F391084

General Info

Members Datasets Scaffolds Average Seq Length
292 153 584 270

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0152974|Ga0466969_0152974_70_840
Length 248
Sequence VKEFALLAELERRGLIVGVEHDAAQIEGLVVTQDTLVEGVHFRFDLLDRRELGFRAAAVNISDLAASGAEPVALVVTLAAPDLDGAIELYEGIAEAGVPVRGGDTTRADSVVVTVTALGRAGRVPDLLVVTGPLGGAGAAFRAGRLLRPPIRIAEGRKLARVATAMLDLSDGLGPDAGHIARRSGCRLVIDLDRVPLADGATLDDLAFGEDNELLAATPDPLDFAVVGRCEEGSGVEPAGLGGWEHFR

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 7.88
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 4.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0152974 3300044656 Bacteria 1062
2 rootH1_10199770 3300003323 Bacteria 2876
3 Ga0070658_10026196 3300005327 Bacteria 4678
4 Ga0070658_10518433 3300005327 Bacteria 1030
5 Ga0070683_100010545 3300005329 Bacteria 7944
6 Ga0070683_100073451 3300005329 Bacteria 3194
7 Ga0070680_100090743 3300005336 Bacteria 2529
8 Ga0070682_100023542 3300005337 Bacteria 3657
9 Ga0070660_100006496 3300005339 Bacteria 8110
10 Ga0070691_10119115 3300005341 Bacteria 1327
11 Ga0070671_100419098 3300005355 Bacteria 1146
12 Ga0070659_100103347 3300005366 Bacteria 2295
13 Ga0070709_10086871 3300005434 Bacteria 2054
14 Ga0070714_100011685 3300005435 Bacteria 6972
15 Ga0070714_100043750 3300005435 Bacteria 3789
16 Ga0070714_100093033 3300005435 Bacteria 2643
17 Ga0070714_100266053 3300005435 Bacteria 1589
18 Ga0070714_100315422 3300005435 Unclassified 1461
19 Ga0070714_100329894 3300005435 Bacteria 1429
20 Ga0070713_100068559 3300005436 Bacteria 2989
21 Ga0070713_100371321 3300005436 Bacteria 1331
22 Ga0070681_10023372 3300005458 Bacteria 6216
23 Ga0070681_10065182 3300005458 Bacteria 3612
24 Ga0070681_10206119 3300005458 Bacteria 1883
25 Ga0070685_10297184 3300005466 Bacteria 1087
26 Ga0070679_100034049 3300005530 Bacteria 5047
27 Ga0070679_100086866 3300005530 Bacteria 3114
28 Ga0070679_100184891 3300005530 Bacteria 2055
29 Ga0070679_100253709 3300005530 Bacteria 1715
30 Ga0070684_100002645 3300005535 Bacteria 13223
31 Ga0070684_100039848 3300005535 Bacteria 4043
32 Ga0068855_100098043 3300005563 Bacteria 3377
33 Ga0070664_100197918 3300005564 Bacteria 1792
34 Ga0068870_10181599 3300005840 Bacteria 1263
35 Ga0081539_10178312 3300005985 Bacteria 999
36 Ga0070717_10005225 3300006028 Bacteria 9459
37 Ga0070717_10049946 3300006028 Bacteria 3435
38 Ga0070716_100008868 3300006173 Bacteria 4998
39 Ga0075431_100444321 3300006847 Unclassified 1293
40 Ga0075433_10126139 3300006852 Bacteria 2273
41 Ga0075433_10321065 3300006852 Bacteria 1370
42 Ga0075434_100021350 3300006871 Bacteria 6292
43 Ga0075434_100148894 3300006871 Bacteria 2360
44 Ga0114129_10810492 3300009147 Unclassified 1194
45 Ga0105248_10507893 3300009177 Bacteria 1359
46 Ga0105237_10239354 3300009545 Bacteria 1816
47 Ga0157373_10361335 3300013100 Unclassified 1036
