F391170

General Info

Members Datasets Scaffolds Average Seq Length
292 160 584 201

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0122753|Ga0501031_0122753_368_1066
Length 218
Sequence MSRTVLVPPERLPRWCENFRTRHGDVGLAVSAGRLLLSGADGAGAEVDLPFGRRYDGDPDADQVAAAAAAPLTWGVLLVRKGGFAVALVDTDRVVASKVGQRHVQGRTKAGGQSQQRFARRRDNRILAEGSENQGTHRRVAAELTPRPPLTALVCGGDRSAVEAVLADPRLSRLPVPVDPWLPVPDPRRAVLDQAVADARSLRIRLTDPPPPASGRGA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
68 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 2643221561 Nocardioides sp. Root151 Isolate Unclassified
142 2643221576 Nocardioides sp. Root614 Isolate Unclassified
143 2643221590 Nocardioides sp. Root682 Isolate Unclassified
144 2643221604 Nocardioides sp. Root190 Isolate Unclassified
145 2643221617 Nocardioides sp. Root79 Isolate Unclassified
146 2643221620 Nocardioides sp. Root240 Isolate Unclassified
147 2643221641 Nocardioides sp. Root122 Isolate Unclassified
148 2643221696 Nocardioides sp. Root140 Isolate Unclassified
149 2738541305 Nocardioides sp. CF167 Isolate Unclassified
150 2739367898 Nocardioides sp. CF479 Isolate Unclassified
151 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
152 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
153 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
154 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
155 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
156 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
157 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
158 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
159 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
160 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.15
Metatranscriptomes 0
Isolates 6.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 6.85
Nodule 0.34
Rhizoplane 8.56
Rhizosphere 77.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0122753 3300049568 Bacteria 1696
2 JGI24740J21852_10019155 3300001979 Bacteria 2415
3 JGI24735J21928_10028271 3300002067 Bacteria 1675
4 Ga0070658_10084490 3300005327 Bacteria 2610
5 Ga0070683_100008121 3300005329 Bacteria 8913
6 Ga0070680_100263176 3300005336 Bacteria 1459
7 Ga0070682_100082597 3300005337 Bacteria 2083
8 Ga0070682_100516179 3300005337 Bacteria 929
9 Ga0070660_100038252 3300005339 Bacteria 3642
10 Ga0070660_100150476 3300005339 Bacteria 1871
11 Ga0070687_100073113 3300005343 Bacteria 1847
12 Ga0070688_100232502 3300005365 Bacteria 1305
13 Ga0070659_100043373 3300005366 Bacteria 3518
14 Ga0070701_10577956 3300005438 Bacteria 741
15 Ga0070700_100072338 3300005441 Bacteria 2204
16 Ga0070708_100396136 3300005445 Bacteria 1302
17 Ga0070663_100277328 3300005455 Bacteria 1335
18 Ga0070678_100670080 3300005456 Bacteria 932
19 Ga0070681_10094994 3300005458 Bacteria 2930
20 Ga0070685_10043428 3300005466 Bacteria 2570
21 Ga0070679_100001650 3300005530 Bacteria 20104
22 Ga0070684_100053608 3300005535 Bacteria 3512
23 Ga0070665_100002138 3300005548 Bacteria 22051
24 Ga0068856_100541798 3300005614 Bacteria 1185
25 Ga0068860_100000311 3300005843 Bacteria 66954
26 Ga0075365_10021323 3300006038 Bacteria 4040
27 Ga0075365_10055222 3300006038 Bacteria 2636
