F391059

General Info

Members Datasets Scaffolds Average Seq Length
292 168 584 157

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0157765|Ga0436365_0157765_1636_2226
Length 196
Sequence LSDERFSHQVPTVLLTLSRSVFTILTAAGLECTVIDDLARKKFTELKERAGQRLVAGPRRVFIPDAELDEFWATLEPATIDFMIGEWQGGEFDTGHRENGTLAVINWFGKTFNSAIDAKPLVCLDADGNKYSNTENGEGSLWMEEFRGEVTATMVFDGQPVHDHFKKIDDNAVMGIMDGKDALDNGRYAYFYLERV

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
66 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
67 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
148 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 2547132424 Nocardia nova SH22a Isolate Unclassified
155 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
156 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
157 2671180195 Frankia sp. CcI49 Isolate Nodule
158 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
159 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
160 2773857922 Frankia sp. CcI49 Isolate Nodule
161 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
162 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
163 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
164 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
165 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
166 2922554459 Rhodococcus sp. 66b Isolate Unclassified
167 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
168 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 0.34
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.26
Nodule 1.03
Rhizoplane 9.93
Rhizosphere 52.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0157765 3300039437 Bacteria 3305
2 Ga0055540_1006339 3300003792 Bacteria 4717
3 Ga0055540_1009218 3300003792 Bacteria 3436
4 Ga0055540_1009840 3300003792 Bacteria 3243
5 Ga0070690_100637526 3300005330 Bacteria 812
6 Ga0070668_100000326 3300005347 Bacteria 31335
7 Ga0070671_100207157 3300005355 Bacteria 1663
8 Ga0070714_100014959 3300005435 Bacteria 6237
9 Ga0070714_100100626 3300005435 Bacteria 2546
10 Ga0070714_100669146 3300005435 Bacteria 1000
11 Ga0070701_10451231 3300005438 Bacteria 825
12 Ga0070663_100203193 3300005455 Bacteria 1547
13 Ga0070678_101575457 3300005456 Bacteria 616
14 Ga0070685_10074331 3300005466 Bacteria 2022
15 Ga0070679_101584507 3300005530 Bacteria 602
16 Ga0070684_100571292 3300005535 Bacteria 1050
17 Ga0068853_100093388 3300005539 Bacteria 2649
18 Ga0068853_100358971 3300005539 Bacteria 1357
19 Ga0068855_100127990 3300005563 Bacteria 2903
20 Ga0068866_10407699 3300005718 Bacteria 878
21 Ga0068858_100194412 3300005842 Bacteria 1917
22 Ga0081455_10063325 3300005937 Bacteria 3104
23 Ga0070717_10538538 3300006028 Bacteria 1057
24 Ga0075365_10049341 3300006038 Bacteria 2773
25 Ga0075365_10093893 3300006038 Bacteria 2047
26 Ga0075368_10254509 3300006042 Bacteria 751
27 Ga0075363_100012653 3300006048 Bacteria 4069