48 Ga0157370_10345340 3300013104 Bacteria 1372
49 Ga0157374_10057906 3300013296 Bacteria 3620
50 Ga0157372_10116360 3300013307 Bacteria 3065
51 Ga0157377_10171886 3300014745 Bacteria 1356
52 Ga0206354_10672702 3300020081 Bacteria 1729
53 Ga0206353_10288702 3300020082 Bacteria 4173
54 Ga0207705_10022248 3300025909 Bacteria 4522
55 Ga0207705_10040237 3300025909 Bacteria 3352
56 Ga0207705_10223705 3300025909 Bacteria 1430
57 Ga0207707_10375813 3300025912 Bacteria 1222
58 Ga0207707_10431708 3300025912 Unclassified 1128
59 Ga0207695_10072666 3300025913 Bacteria 3508
60 Ga0207693_10503550 3300025915 Bacteria 945
61 Ga0207663_10001508 3300025916 Bacteria 10873
62 Ga0207657_10015976 3300025919 Bacteria 7248
63 Ga0207657_10045730 3300025919 Bacteria 3839
64 Ga0207657_10254936 3300025919 Bacteria 1397
65 Ga0207649_10075596 3300025920 Bacteria 2165
66 Ga0207652_10019422 3300025921 Bacteria 5589
67 Ga0207652_10085958 3300025921 Bacteria 2757
68 Ga0207652_10097281 3300025921 Bacteria 2594
69 Ga0207652_10380984 3300025921 Bacteria 1273
70 Ga0207652_10466611 3300025921 Bacteria 1138
71 Ga0207646_10001031 3300025922 Bacteria 35603
72 Ga0207687_10043708 3300025927 Bacteria 3088
73 Ga0207700_10030363 3300025928 Bacteria 3827
74 Ga0207664_10131576 3300025929 Bacteria 2106
75 Ga0207664_10182329 3300025929 Bacteria 1803
76 Ga0207664_10263012 3300025929 Bacteria 1509
77 Ga0207664_10417341 3300025929 Bacteria 1195
78 Ga0207709_10023022 3300025935 Bacteria 3541
79 Ga0207665_10000835 3300025939 Bacteria 20809
80 Ga0207661_10046621 3300025944 Bacteria 3437
81 Ga0207661_10061472 3300025944 Bacteria 3035
82 Ga0207679_10130466 3300025945 Bacteria 2015
83 Ga0207658_10003585 3300025986 Bacteria 10964
84 Ga0207674_10325981 3300026116 Bacteria 1485
85 Ga0265319_1026125 3300028563 Bacteria 2084
86 Ga0265334_10019552 3300028573 Bacteria 2784
87 Ga0265318_10001303 3300028577 Bacteria 15009
88 Ga0265318_10122384 3300028577 Unclassified 957
89 Ga0265322_10028787 3300028654 Bacteria 1587
90 Ga0265338_10003221 3300028800 Bacteria 23276
91 Ga0265338_10012864 3300028800 Bacteria 9509
92 Ga0265338_10043898 3300028800 Bacteria 4137
93 Ga0265338_10046261 3300028800 Bacteria 3989
94 Ga0265330_10001454 3300031235 Bacteria 13806
95 Ga0265328_10000553 3300031239 Bacteria 17405
96 Ga0265325_10001515 3300031241 Bacteria 16326
97 Ga0265325_10031289 3300031241 Bacteria 2849
98 Ga0265329_10009819 3300031242 Bacteria 3546
99 Ga0265340_10003712 3300031247 Bacteria 8594
100 Ga0265339_10003002 3300031249 Bacteria 11894
101 Ga0265339_10004365 3300031249 Bacteria 9652
102 Ga0265339_10133493 3300031249 Unclassified 1267
103 Ga0265331_10001988 3300031250 Bacteria 14279
104 Ga0265331_10153400 3300031250 Bacteria 1045
105 Ga0265327_10003921 3300031251 Bacteria 13660
106 Ga0265327_10030936 3300031251 Bacteria 3015