28 Ga0075365_10153288 3300006038 Bacteria 1604
29 Ga0075365_10213343 3300006038 Bacteria 1354
30 Ga0075363_100006379 3300006048 Bacteria 5347
31 Ga0075363_100078104 3300006048 Bacteria 1807
32 Ga0075364_10004843 3300006051 Bacteria 7797
33 Ga0075364_10094352 3300006051 Bacteria 1988
34 Ga0075367_10022295 3300006178 Bacteria 3550
35 Ga0075370_10019098 3300006353 Bacteria 3727
36 Ga0105243_10277209 3300009148 Bacteria 1508
37 Ga0105243_10346847 3300009148 Bacteria 1362
38 Ga0105243_11348496 3300009148 Bacteria 732
39 Ga0105237_10076231 3300009545 Bacteria 3344
40 Ga0105239_10110017 3300010375 Bacteria 3054
41 Ga0105239_10787709 3300010375 Bacteria 1089
42 Ga0157375_10306499 3300013308 Bacteria 1752
43 Ga0157375_10314362 3300013308 Bacteria 1731
44 Ga0157376_10529545 3300014969 Bacteria 1163
45 Ga0182006_1104609 3300015261 Bacteria 1001
46 Ga0207647_10002418 3300025904 Bacteria 14155
47 Ga0207647_10139430 3300025904 Bacteria 1421
48 Ga0207705_10284872 3300025909 Bacteria 1265
49 Ga0207671_10235726 3300025914 Bacteria 1436
50 Ga0207660_10810461 3300025917 Bacteria 764
51 Ga0207657_10060925 3300025919 Bacteria 3238
52 Ga0207657_10092665 3300025919 Bacteria 2518
53 Ga0207657_10172824 3300025919 Bacteria 1750
54 Ga0207652_10038141 3300025921 Bacteria 4071
55 Ga0207706_10193789 3300025933 Bacteria 1783
56 Ga0207709_10028167 3300025935 Bacteria 3245
57 Ga0207709_10241491 3300025935 Bacteria 1314
58 Ga0207661_10009728 3300025944 Bacteria 6903
59 Ga0207679_10043686 3300025945 Bacteria 3229
60 Ga0207668_10259350 3300025972 Bacteria 1416
61 Ga0207678_10213704 3300026067 Bacteria 1650
62 Ga0207708_10047904 3300026075 Bacteria 3253
63 Ga0207702_10329996 3300026078 Bacteria 1455
64 Ga0209813_10002932 3300027866 Bacteria 3948
65 Ga0209813_10207425 3300027866 Bacteria 728
66 Ga0268266_10000855 3300028379 Bacteria 39694
67 Ga0268264_10000717 3300028381 Bacteria 38073
68 Ga0307408_100364223 3300031548 Bacteria 1231
69 Ga0307405_10110960 3300031731 Bacteria 1858
70 Ga0307405_10249144 3300031731 Bacteria 1321
71 Ga0307413_10615846 3300031824 Bacteria 891
72 Ga0307410_10115907 3300031852 Bacteria 1946
73 Ga0307409_100039253 3300031995 Bacteria 3511
74 Ga0307409_100397643 3300031995 Bacteria 1315
75 Ga0307416_100836256 3300032002 Bacteria 1018
76 Ga0307414_10294764 3300032004 Bacteria 1369
77 Ga0307415_100692612 3300032126 Bacteria 919
78 Ga0307415_100761263 3300032126 Bacteria 880
79 Ga0395899_0120440 3300037312 Bacteria 1880
80 Ga0395898_0117647 3300037466 Bacteria 2546
81 Ga0395901_0097990 3300038443 Bacteria 3074
82 Ga0395901_0419193 3300038443 Bacteria 1373
83 Ga0439438_043158 3300041405 Bacteria 1165
84 Ga0451791_1509468 3300041451 Bacteria 740
85 Ga0451853_2526805 3300041512 Bacteria 3782
86 Ga0439431_0008196 3300041997 Bacteria 2346
87 Ga0439442_020882 3300042002 Bacteria 1358
88 Ga0439446_0189659 3300042156 Bacteria 690
89 Ga0439434_0006140 3300042435 Bacteria 3503
90 Ga0466969_0101817 3300044656 Bacteria 1351
91 Ga0466965_0161530 3300044683 Bacteria 1175
92 Ga0466966_0014311 3300044684 Bacteria 5252
93 Ga0466961_0002936 3300044693 Bacteria 10588
94 Ga0466961_0137055 3300044693 Bacteria 1533