28 Ga0075363_100017276 3300006048 Bacteria 3575
29 Ga0075363_100097970 3300006048 Bacteria 1621
30 Ga0075363_100283193 3300006048 Bacteria 959
31 Ga0075363_100458952 3300006048 Bacteria 753
32 Ga0075363_100479262 3300006048 Bacteria 737
33 Ga0075364_10006221 3300006051 Bacteria 7002
34 Ga0075364_10007253 3300006051 Bacteria 6572
35 Ga0075364_10017630 3300006051 Bacteria 4465
36 Ga0075364_10074615 3300006051 Bacteria 2237
37 Ga0075364_10118902 3300006051 Bacteria 1768
38 Ga0075364_10242283 3300006051 Bacteria 1225
39 Ga0075364_10379856 3300006051 Bacteria 964
40 Ga0075364_10390089 3300006051 Bacteria 950
41 Ga0075364_10489498 3300006051 Bacteria 841
42 Ga0075364_10625912 3300006051 Bacteria 735
43 Ga0075367_10069810 3300006178 Bacteria 2110
44 Ga0075369_10048974 3300006186 Bacteria 1824
45 Ga0075369_10065764 3300006186 Bacteria 1589
46 Ga0075369_10209408 3300006186 Bacteria 901
47 Ga0075370_10019821 3300006353 Bacteria 3665
48 Ga0075370_10109869 3300006353 Bacteria 1601
49 Ga0075370_10131261 3300006353 Bacteria 1462
50 Ga0075370_10261457 3300006353 Bacteria 1026
51 Ga0068865_100051112 3300006881 Bacteria 2859
52 Ga0105240_10272997 3300009093 Bacteria 1946
53 Ga0111539_10617255 3300009094 Bacteria 1263
54 Ga0111539_11046057 3300009094 Bacteria 949
55 Ga0105245_12151881 3300009098 Bacteria 612
56 Ga0105243_11234718 3300009148 Bacteria 762
57 Ga0105248_10149097 3300009177 Bacteria 2639
58 Ga0105237_10018251 3300009545 Bacteria 7259
59 Ga0105237_11710286 3300009545 Bacteria 636
60 Ga0105238_10597354 3300009551 Bacteria 1111
61 Ga0105238_11057125 3300009551 Bacteria 834
62 Ga0105239_10011305 3300010375 Bacteria 9959
63 Ga0105246_10408769 3300011119 Bacteria 1129
64 Ga0157369_10303385 3300013105 Bacteria 1661
65 Ga0157369_11312227 3300013105 Bacteria 737
66 Ga0163162_10352684 3300013306 Bacteria 1604
67 Ga0157375_11476767 3300013308 Bacteria 802
68 Ga0157380_12649697 3300014326 Bacteria 568
69 Ga0213874_10080893 3300021377 Bacteria 1052
70 Ga0213876_10003618 3300021384 Bacteria 8791
71 Ga0213876_10019550 3300021384 Bacteria 3579
72 Ga0213876_10213346 3300021384 Bacteria 1026
73 Ga0213875_10080464 3300021388 Bacteria 1520
74 Ga0213875_10099815 3300021388 Bacteria 1355
75 Ga0209025_1056608 3300025294 Bacteria 1505
76 Ga0209051_1000649 3300025303 Bacteria 39520
77 Ga0209051_1002001 3300025303 Bacteria 15551
78 Ga0209051_1007020 3300025303 Bacteria 6237
79 Ga0207671_10044983 3300025914 Bacteria 3264
80 Ga0207694_11623535 3300025924 Bacteria 545
81 Ga0207664_10055734 3300025929 Bacteria 3137
82 Ga0207664_10263762 3300025929 Bacteria 1507
83 Ga0207664_10531943 3300025929 Bacteria 1054
84 Ga0207664_10657440 3300025929 Bacteria 942
85 Ga0207669_10051750 3300025937 Bacteria 2462
86 Ga0207665_10118435 3300025939 Bacteria 1868
87 Ga0207711_10036558 3300025941 Bacteria 4167
88 Ga0207667_10112074 3300025949 Bacteria 2813