107 Ga0265316_10004716 3300031344 Bacteria 13502
108 Ga0265316_10011484 3300031344 Bacteria 7982
109 Ga0265313_10003149 3300031595 Bacteria 13619
110 Ga0265313_10007349 3300031595 Bacteria 7549
111 Ga0265313_10026510 3300031595 Bacteria 3051
112 Ga0265314_10003611 3300031711 Bacteria 14879
113 Ga0265314_10012767 3300031711 Bacteria 6828
114 Ga0265342_10001768 3300031712 Bacteria 19717
115 Ga0265342_10062322 3300031712 Bacteria 2195
116 Ga0307406_10055215 3300031901 Bacteria 2538
117 Ga0307412_10012440 3300031911 Bacteria 4964
118 Ga0307409_100087845 3300031995 Bacteria 2535
119 Ga0307411_10041613 3300032005 Bacteria 2925
120 Ga0373934_0147395 3300035086 Bacteria 963
121 Ga0373937_0035770 3300036401 Bacteria 4522
122 Ga0373925_0159163 3300037068 Bacteria 1778
123 Ga0395899_0036391 3300037312 Bacteria 3692
124 Ga0395900_0103993 3300037418 Bacteria 2917
125 Ga0395900_0118965 3300037418 Bacteria 2711
126 Ga0395900_0128657 3300037418 Bacteria 2596
127 Ga0395900_0228933 3300037418 Bacteria 1870
128 Ga0395898_0013441 3300037466 Bacteria 8431
129 Ga0395898_0022599 3300037466 Bacteria 6368
130 Ga0395898_0069532 3300037466 Bacteria 3406
131 Ga0395898_0133021 3300037466 Bacteria 2381
132 Ga0395898_0236934 3300037466 Unclassified 1740
133 Ga0395898_0686899 3300037466 Bacteria 966
134 Ga0395905_0047513 3300037471 Bacteria 4022
135 Ga0395905_0106083 3300037471 Bacteria 2638
136 Ga0395905_0116813 3300037471 Unclassified 2507
137 Ga0395905_0159821 3300037471 Bacteria 2118
138 Ga0395901_0043994 3300038443 Bacteria 4631
139 Ga0395901_0052723 3300038443 Bacteria 4227
140 Ga0395901_0058232 3300038443 Bacteria 4019
141 Ga0395901_0092851 3300038443 Bacteria 3159
142 Ga0466965_0010523 3300044683 Bacteria 4321
143 Ga0466965_0159860 3300044683 Unclassified 1181
144 Ga0466966_0151621 3300044684 Bacteria 1413
145 Ga0466961_0007361 3300044693 Bacteria 7001
146 Ga0466961_0039478 3300044693 Bacteria 3026
147 Ga0466961_0145964 3300044693 Bacteria 1479
148 Ga0466961_0218485 3300044693 Bacteria 1175
149 Ga0466963_0015728 3300044694 Bacteria 4694
150 Ga0466963_0022968 3300044694 Bacteria 3955
151 Ga0466963_0027378 3300044694 Bacteria 3649
152 Ga0466963_0030190 3300044694 Bacteria 3495
153 Ga0466963_0091260 3300044694 Bacteria 2074
154 Ga0466963_0099452 3300044694 Bacteria 1989
155 Ga0466964_0000605 3300044706 Bacteria 11363
156 Ga0466964_0000742 3300044706 Bacteria 10605
157 Ga0466964_0009762 3300044706 Bacteria 3617
158 Ga0466964_0011891 3300044706 Bacteria 3290
159 Ga0466964_0106867 3300044706 Bacteria 1242
160 Ga0466964_0125046 3300044706 Bacteria 1164
161 Ga0466971_0000943 3300044719 Bacteria 11933
162 Ga0466971_0003709 3300044719 Bacteria 6533
163 Ga0466971_0037771 3300044719 Bacteria 2165
164 Ga0466968_0017320 3300044735 Bacteria 2878
165 Ga0466968_0036146 3300044735 Bacteria 2069