95 Ga0466961_0236031 3300044693 Bacteria 1125
96 Ga0466963_0029233 3300044694 Bacteria 3545
97 Ga0466963_0032799 3300044694 Bacteria 3366
98 Ga0466963_0107541 3300044694 Bacteria 1913
99 Ga0466963_0355050 3300044694 Bacteria 1032
100 Ga0466971_0005336 3300044719 Bacteria 5574
101 Ga0466968_0029305 3300044735 Bacteria 2276
102 Ga0466970_0115186 3300044765 Bacteria 1470
103 Ga0466957_0118632 3300044842 Bacteria 1685
104 Ga0466960_0001488 3300044901 Bacteria 8545
105 Ga0466960_0033856 3300044901 Bacteria 2377
106 Ga0466960_0171943 3300044901 Bacteria 1170
107 Ga0466959_0049183 3300045049 Bacteria 3097
108 Ga0466967_0026304 3300045976 Bacteria 4817
109 Ga0466967_0057537 3300045976 Bacteria 3433
110 Ga0466967_0576500 3300045976 Bacteria 1109
111 Ga0466967_0631260 3300045976 Bacteria 1058
112 Ga0466967_1013954 3300045976 Bacteria 827
113 Ga0495629_0400921 3300046459 Bacteria 932
114 Ga0495582_0083637 3300046473 Bacteria 1774
115 Ga0495639_0119716 3300046475 Bacteria 1255
116 Ga0495613_0613010 3300046689 Bacteria 723
117 Ga0496100_0047468 3300048903 Bacteria 2767
118 Ga0496101_0067721 3300048904 Bacteria 2608
119 Ga0496102_0284888 3300048905 Bacteria 1557
120 Ga0496103_0358644 3300048906 Bacteria 937
121 Ga0496105_0018148 3300048908 Bacteria 5649
122 Ga0496105_0039029 3300048908 Bacteria 3912
123 Ga0496106_0015117 3300048909 Bacteria 5714
124 Ga0496107_0031511 3300048910 Bacteria 3784
125 Ga0496107_0472480 3300048910 Bacteria 931
126 Ga0496108_0977102 3300048911 Bacteria 724
127 Ga0496109_0328225 3300048912 Bacteria 1444
128 Ga0496109_0497532 3300048912 Bacteria 1151
129 Ga0496110_0254027 3300048913 Bacteria 1600
130 Ga0496110_0375347 3300048913 Bacteria 1296
131 Ga0496111_0027392 3300048914 Bacteria 4032
132 Ga0496112_0238724 3300048915 Bacteria 1771
133 Ga0496113_0205900 3300048916 Bacteria 1565
134 Ga0496113_0246630 3300048916 Bacteria 1425
135 Ga0496114_0002194 3300048917 Bacteria 14852
136 Ga0496114_0006700 3300048917 Bacteria 9074
137 Ga0496114_0029739 3300048917 Bacteria 4491
138 Ga0496114_0113749 3300048917 Bacteria 2320
139 Ga0496114_0253741 3300048917 Bacteria 1548
140 Ga0496115_0457162 3300048918 Bacteria 1030
141 Ga0501031_0003650 3300049568 Bacteria 9906
142 Ga0501031_0097338 3300049568 Bacteria 1920
143 Ga0501031_0388168 3300049568 Bacteria 903
144 Ga0501032_0070213 3300049569 Bacteria 2336
145 Ga0501032_0074653 3300049569 Bacteria 2259
146 Ga0501032_0086947 3300049569 Bacteria 2077
147 Ga0501033_0002669 3300049570 Bacteria 14983
148 Ga0501033_0084507 3300049570 Bacteria 2326
149 Ga0501033_0396828 3300049570 Bacteria 962
150 Ga0501034_0002988 3300049571 Bacteria 19576
151 Ga0501034_0014447 3300049571 Bacteria 8131
152 Ga0501034_0055204 3300049571 Bacteria 3998
153 Ga0501036_0015857 3300049572 Bacteria 6292
154 Ga0501036_0047275 3300049572 Bacteria 3645
155 Ga0501036_0117694 3300049572 Bacteria 2244
156 Ga0501036_0296869 3300049572 Bacteria 1351
157 Ga0501036_0395578 3300049572 Bacteria 1153
158 Ga0501036_0401885 3300049572 Bacteria 1143
159 Ga0501037_0001113 3300049573 Bacteria 19944
160 Ga0501037_0031006 3300049573 Bacteria 3948
161 Ga0501037_0176093 3300049573 Bacteria 1519
