198
264 3300035118 Ga0373954_0005071 Ga0373954_0005071_294_902 198
265 3300035120 Ga0373957_0008643 Ga0373957_0008643_742_1350 198
266 3300035410 Ga0373924_0001343 Ga0373924_0001343_752_1390 198
267 3300035692 Ga0373935_0082725 Ga0373935_0082725_1165_1773 198
268 3300036401 Ga0373937_0001967 Ga0373937_0001967_1288_1896 198
269 3300044712 Ga0453684_0058137 Ga0453684_0058137_3341_3958 198
270 3300046457 Ga0495590_0182104 Ga0495590_0182104_60_668 198
271 3300047471 Ga0495684_0012249 Ga0495684_0012249_914_1522 198
272 3300048915 Ga0496112_0104739 Ga0496112_0104739_366_1004 198
273 3300050511 nmdc:mga08y16_10985_c1 nmdc:mga08y16_10985_c1_1385_1996 198
274 3300053078 Ga0495612_0140916 Ga0495612_0140916_243_881 198
275 3300053087 Ga0500643_013526 Ga0500643_013526_1707_2309 198
276 3300059426 Ga0590077_067773 Ga0590077_067773_48_662 198
277 3300003203 JGI25406J46586_10000056 JGI25406J46586_1000005645 199
278 3300005434 Ga0070709_10711797 Ga0070709_107117971 199
279 3300005436 Ga0070713_100776012 Ga0070713_1007760122 199
280 3300005437 Ga0070710_10344515 Ga0070710_103445152 199
281 3300005437 Ga0070710_10345142 Ga0070710_103451422 199
282 3300005842 Ga0068858_100432719 Ga0068858_1004327191 199
283 3300005985 Ga0081539_10000098 Ga0081539_1000009892 199
284 3300009094 Ga0111539_10387858 Ga0111539_103878581 199
285 3300021388 Ga0213875_10174760 Ga0213875_101747601 199
286 3300025906 Ga0207699_10051072 Ga0207699_100510723 199
287 3300025939 Ga0207665_10145516 Ga0207665_101455161 199
288 3300039438 Ga0436360_0258315 Ga0436360_0258315_1131_1739 199
289 3300039438 Ga0436360_0434891 Ga0436360_0434891_1054_1692 199
290 3300039447 Ga0436361_0216155 Ga0436361_0216155_2202_2807 199
291 3300039453 Ga0436362_0436962 Ga0436362_0436962_653_1261 199
292 3300050511 nmdc:mga08y16_609884_c1 nmdc:mga08y16_609884_c1_74_688 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

43

131

0.94

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

138

244

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rcv-assembly4.cif.gz_F crystal structure of the bacillus subtilis superoxide dismutase 0.9848 2 199
2rcv-assembly2.cif.gz_H crystal structure of the bacillus subtilis superoxide dismutase 0.9848 2 199
1xuq-assembly1.cif.gz_B crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. 0.9842 3 199
2rcv-assembly3.cif.gz_D crystal structure of the bacillus subtilis superoxide dismutase 0.9824 2 199
1jr9-assembly1.cif.gz_A-2 crystal structure of manganese superoxide dismutases from bacillus halodenitrificans 0.9762 4 199
ID Description Score Start End Superfamily
2rcvH01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 1.003 20 86 1.10.287.990
1xuqA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 1.001 20 89 1.10.287.990
2rcvG01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 1 20 86 1.10.287.990
2rcvA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9999 20 86 1.10.287.990
2rcvB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.999 20 86 1.10.287.990
ID Description Score Start End GO Terms
AF-A5HE80-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9941 19 164 GO:0004784
GO:0005737
GO:0046872
AF-A0A3M0Z9H9-F1-model_v4 deleted 0.994 1 134
AF-A0A257V8P3-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9934 1 132 GO:0004784
GO:0005737
GO:0046872
AF-Q6XZA6-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.993 9 160 GO:0004784
GO:0005737
GO:0046872
AF-A0A6B1GVD3-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9914 3 109 GO:0004784
GO:0005737
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map