166 Ga0466968_0038451 3300044735 Bacteria 2011
167 Ga0466970_0040609 3300044765 Bacteria 2471
168 Ga0466957_0006799 3300044842 Bacteria 6462
169 Ga0466957_0012815 3300044842 Bacteria 4859
170 Ga0466957_0101005 3300044842 Bacteria 1818
171 Ga0466960_0002443 3300044901 Bacteria 6998
172 Ga0466960_0041161 3300044901 Bacteria 2188
173 Ga0466959_0041359 3300045049 Bacteria 3402
174 Ga0466959_0069344 3300045049 Bacteria 2554
175 Ga0466959_0121031 3300045049 Bacteria 1861
176 Ga0466958_0072066 3300045836 Bacteria 2115
177 Ga0466958_0158289 3300045836 Bacteria 1430
178 Ga0466967_0000861 3300045976 Bacteria 16138
179 Ga0466967_0001889 3300045976 Bacteria 12650
180 Ga0466967_0012912 3300045976 Bacteria 6422
181 Ga0466967_0016470 3300045976 Bacteria 5831
182 Ga0466967_0019255 3300045976 Bacteria 5484
183 Ga0466967_0043805 3300045976 Bacteria 3877
184 Ga0466967_0064843 3300045976 Bacteria 3250
185 Ga0466967_0100639 3300045976 Bacteria 2641
186 Ga0466967_0110568 3300045976 Bacteria 2524
187 Ga0466967_0127512 3300045976 Bacteria 2358
188 Ga0466967_0139312 3300045976 Bacteria 2258
189 Ga0466967_0230949 3300045976 Bacteria 1761
190 Ga0466967_0289074 3300045976 Bacteria 1574
191 Ga0466967_0357448 3300045976 Bacteria 1414
192 Ga0495592_0000050 3300046454 Bacteria 111971
193 Ga0495592_0082399 3300046454 Bacteria 2325
194 Ga0495629_0006635 3300046459 Bacteria 8564
195 Ga0495641_0017282 3300046461 Bacteria 3763
196 Ga0495641_0139751 3300046461 Bacteria 1082
197 Ga0495651_0000028 3300046462 Bacteria 105473
198 Ga0495651_0097543 3300046462 Bacteria 2194
199 Ga0495651_0123602 3300046462 Bacteria 1898
200 Ga0495653_0008999 3300046463 Bacteria 8169
201 Ga0495653_0071013 3300046463 Bacteria 2604
202 Ga0495653_0097980 3300046463 Bacteria 2129
203 Ga0495582_0064248 3300046473 Bacteria 2026
204 Ga0495639_0070664 3300046475 Bacteria 1612
205 Ga0495664_0172440 3300046477 Bacteria 1312
206 Ga0495608_0061490 3300046511 Bacteria 2469
207 Ga0495608_0077930 3300046511 Bacteria 2157
208 Ga0495618_0012489 3300046514 Bacteria 5158
209 Ga0495618_0062192 3300046514 Bacteria 2368
210 Ga0495628_0000060 3300046516 Bacteria 87173
211 Ga0495628_0033148 3300046516 Bacteria 4164
212 Ga0495630_0015140 3300046517 Bacteria 5628
213 Ga0495630_0021734 3300046517 Bacteria 4738
214 Ga0495652_0024580 3300046529 Bacteria 5331
215 Ga0495640_0016482 3300046533 Bacteria 5527
216 Ga0495586_0002209 3300046535 Bacteria 10571
217 Ga0495587_0000062 3300046536 Bacteria 91862
218 Ga0495645_0000207 3300046543 Bacteria 42086
219 Ga0495667_0044644 3300046559 Bacteria 2935
220 Ga0495667_0051461 3300046559 Bacteria 2717
221 Ga0495667_0252949 3300046559 Bacteria 1121
222 Ga0495634_0029685 3300046642 Bacteria 3784
223 Ga0495635_0011392 3300046663 Bacteria 6237
224 Ga0495657_0044955 3300046675 Bacteria 2999
225 Ga0495657_0136010 3300046675 Bacteria 1535