89 Ga0207668_10006994 3300025972 Bacteria 6691
90 Ga0207639_10585670 3300026041 Bacteria 1027
91 Ga0207678_10508610 3300026067 Bacteria 1050
92 Ga0265760_10227499 3300031090 Bacteria 638
93 Ga0307406_10724136 3300031901 Bacteria 833
94 Ga0307415_100144488 3300032126 Bacteria 1822
95 Ga0395900_0361960 3300037418 Bacteria 1422
96 Ga0436364_0884220 3300037853 Bacteria 1473
97 Ga0436364_1134094 3300037853 Bacteria 1924
98 Ga0436365_0204440 3300039437 Bacteria 69949
99 Ga0436365_0586050 3300039437 Bacteria 6816
100 Ga0436365_1091168 3300039437 Bacteria 34943
101 Ga0436360_0034741 3300039438 Bacteria 756
102 Ga0436361_0923433 3300039447 Bacteria 584
103 Ga0436363_0123009 3300039450 Bacteria 1144
104 Ga0436363_0322251 3300039450 Bacteria 5923
105 Ga0451787_627651 3300041441 Bacteria 713
106 Ga0451793_0837139 3300041452 Bacteria 1562
107 Ga0451795_0064239 3300041456 Bacteria 2265
108 Ga0451800_0587502 3300041459 Bacteria 565
109 Ga0451802_2194342 3300041460 Bacteria 2208
110 Ga0451807_1651045 3300041486 Bacteria 1007
111 Ga0466969_0093039 3300044656 Bacteria 1427
112 Ga0466969_0283275 3300044656 Bacteria 750
113 Ga0466972_0045234 3300044658 Bacteria 2134
114 Ga0466965_0001435 3300044683 Bacteria 9625
115 Ga0466965_0005303 3300044683 Bacteria 5801
116 Ga0466966_0041718 3300044684 Bacteria 2948
117 Ga0466963_0123153 3300044694 Bacteria 1786
118 Ga0466963_0355619 3300044694 Bacteria 1032
119 Ga0466963_0475454 3300044694 Bacteria 882
120 Ga0466964_0106149 3300044706 Bacteria 1246
121 Ga0466964_0152139 3300044706 Bacteria 1074
122 Ga0466968_0015092 3300044735 Bacteria 3060
123 Ga0466970_0007164 3300044765 Bacteria 5582
124 Ga0466970_0039609 3300044765 Bacteria 2501
125 Ga0466970_0487366 3300044765 Bacteria 709
126 Ga0466957_0032925 3300044842 Bacteria 3106
127 Ga0466957_0167267 3300044842 Bacteria 1431
128 Ga0466960_0002375 3300044901 Bacteria 7081
129 Ga0466960_0035431 3300044901 Bacteria 2332
130 Ga0466959_0127753 3300045049 Bacteria 1803
131 Ga0466958_0018180 3300045836 Bacteria 4075
132 Ga0466958_0702132 3300045836 Bacteria 659
133 Ga0466967_0001186 3300045976 Bacteria 14627
134 Ga0466967_0095387 3300045976 Bacteria 2711
135 Ga0466967_0134719 3300045976 Bacteria 2296
136 Ga0466967_0140072 3300045976 Bacteria 2252
137 Ga0466967_0290552 3300045976 Bacteria 1570
138 Ga0495638_0002384 3300046460 Bacteria 15391
139 Ga0495605_0198310 3300046474 Bacteria 876
140 Ga0495583_0365903 3300046506 Bacteria 568
141 Ga0495606_0037929 3300046507 Bacteria 3267
142 Ga0495648_0003635 3300046524 Bacteria 13487
143 Ga0495665_0006812 3300046531 Bacteria 6165
144 Ga0495640_0417258 3300046533 Bacteria 823
145 Ga0495668_0060549 3300046616 Bacteria 2088
146 Ga0495625_0379080 3300046660 Bacteria 888
147 Ga0495581_0141333 3300047315 Bacteria 1404
148 Ga0495672_0026405 3300047320 Bacteria 3705
149 Ga0495673_0001541 3300047469 Bacteria 18121