162 Ga0501037_0236821 3300049573 Bacteria 1280
163 Ga0501038_0004134 3300049574 Bacteria 13511
164 Ga0501038_0118732 3300049574 Bacteria 2183
165 Ga0501038_0143927 3300049574 Bacteria 1948
166 Ga0501038_0484414 3300049574 Bacteria 948
167 Ga0501039_0002962 3300049575 Bacteria 12708
168 Ga0501039_0023455 3300049575 Bacteria 4737
169 Ga0501039_0066265 3300049575 Bacteria 2803
170 Ga0501039_0161652 3300049575 Bacteria 1760
171 Ga0501040_0171608 3300049576 Bacteria 1536
172 Ga0501040_0250735 3300049576 Bacteria 1262
173 Ga0501040_0288266 3300049576 Bacteria 1173
174 Ga0501041_0141860 3300049577 Bacteria 1498
175 Ga0501041_0329148 3300049577 Bacteria 964
176 Ga0501042_0214234 3300049578 Bacteria 1389
177 Ga0501042_0362550 3300049578 Bacteria 1049
178 Ga0501043_0040876 3300049579 Bacteria 3644
179 Ga0501043_0099403 3300049579 Bacteria 2287
180 Ga0501043_0307413 3300049579 Bacteria 1210
181 Ga0501043_0401786 3300049579 Bacteria 1035
182 Ga0501043_0431791 3300049579 Bacteria 992
183 Ga0501046_0003206 3300049580 Bacteria 15050
184 Ga0501046_0012603 3300049580 Bacteria 7189
185 Ga0501046_0693815 3300049580 Bacteria 718
186 Ga0501047_0087630 3300049581 Bacteria 2990
187 Ga0501047_0125525 3300049581 Bacteria 2446
188 Ga0501048_0002196 3300049582 Bacteria 14842
189 Ga0501048_0003907 3300049582 Bacteria 11320
190 Ga0501048_0034976 3300049582 Bacteria 3620
191 Ga0501048_0075530 3300049582 Bacteria 2378
192 Ga0501048_0246161 3300049582 Bacteria 1269
193 Ga0501048_0997018 3300049582 Bacteria 603
194 Ga0501067_0019103 3300049583 Bacteria 3793
195 Ga0501067_0049340 3300049583 Bacteria 2333
196 Ga0501067_0109732 3300049583 Bacteria 1534
197 Ga0501067_0123737 3300049583 Bacteria 1439
198 Ga0501067_0273227 3300049583 Bacteria 941
199 Ga0501068_0011455 3300049584 Bacteria 5008
200 Ga0501069_0226997 3300049585 Bacteria 1086
201 Ga0501069_0404156 3300049585 Bacteria 808
202 Ga0501070_0017273 3300049586 Bacteria 6058
203 Ga0501070_0019007 3300049586 Bacteria 5763
204 Ga0501070_0068860 3300049586 Bacteria 2929
205 Ga0501070_0125598 3300049586 Bacteria 2120
206 Ga0501070_0135561 3300049586 Bacteria 2033
207 Ga0501070_0146771 3300049586 Bacteria 1947
208 Ga0501070_0370186 3300049586 Bacteria 1161
209 Ga0501070_0572037 3300049586 Bacteria 903
210 Ga0501071_0025260 3300049587 Bacteria 4160
211 Ga0501071_0195289 3300049587 Bacteria 1519
212 Ga0501071_0215643 3300049587 Bacteria 1444
213 Ga0501072_0020387 3300049588 Bacteria 5136
214 Ga0501072_0044766 3300049588 Bacteria 3480
215 Ga0501072_0255458 3300049588 Bacteria 1395
216 Ga0501072_0333225 3300049588 Bacteria 1205
217 Ga0501072_0518380 3300049588 Bacteria 942
218 Ga0501072_0620636 3300049588 Bacteria 852
219 Ga0501073_0011565 3300049589 Bacteria 6453
220 Ga0501073_0051686 3300049589 Bacteria 2878
221 Ga0501073_0469286 3300049589 Bacteria 870
222 Ga0501074_0002475 3300049590 Bacteria 12878
223 Ga0501074_0022146 3300049590 Bacteria 4616
224 Ga0501074_0131382 3300049590 Bacteria 1791
225 Ga0501074_0346891 3300049590 Bacteria 1054
226 Ga0501074_0639534 3300049590 Bacteria 752
227 Ga0501075_0019497 3300049591 Bacteria 4921
228 Ga0501076_0045966 3300049592 Bacteria 3449