226 Ga0495599_0030232 3300046678 Bacteria 3397
227 Ga0495623_0000230 3300046679 Bacteria 35964
228 Ga0495646_0006958 3300046680 Bacteria 7180
229 Ga0495646_0162547 3300046680 Bacteria 1235
230 Ga0495658_0172768 3300046683 Bacteria 1338
231 Ga0495613_0009460 3300046689 Bacteria 7228
232 Ga0495613_0038824 3300046689 Bacteria 3529
233 Ga0495613_0074444 3300046689 Bacteria 2473
234 Ga0495613_0249579 3300046689 Unclassified 1239
235 Ga0495613_0291715 3300046689 Bacteria 1131
236 Ga0495624_0050021 3300046690 Bacteria 2649
237 Ga0495600_0052616 3300046809 Bacteria 2659
238 Ga0495604_0000242 3300047317 Bacteria 48737
239 Ga0495604_0306164 3300047317 Bacteria 1066
240 Ga0495674_0025974 3300047319 Bacteria 5360
241 Ga0495674_0428178 3300047319 Unclassified 1065
242 Ga0495676_0019388 3300047321 Bacteria 5983
243 Ga0495680_0045025 3300047322 Bacteria 3486
244 Ga0495680_0046770 3300047322 Bacteria 3409
245 Ga0495675_0000020 3300047444 Bacteria 111526
246 Ga0495684_0050966 3300047471 Bacteria 3159
247 Ga0495684_0130795 3300047471 Bacteria 1885
248 Ga0495684_0145208 3300047471 Bacteria 1777
249 Ga0495602_0000222 3300048088 Bacteria 53050
250 Ga0495602_0045121 3300048088 Bacteria 3991
251 Ga0495602_0461253 3300048088 Bacteria 895
252 Ga0496101_0009481 3300048904 Bacteria 6398
253 Ga0496101_0439505 3300048904 Bacteria 1029
254 Ga0496103_0019582 3300048906 Bacteria 4063
255 Ga0496103_0113952 3300048906 Bacteria 1719
256 Ga0496104_0013132 3300048907 Bacteria 7465
257 Ga0496104_0209129 3300048907 Bacteria 1863
258 Ga0496106_0001856 3300048909 Bacteria 15812
259 Ga0496106_0002999 3300048909 Bacteria 12571
260 Ga0496107_0007725 3300048910 Bacteria 7426
261 Ga0496108_0010043 3300048911 Bacteria 7677
262 Ga0496108_0018921 3300048911 Bacteria 5648
263 Ga0496110_0027322 3300048913 Bacteria 4891
264 Ga0496111_0021897 3300048914 Bacteria 4468
265 Ga0496111_0039947 3300048914 Bacteria 3366
266 Ga0496111_0070787 3300048914 Bacteria 2538
267 Ga0496112_0006380 3300048915 Bacteria 10354
268 Ga0496112_0016593 3300048915 Bacteria 6903
269 Ga0496112_0205839 3300048915 Bacteria 1926
270 Ga0496113_0005587 3300048916 Bacteria 7860
271 Ga0496113_0119163 3300048916 Bacteria 2062
272 Ga0496115_0013970 3300048918 Bacteria 6077
273 Ga0496115_0221941 3300048918 Bacteria 1559
274 Ga0496115_0253524 3300048918 Bacteria 1448
275 Ga0501067_0061026 3300049583 Bacteria 2087
276 Ga0501069_0011752 3300049585 Bacteria 4643
277 nmdc:mga05p37_1147203_c1 3300050507 Bacteria 809
278 nmdc:mga0n895_258508_c1 3300050512 Bacteria 1767
279 nmdc:mga0n895_27788_c1 3300050512 Bacteria 5377
280 nmdc:mga0n895_362148_c1 3300050512 Bacteria 1468
281 nmdc:mga0a205_94809_c1 3300050515 Bacteria 2883
282 Ga0495601_0000967 3300053077 Bacteria 15693
283 Ga0495601_0074646 3300053077 Bacteria 2169
284 Ga0495612_0045021 3300053078 Bacteria 1806