150 Ga0495686_0004128 3300047472 Bacteria 12089
151 Ga0496100_0000948 3300048903 Bacteria 13885
152 Ga0496101_0000050 3300048904 Bacteria 144545
153 Ga0496101_0022337 3300048904 Bacteria 4354
154 Ga0496101_0158146 3300048904 Bacteria 1737
155 Ga0496102_0000001 3300048905 Bacteria 873433
156 Ga0496102_0142131 3300048905 Bacteria 2251
157 Ga0496103_0000007 3300048906 Bacteria 354915
158 Ga0496104_0037944 3300048907 Bacteria 4506
159 Ga0496105_0016974 3300048908 Bacteria 5825
160 Ga0496106_0039796 3300048909 Bacteria 3521
161 Ga0496106_0053303 3300048909 Bacteria 3054
162 Ga0496107_0030935 3300048910 Bacteria 3817
163 Ga0496107_0182917 3300048910 Bacteria 1556
164 Ga0496108_0000017 3300048911 Bacteria 235428
165 Ga0496108_0129107 3300048911 Bacteria 2172
166 Ga0496108_0581609 3300048911 Bacteria 976
167 Ga0496108_0706904 3300048911 Bacteria 874
168 Ga0496109_1042107 3300048912 Bacteria 755
169 Ga0496110_0615122 3300048913 Bacteria 985
170 Ga0496112_0039134 3300048915 Bacteria 4632
171 Ga0496112_0325390 3300048915 Bacteria 1481
172 Ga0496114_0023495 3300048917 Bacteria 5031
173 Ga0496115_0930545 3300048918 Bacteria 668
174 Ga0496116_0000018 3300048919 Bacteria 545877
175 Ga0496117_0000015 3300048920 Bacteria 583316
176 Ga0496117_0131626 3300048920 Bacteria 1515
177 Ga0496118_0000012 3300048921 Bacteria 583316
178 Ga0496119_0000172 3300048922 Bacteria 91464
179 Ga0496119_0050516 3300048922 Bacteria 2563
180 Ga0496120_0001650 3300048923 Bacteria 25816
181 Ga0496120_0034599 3300048923 Bacteria 3025
182 Ga0496120_0218440 3300048923 Bacteria 912
183 Ga0496121_0008042 3300048924 Bacteria 12572
184 Ga0496121_0169816 3300048924 Bacteria 1586
185 Ga0496123_0020791 3300048926 Bacteria 5122
186 Ga0496124_0608945 3300048927 Bacteria 709
187 Ga0496125_0059316 3300048928 Bacteria 3084
188 Ga0496125_0196732 3300048928 Bacteria 1325
189 Ga0496126_0000920 3300048929 Bacteria 50943
190 Ga0496126_0005459 3300048929 Bacteria 14506
191 Ga0496126_0113194 3300048929 Bacteria 2362
192 Ga0496126_0472039 3300048929 Bacteria 1007
193 Ga0501031_0471932 3300049568 Bacteria 810
194 Ga0501032_0000434 3300049569 Bacteria 34423
195 Ga0501032_0004932 3300049569 Bacteria 9982
196 Ga0501032_0008559 3300049569 Bacteria 7463
197 Ga0501033_0022693 3300049570 Bacteria 4733
198 Ga0501033_0122097 3300049570 Bacteria 1890
199 Ga0501034_0006590 3300049571 Bacteria 12458
200 Ga0501034_0011556 3300049571 Bacteria 9145
201 Ga0501034_0021644 3300049571 Bacteria 6549
202 Ga0501036_0024407 3300049572 Bacteria 5097
203 Ga0501036_0060996 3300049572 Bacteria 3194
204 Ga0501037_0001618 3300049573 Bacteria 16352
205 Ga0501037_0001660 3300049573 Bacteria 16195
206 Ga0501037_0059392 3300049573 Bacteria 2790
207 Ga0501037_0121656 3300049573 Bacteria 1876
208 Ga0501037_0157040 3300049573 Bacteria 1623
209 Ga0501038_0000030 3300049574 Bacteria 132455