229 Ga0501076_0114492 3300049592 Bacteria 2182
230 Ga0501076_0665714 3300049592 Bacteria 859
231 Ga0501076_0740593 3300049592 Bacteria 811
232 Ga0501077_0010180 3300049593 Bacteria 5855
233 Ga0501077_0138966 3300049593 Bacteria 1540
234 Ga0501077_0217478 3300049593 Bacteria 1214
235 Ga0501077_0399434 3300049593 Bacteria 879
236 Ga0501079_0393099 3300049741 Bacteria 1087
237 Ga0501080_0011987 3300049742 Bacteria 7941
238 Ga0501080_0028663 3300049742 Bacteria 5183
239 Ga0501080_0124433 3300049742 Bacteria 2388
240 Ga0501080_0517533 3300049742 Bacteria 1065
241 Ga0501083_0001649 3300049744 Bacteria 15227
242 Ga0501083_0035459 3300049744 Bacteria 3408
243 Ga0501035_0002047 3300049822 Bacteria 20101
244 Ga0501035_0246688 3300049822 Bacteria 1517
245 Ga0501035_0257118 3300049822 Bacteria 1481
246 Ga0501035_0409686 3300049822 Bacteria 1127
247 Ga0501044_0006225 3300049823 Bacteria 13190
248 Ga0501044_0090982 3300049823 Bacteria 3077
249 Ga0501044_0311864 3300049823 Bacteria 1499
250 Ga0501044_0558133 3300049823 Bacteria 1042
251 Ga0501045_0096950 3300049824 Bacteria 2182
252 nmdc:mga00v17_100600_c1 3300050491 Bacteria 1824
253 nmdc:mga00v17_23577_c1 3300050491 Bacteria 3560
254 nmdc:mga0yw44_337951_c1 3300050492 Bacteria 1013
255 nmdc:mga0yw44_58361_c1 3300050492 Bacteria 2357
256 nmdc:mga06z11_275048_c1 3300050494 Bacteria 996
257 nmdc:mga06z11_29918_c1 3300050494 Bacteria 2630
258 nmdc:mga06z11_3975_c2 3300050494 Bacteria 2663
259 Ga0495595_0147654 3300053084 Bacteria 1156
260 Ga0495619_0699460 3300053085 Bacteria 689
261 Ga0500573_0221642 3300053140 Bacteria 991
262 Ga0501084_0029161 3300054114 Bacteria 4615
263 Ga0501084_0091031 3300054114 Bacteria 2561
264 Ga0501084_0211410 3300054114 Bacteria 1637
265 Ga0501084_0491936 3300054114 Bacteria 1036
266 Ga0501082_0010984 3300060353 Bacteria 7790
267 Ga0501082_0071741 3300060353 Bacteria 2982
268 Ga0501082_0254750 3300060353 Bacteria 1527
269 Ga0530510_0164308 3300061734 Bacteria 1643
270 Ga0530510_0171150 3300061734 Bacteria 1609
271 Ga0530510_0603762 3300061734 Bacteria 835
272 Ga0530510_0675240 3300061734 Bacteria 787
273 2643826035 2643221561 Bacteria 4984412
274 2643893627 2643221576 Bacteria 5214352
275 2643962677 2643221590 Bacteria 5214697
276 2644035618 2643221604 Bacteria 5014917
277 2644101663 2643221617 Bacteria 5139111
278 2644115725 2643221620 Bacteria 5134593
279 2644232218 2643221641 Bacteria 4490190
280 2644532023 2643221696 Bacteria 5431823
281 2738868276 2738541305 Bacteria 4910150
282 2740169370 2739367898 Bacteria 4367674
283 2774392147 2773857762 Bacteria 5971770
284 2809195945 2808606439 Bacteria 5952208
285 2812332709 2811994874 Bacteria 5367947
286 2812351917 2811994878 Bacteria 5992952
287 2855387115 2855386786 Bacteria 4752232
288 2857484053 2857481737 Bacteria 4761446
289 2891970447 2891968417 Bacteria 5821697
290 2984580226 2984576629 Bacteria 4248407
291 2990259076 2990256926 Bacteria 4252839
292 8054612932 8054609563 Bacteria 5170090
293 Ga0501031_0122753
294 JGI24740J21852_10019155
295 JGI24735J21928_10028271
296 Ga0070658_10084490
297 Ga0070683_100008121
298 Ga0070680_100263176
299 Ga0070682_100082597
300 Ga0070682_100516179