285 Ga0495595_0036903 3300053084 Bacteria 2220
286 Ga0495619_0012071 3300053085 Bacteria 5443
287 Ga0495619_0031354 3300053085 Bacteria 3445
288 Ga0500566_0099645 3300053094 Bacteria 1595
289 Ga0466962_0000666 3300061719 Bacteria 15245
290 Ga0466962_0002358 3300061719 Bacteria 8961
291 Ga0466962_0026727 3300061719 Bacteria 2771
292 Ga0466962_0034066 3300061719 Bacteria 2437
293 Ga0466969_0152974
294 rootH1_10199770
295 Ga0070658_10026196
296 Ga0070658_10518433
297 Ga0070683_100010545
298 Ga0070683_100073451
299 Ga0070680_100090743
300 Ga0070682_100023542
301 Ga0070660_100006496
302 Ga0070691_10119115
303 Ga0070671_100419098
304 Ga0070659_100103347
305 Ga0070709_10086871
306 Ga0070714_100011685
307 Ga0070714_100043750
308 Ga0070714_100093033
309 Ga0070714_100266053
310 Ga0070714_100315422
311 Ga0070714_100329894
312 Ga0070713_100068559
313 Ga0070713_100371321
314 Ga0070681_10023372
315 Ga0070681_10065182
316 Ga0070681_10206119
317 Ga0070685_10297184
318 Ga0070679_100034049
319 Ga0070679_100086866
320 Ga0070679_100184891
321 Ga0070679_100253709
322 Ga0070684_100002645
323 Ga0070684_100039848
324 Ga0068855_100098043
325 Ga0070664_100197918
326 Ga0068870_10181599
327 Ga0081539_10178312
328 Ga0070717_10005225
329 Ga0070717_10049946
330 Ga0070716_100008868
331 Ga0075431_100444321
332 Ga0075433_10126139
333 Ga0075433_10321065
334 Ga0075434_100021350
335 Ga0075434_100148894
336 Ga0114129_10810492
337 Ga0105248_10507893
338 Ga0105237_10239354
339 Ga0157373_10361335
340 Ga0157370_10345340
341 Ga0157374_10057906
342 Ga0157372_10116360
343 Ga0157377_10171886
344 Ga0206354_10672702
345 Ga0206353_10288702
346 Ga0207705_10022248
347 Ga0207705_10040237
348 Ga0207705_10223705
349 Ga0207707_10375813
350 Ga0207707_10431708
351 Ga0207695_10072666
352 Ga0207693_10503550
353 Ga0207663_10001508
354 Ga0207657_10015976
355 Ga0207657_10045730
356 Ga0207657_10254936
357 Ga0207649_10075596
358 Ga0207652_10019422
359 Ga0207652_10085958
360 Ga0207652_10097281
361 Ga0207652_10380984
362 Ga0207652_10466611
363 Ga0207646_10001031
364 Ga0207687_10043708
365 Ga0207700_10030363
366 Ga0207664_10131576
367 Ga0207664_10182329
368 Ga0207664_10263012
369 Ga0207664_10417341
370 Ga0207709_10023022
371 Ga0207665_10000835
372 Ga0207661_10046621
373 Ga0207661_10061472
374 Ga0207679_10130466
375 Ga0207658_10003585
376 Ga0207674_10325981
377 Ga0265319_1026125
378 Ga0265334_10019552
379 Ga0265318_10001303
380 Ga0265318_10122384
381 Ga0265322_10028787
382 Ga0265338_10003221
383 Ga0265338_10012864
384 Ga0265338_10043898
385 Ga0265338_10046261
386 Ga0265330_10001454
387 Ga0265328_10000553
388 Ga0265325_10001515
389 Ga0265325_10031289
390 Ga0265329_10009819
391 Ga0265340_10003712
392 Ga0265339_10003002
393 Ga0265339_10004365
394 Ga0265339_10133493
395 Ga0265331_10001988
396 Ga0265331_10153400
397 Ga0265327_10003921