210 Ga0501038_0004505 3300049574 Bacteria 12958
211 Ga0501038_0125838 3300049574 Bacteria 2109
212 Ga0501038_0523825 3300049574 Bacteria 904
213 Ga0501039_0000128 3300049575 Bacteria 52738
214 Ga0501039_0000446 3300049575 Bacteria 29976
215 Ga0501043_0002260 3300049579 Bacteria 16385
216 Ga0501043_0005725 3300049579 Bacteria 10010
217 Ga0501043_0081017 3300049579 Bacteria 2550
218 Ga0501043_0155882 3300049579 Bacteria 1786
219 Ga0501046_0000628 3300049580 Bacteria 34641
220 Ga0501047_0016043 3300049581 Bacteria 7143
221 Ga0501047_0140748 3300049581 Bacteria 2291
222 Ga0501048_0115580 3300049582 Bacteria 1895
223 Ga0501067_0121934 3300049583 Bacteria 1451
224 Ga0501067_0343651 3300049583 Bacteria 831
225 Ga0501070_0000369 3300049586 Bacteria 40971
226 Ga0501070_0001838 3300049586 Bacteria 18711
227 Ga0501070_0003981 3300049586 Bacteria 12709
228 Ga0501070_0104642 3300049586 Bacteria 2340
229 Ga0501070_0218013 3300049586 Bacteria 1565
230 Ga0501070_0310632 3300049586 Bacteria 1283
231 Ga0501072_0527947 3300049588 Bacteria 933
232 Ga0501073_0025112 3300049589 Bacteria 4277
233 Ga0501073_0045602 3300049589 Bacteria 3087
234 Ga0501073_0125478 3300049589 Bacteria 1779
235 Ga0501080_0067245 3300049742 Bacteria 3333
236 Ga0501035_0000229 3300049822 Bacteria 66514
237 Ga0501035_0067848 3300049822 Bacteria 3163
238 Ga0501035_0267704 3300049822 Bacteria 1447
239 Ga0501044_0004868 3300049823 Bacteria 15011
240 Ga0501044_0049186 3300049823 Bacteria 4353
241 Ga0501044_0071251 3300049823 Bacteria 3534
242 Ga0501044_0445655 3300049823 Bacteria 1202
243 nmdc:mga03n38_102094_c1 3300050490 Bacteria 1384
244 nmdc:mga03n38_10978_c1 3300050490 Bacteria 3358
245 nmdc:mga03n38_2176_c1 3300050490 Bacteria 5974
246 nmdc:mga03n38_30306_c1 3300050490 Bacteria 2273
247 nmdc:mga03n38_359498_c1 3300050490 Bacteria 794
248 nmdc:mga03n38_403099_c1 3300050490 Bacteria 753
249 nmdc:mga03n38_547693_c1 3300050490 Bacteria 654
250 nmdc:mga03n38_75253_c1 3300050490 Bacteria 1572
251 nmdc:mga00v17_123877_c1 3300050491 Bacteria 1648
252 nmdc:mga00v17_150317_c1 3300050491 Bacteria 1496
253 nmdc:mga00v17_3095_c1 3300050491 Bacteria 8554
254 nmdc:mga00v17_33464_c1 3300050491 Bacteria 3045
255 nmdc:mga00v17_4044_c1 3300050491 Bacteria 7582
256 nmdc:mga00v17_96631_c1 3300050491 Bacteria 1861
257 nmdc:mga0yw44_133115_c1 3300050492 Bacteria 1611
258 nmdc:mga0yw44_74768_c1 3300050492 Bacteria 2111
259 nmdc:mga06z11_45748_c2 3300050494 Bacteria 1628
260 nmdc:mga06z11_57437_c1 3300050494 Bacteria 2016
261 nmdc:mga07m45_208196_c1 3300050496 Bacteria 1138
262 nmdc:mga07m45_317409_c1 3300050496 Bacteria 906
263 nmdc:mga07m45_350657_c1 3300050496 Bacteria 857
264 nmdc:mga07m45_72457_c1 3300050496 Bacteria 1961
265 nmdc:mga08y16_704925_c1 3300050511 Bacteria 1009
266 nmdc:mga0sz30_111726_c1 3300050516 Bacteria 1198
267 nmdc:mga0sz30_237924_c1 3300050516 Bacteria 810