301 Ga0070660_100038252
302 Ga0070660_100150476
303 Ga0070687_100073113
304 Ga0070688_100232502
305 Ga0070659_100043373
306 Ga0070701_10577956
307 Ga0070700_100072338
308 Ga0070708_100396136
309 Ga0070663_100277328
310 Ga0070678_100670080
311 Ga0070681_10094994
312 Ga0070685_10043428
313 Ga0070679_100001650
314 Ga0070684_100053608
315 Ga0070665_100002138
316 Ga0068856_100541798
317 Ga0068860_100000311
318 Ga0075365_10021323
319 Ga0075365_10055222
320 Ga0075365_10153288
321 Ga0075365_10213343
322 Ga0075363_100006379
323 Ga0075363_100078104
324 Ga0075364_10004843
325 Ga0075364_10094352
326 Ga0075367_10022295
327 Ga0075370_10019098
328 Ga0105243_10277209
329 Ga0105243_10346847
330 Ga0105243_11348496
331 Ga0105237_10076231
332 Ga0105239_10110017
333 Ga0105239_10787709
334 Ga0157375_10306499
335 Ga0157375_10314362
336 Ga0157376_10529545
337 Ga0182006_1104609
338 Ga0207647_10002418
339 Ga0207647_10139430
340 Ga0207705_10284872
341 Ga0207671_10235726
342 Ga0207660_10810461
343 Ga0207657_10060925
344 Ga0207657_10092665
345 Ga0207657_10172824
346 Ga0207652_10038141
347 Ga0207706_10193789
348 Ga0207709_10028167
349 Ga0207709_10241491
350 Ga0207661_10009728
351 Ga0207679_10043686
352 Ga0207668_10259350
353 Ga0207678_10213704
354 Ga0207708_10047904
355 Ga0207702_10329996
356 Ga0209813_10002932
357 Ga0209813_10207425
358 Ga0268266_10000855
359 Ga0268264_10000717
360 Ga0307408_100364223
361 Ga0307405_10110960
362 Ga0307405_10249144
363 Ga0307413_10615846
364 Ga0307410_10115907
365 Ga0307409_100039253
366 Ga0307409_100397643
367 Ga0307416_100836256
368 Ga0307414_10294764
369 Ga0307415_100692612
370 Ga0307415_100761263
371 Ga0395899_0120440
372 Ga0395898_0117647
373 Ga0395901_0097990
374 Ga0395901_0419193
375 Ga0439438_043158
376 Ga0451791_1509468
377 Ga0451853_2526805
378 Ga0439431_0008196
379 Ga0439442_020882
380 Ga0439446_0189659
381 Ga0439434_0006140
382 Ga0466969_0101817
383 Ga0466965_0161530
384 Ga0466966_0014311
385 Ga0466961_0002936
386 Ga0466961_0137055
387 Ga0466961_0236031
388 Ga0466963_0029233
389 Ga0466963_0032799
390 Ga0466963_0107541
391 Ga0466963_0355050
392 Ga0466971_0005336
393 Ga0466968_0029305
394 Ga0466970_0115186
395 Ga0466957_0118632
396 Ga0466960_0001488
397 Ga0466960_0033856
398 Ga0466960_0171943
399 Ga0466959_0049183
400 Ga0466967_0026304
401 Ga0466967_0057537
402 Ga0466967_0576500
403 Ga0466967_0631260
404 Ga0466967_1013954
405 Ga0495629_0400921
406 Ga0495582_0083637
407 Ga0495639_0119716
408 Ga0495613_0613010
409 Ga0496100_0047468
410 Ga0496101_0067721
411 Ga0496102_0284888
412 Ga0496103_0358644
413 Ga0496105_0018148
414 Ga0496105_0039029
415 Ga0496106_0015117
416 Ga0496107_0031511
417 Ga0496107_0472480
418 Ga0496108_0977102
419 Ga0496109_0328225
420 Ga0496109_0497532
421 Ga0496110_0254027
422 Ga0496110_0375347
423 Ga0496111_0027392
424 Ga0496112_0238724
425 Ga0496113_0205900
426 Ga0496113_0246630
427 Ga0496114_0002194
428 Ga0496114_0006700
429 Ga0496114_0029739
430 Ga0496114_0113749
431 Ga0496114_0253741
432 Ga0496115_0457162
433 Ga0501031_0003650
434 Ga0501031_0097338
435 Ga0501031_0388168
436 Ga0501032_0070213
437 Ga0501032_0074653
438 Ga0501032_0086947
439 Ga0501033_0002669