398 Ga0265327_10030936
399 Ga0265316_10004716
400 Ga0265316_10011484
401 Ga0265313_10003149
402 Ga0265313_10007349
403 Ga0265313_10026510
404 Ga0265314_10003611
405 Ga0265314_10012767
406 Ga0265342_10001768
407 Ga0265342_10062322
408 Ga0307406_10055215
409 Ga0307412_10012440
410 Ga0307409_100087845
411 Ga0307411_10041613
412 Ga0373934_0147395
413 Ga0373937_0035770
414 Ga0373925_0159163
415 Ga0395899_0036391
416 Ga0395900_0103993
417 Ga0395900_0118965
418 Ga0395900_0128657
419 Ga0395900_0228933
420 Ga0395898_0013441
421 Ga0395898_0022599
422 Ga0395898_0069532
423 Ga0395898_0133021
424 Ga0395898_0236934
425 Ga0395898_0686899
426 Ga0395905_0047513
427 Ga0395905_0106083
428 Ga0395905_0116813
429 Ga0395905_0159821
430 Ga0395901_0043994
431 Ga0395901_0052723
432 Ga0395901_0058232
433 Ga0395901_0092851
434 Ga0466965_0010523
435 Ga0466965_0159860
436 Ga0466966_0151621
437 Ga0466961_0007361
438 Ga0466961_0039478
439 Ga0466961_0145964
440 Ga0466961_0218485
441 Ga0466963_0015728
442 Ga0466963_0022968
443 Ga0466963_0027378
444 Ga0466963_0030190
445 Ga0466963_0091260
446 Ga0466963_0099452
447 Ga0466964_0000605
448 Ga0466964_0000742
449 Ga0466964_0009762
450 Ga0466964_0011891
451 Ga0466964_0106867
452 Ga0466964_0125046
453 Ga0466971_0000943
454 Ga0466971_0003709
455 Ga0466971_0037771
456 Ga0466968_0017320
457 Ga0466968_0036146
458 Ga0466968_0038451
459 Ga0466970_0040609
460 Ga0466957_0006799
461 Ga0466957_0012815
462 Ga0466957_0101005
463 Ga0466960_0002443
464 Ga0466960_0041161
465 Ga0466959_0041359
466 Ga0466959_0069344
467 Ga0466959_0121031
468 Ga0466958_0072066
469 Ga0466958_0158289
470 Ga0466967_0000861
471 Ga0466967_0001889
472 Ga0466967_0012912
473 Ga0466967_0016470
474 Ga0466967_0019255
475 Ga0466967_0043805
476 Ga0466967_0064843
477 Ga0466967_0100639
478 Ga0466967_0110568
479 Ga0466967_0127512
480 Ga0466967_0139312
481 Ga0466967_0230949
482 Ga0466967_0289074
483 Ga0466967_0357448
484 Ga0495592_0000050
485 Ga0495592_0082399
486 Ga0495629_0006635
487 Ga0495641_0017282
488 Ga0495641_0139751
489 Ga0495651_0000028
490 Ga0495651_0097543
491 Ga0495651_0123602
492 Ga0495653_0008999
493 Ga0495653_0071013
494 Ga0495653_0097980
495 Ga0495582_0064248
496 Ga0495639_0070664
497 Ga0495664_0172440
498 Ga0495608_0061490
499 Ga0495608_0077930
500 Ga0495618_0012489
501 Ga0495618_0062192
502 Ga0495628_0000060
503 Ga0495628_0033148
504 Ga0495630_0015140
505 Ga0495630_0021734
506 Ga0495652_0024580
507 Ga0495640_0016482
508 Ga0495586_0002209
509 Ga0495587_0000062
510 Ga0495645_0000207
511 Ga0495667_0044644
512 Ga0495667_0051461
513 Ga0495667_0252949
514 Ga0495634_0029685
515 Ga0495635_0011392
516 Ga0495657_0044955
517 Ga0495657_0136010
518 Ga0495599_0030232
519 Ga0495623_0000230
520 Ga0495646_0006958
521 Ga0495646_0162547
522 Ga0495658_0172768
523 Ga0495613_0009460
524 Ga0495613_0038824
525 Ga0495613_0074444
526 Ga0495613_0249579
527 Ga0495613_0291715
528 Ga0495624_0050021
529 Ga0495600_0052616
530 Ga0495604_0000242
531 Ga0495604_0306164
532 Ga0495674_0025974
533 Ga0495674_0428178
534 Ga0495676_0019388
535 Ga0495680_0045025
536 Ga0495680_0046770
537 Ga0495675_0000020
538 Ga0495684_0050966
539 Ga0495684_0130795
540 Ga0495684_0145208
541 Ga0495602_0000222
542 Ga0495602_0045121
543 Ga0495602_0461253
544 Ga0496101_0009481
545 Ga0496101_0439505
546 Ga0496103_0019582
547 Ga0496103_0113952
548 Ga0496104_0013132
549 Ga0496104_0209129
550 Ga0496106_0001856
551 Ga0496106_0002999
552 Ga0496107_0007725
553 Ga0496108_0010043
554 Ga0496108_0018921
555 Ga0496110_0027322
556 Ga0496111_0021897
557 Ga0496111_0039947
558 Ga0496111_0070787
559 Ga0496112_0006380
560 Ga0496112_0016593
561 Ga0496112_0205839
562 Ga0496113_0005587
563 Ga0496113_0119163
564 Ga0496115_0013970
565 Ga0496115_0221941
566 Ga0496115_0253524
567 Ga0501067_0061026
568 Ga0501069_0011752
569 nmdc:mga05p37_1147203_c1
570 nmdc:mga0n895_258508_c1
571 nmdc:mga0n895_27788_c1
572 nmdc:mga0n895_362148_c1
573 nmdc:mga0a205_94809_c1
574 Ga0495601_0000967
575 Ga0495601_0074646
576 Ga0495612_0045021
577 Ga0495595_0036903
578 Ga0495619_0012071
579 Ga0495619_0031354
580 Ga0500566_0099645
581 Ga0466962_0000666
582 Ga0466962_0002358
583 Ga0466962_0026727
584 Ga0466962_0034066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

20

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9s-assembly1.cif.gz_B aathil complexed with amppcp 0.905 1 260
6mfm-assembly1.cif.gz_A structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form 0.8777 30 271
1vqv-assembly1.cif.gz_B crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.8771 2 263
3c9s-assembly1.cif.gz_B aathil complexed with amppcp 0.8668 1 260
1vqv-assembly1.cif.gz_A crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.8555 2 263
ID Description Score Start End Superfamily
af_Q60337_1_142_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8589 13 128 3.30.1330.10
2yxzD01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8539 3 131 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8487 3 133 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8369 3 133 3.30.1330.10
af_Q58089_159_335_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8343 138 264 3.90.650.10
ID Description Score Start End GO Terms
AF-A0A537W4F2-F1-model_v4 Thiamine-phosphate kinase 0.9891 61 182 GO:0009030
GO:0009228
AF-A0A7W1N599-F1-model_v4 Thiamine-phosphate kinase 0.9848 154 271 GO:0016301
AF-A0A538BVZ3-F1-model_v4 Thiamine-monophosphate kinase 0.981 2 194 GO:0009030
GO:0009228
AF-A0A7W0SZN2-F1-model_v4 Thiamine-phosphate kinase (EC 2.7.4.16) 0.9789 24 271 GO:0000287
GO:0005524
GO:0009030
GO:0009228
GO:0009229
AF-A0A7W1N599-F1-model_v4 Thiamine-phosphate kinase 0.9766 154 271 GO:0016301

Map