440 Ga0501033_0084507
441 Ga0501033_0396828
442 Ga0501034_0002988
443 Ga0501034_0014447
444 Ga0501034_0055204
445 Ga0501036_0015857
446 Ga0501036_0047275
447 Ga0501036_0117694
448 Ga0501036_0296869
449 Ga0501036_0395578
450 Ga0501036_0401885
451 Ga0501037_0001113
452 Ga0501037_0031006
453 Ga0501037_0176093
454 Ga0501037_0236821
455 Ga0501038_0004134
456 Ga0501038_0118732
457 Ga0501038_0143927
458 Ga0501038_0484414
459 Ga0501039_0002962
460 Ga0501039_0023455
461 Ga0501039_0066265
462 Ga0501039_0161652
463 Ga0501040_0171608
464 Ga0501040_0250735
465 Ga0501040_0288266
466 Ga0501041_0141860
467 Ga0501041_0329148
468 Ga0501042_0214234
469 Ga0501042_0362550
470 Ga0501043_0040876
471 Ga0501043_0099403
472 Ga0501043_0307413
473 Ga0501043_0401786
474 Ga0501043_0431791
475 Ga0501046_0003206
476 Ga0501046_0012603
477 Ga0501046_0693815
478 Ga0501047_0087630
479 Ga0501047_0125525
480 Ga0501048_0002196
481 Ga0501048_0003907
482 Ga0501048_0034976
483 Ga0501048_0075530
484 Ga0501048_0246161
485 Ga0501048_0997018
486 Ga0501067_0019103
487 Ga0501067_0049340
488 Ga0501067_0109732
489 Ga0501067_0123737
490 Ga0501067_0273227
491 Ga0501068_0011455
492 Ga0501069_0226997
493 Ga0501069_0404156
494 Ga0501070_0017273
495 Ga0501070_0019007
496 Ga0501070_0068860
497 Ga0501070_0125598
498 Ga0501070_0135561
499 Ga0501070_0146771
500 Ga0501070_0370186
501 Ga0501070_0572037
502 Ga0501071_0025260
503 Ga0501071_0195289
504 Ga0501071_0215643
505 Ga0501072_0020387
506 Ga0501072_0044766
507 Ga0501072_0255458
508 Ga0501072_0333225
509 Ga0501072_0518380
510 Ga0501072_0620636
511 Ga0501073_0011565
512 Ga0501073_0051686
513 Ga0501073_0469286
514 Ga0501074_0002475
515 Ga0501074_0022146
516 Ga0501074_0131382
517 Ga0501074_0346891
518 Ga0501074_0639534
519 Ga0501075_0019497
520 Ga0501076_0045966
521 Ga0501076_0114492
522 Ga0501076_0665714
523 Ga0501076_0740593
524 Ga0501077_0010180
525 Ga0501077_0138966
526 Ga0501077_0217478
527 Ga0501077_0399434
528 Ga0501079_0393099
529 Ga0501080_0011987
530 Ga0501080_0028663
531 Ga0501080_0124433
532 Ga0501080_0517533
533 Ga0501083_0001649
534 Ga0501083_0035459
535 Ga0501035_0002047
536 Ga0501035_0246688
537 Ga0501035_0257118
538 Ga0501035_0409686
539 Ga0501044_0006225
540 Ga0501044_0090982
541 Ga0501044_0311864
542 Ga0501044_0558133
543 Ga0501045_0096950
544 nmdc:mga00v17_100600_c1
545 nmdc:mga00v17_23577_c1
546 nmdc:mga0yw44_337951_c1
547 nmdc:mga0yw44_58361_c1
548 nmdc:mga06z11_275048_c1
549 nmdc:mga06z11_29918_c1
550 nmdc:mga06z11_3975_c2
551 Ga0495595_0147654
552 Ga0495619_0699460
553 Ga0500573_0221642
554 Ga0501084_0029161
555 Ga0501084_0091031
556 Ga0501084_0211410
557 Ga0501084_0491936
558 Ga0501082_0010984
559 Ga0501082_0071741
560 Ga0501082_0254750
561 Ga0530510_0164308
562 Ga0530510_0171150
563 Ga0530510_0603762
564 Ga0530510_0675240
565 2643826035
566 2643893627
567 2643962677
568 2644035618
569 2644101663
570 2644115725
571 2644232218
572 2644532023
573 2738868276
574 2740169370
575 2774392147
576 2809195945
577 2812332709
578 2812351917
579 2855387115
580 2857484053
581 2891970447
582 2984580226
583 2990259076
584 8054612932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18859

acVLRF1

Actinobacteria/chloroflexi VLRF1 release factor

72

205

0.94

PF18854

baeRF_family10

Bacterial archaeo-eukaryotic release factor family 10

59

200

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xb3-assembly5.cif.gz_I structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.788 74 102
6xb3-assembly5.cif.gz_J structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.785 74 102
6xb3-assembly1.cif.gz_A structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.7824 74 102
2vrt-assembly4.cif.gz_D crystal structure of e. coli rnase e possessing m1 rna fragments - catalytic domain 0.779 72 100
6xb3-assembly3.cif.gz_E structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.7653 74 102
ID Description Score Start End Superfamily
af_Q8BYR5_896_1297_1.10.357.50 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2; 0.8082 107 138 1.10.357.50
af_A0A2R8RKZ9_1185_1335_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8021 25 45 2.60.120.200
af_A4IAE7_460_805_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7701 23 47 2.130.10.10
af_A4I2W3_139_278_3.30.420.60 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;eRF1 domain 2 0.7596 72 194 3.30.420.60
af_X1WH23_7_262_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7552 72 100 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2D9H573-F1-model_v4 Actinobacteria/chloroflexi VLRF1 release factor domain-containing protein 0.9699 2 202
AF-A0A2D9H573-F1-model_v4 Actinobacteria/chloroflexi VLRF1 release factor domain-containing protein 0.9605 2 202
AF-A0A316TL65-F1-model_v4 Actinobacteria/chloroflexi VLRF1 release factor domain-containing protein 0.946 1 202
AF-A0A6H1A1M6-F1-model_v4 Actinobacteria/chloroflexi VLRF1 release factor domain-containing protein 0.9092 1 202
AF-A0A6H1A1M6-F1-model_v4 Actinobacteria/chloroflexi VLRF1 release factor domain-containing protein 0.9049 1 202

Map