268 Ga0500610_0002139 3300053079 Bacteria 7133
269 Ga0500578_0175699 3300053086 Bacteria 1322
270 Ga0500643_003856 3300053087 Bacteria 6979
271 Ga0500556_0128105 3300053104 Bacteria 993
272 Ga0500562_008287 3300053108 Bacteria 2625
273 Ga0500642_0181835 3300053130 Bacteria 983
274 Ga0500604_0189015 3300053151 Bacteria 707
275 Ga0501084_0803922 3300054114 Bacteria 792
276 Ga0466962_0033766 3300061719 Bacteria 2449
277 Ga0466962_0328630 3300061719 Bacteria 759
278 2548696905 2547132424 Bacteria 8348532
279 2566995849 2565956761 Bacteria 6601618
280 2644488369 2643221687 Bacteria 6500351
281 2671838874 2671180195 Bacteria 9757215
282 2738888651 2738541308 Bacteria 7020677
283 2744953549 2744054611 Bacteria 5611514
284 2774857030 2773857922 Bacteria 9757215
285 2842136200 2842134933 Bacteria 5847019
286 2902795299 2902792274 Bacteria 7270173
287 2902842886 2902837492 Bacteria 6697721
288 2904537642 2904535858 Bacteria 6308016
289 2919719648 2919713450 Bacteria 7431245
290 2922558713 2922554459 Bacteria 6683962
291 2929218398 2929212328 Bacteria 7708288
292 2939583603 2939582691 Bacteria 7088898
293 Ga0436365_0157765
294 Ga0055540_1006339
295 Ga0055540_1009218
296 Ga0055540_1009840
297 Ga0070690_100637526
298 Ga0070668_100000326
299 Ga0070671_100207157
300 Ga0070714_100014959
301 Ga0070714_100100626
302 Ga0070714_100669146
303 Ga0070701_10451231
304 Ga0070663_100203193
305 Ga0070678_101575457
306 Ga0070685_10074331
307 Ga0070679_101584507
308 Ga0070684_100571292
309 Ga0068853_100093388
310 Ga0068853_100358971
311 Ga0068855_100127990
312 Ga0068866_10407699
313 Ga0068858_100194412
314 Ga0081455_10063325
315 Ga0070717_10538538
316 Ga0075365_10049341
317 Ga0075365_10093893
318 Ga0075368_10254509
319 Ga0075363_100012653
320 Ga0075363_100017276
321 Ga0075363_100097970
322 Ga0075363_100283193
323 Ga0075363_100458952
324 Ga0075363_100479262
325 Ga0075364_10006221
326 Ga0075364_10007253
327 Ga0075364_10017630
328 Ga0075364_10074615
329 Ga0075364_10118902
330 Ga0075364_10242283
331 Ga0075364_10379856
332 Ga0075364_10390089
333 Ga0075364_10489498
334 Ga0075364_10625912
335 Ga0075367_10069810
336 Ga0075369_10048974
337 Ga0075369_10065764
338 Ga0075369_10209408
339 Ga0075370_10019821
340 Ga0075370_10109869
341 Ga0075370_10131261
342 Ga0075370_10261457
343 Ga0068865_100051112
344 Ga0105240_10272997
345 Ga0111539_10617255
346 Ga0111539_11046057
347 Ga0105245_12151881
348 Ga0105243_11234718
349 Ga0105248_10149097
350 Ga0105237_10018251
351 Ga0105237_11710286
352 Ga0105238_10597354
353 Ga0105238_11057125
354 Ga0105239_10011305
355 Ga0105246_10408769
356 Ga0157369_10303385
357 Ga0157369_11312227
358 Ga0163162_10352684
359 Ga0157375_11476767
360 Ga0157380_12649697
361 Ga0213874_10080893
362 Ga0213876_10003618
363 Ga0213876_10019550
364 Ga0213876_10213346
365 Ga0213875_10080464
366 Ga0213875_10099815
367 Ga0209025_1056608
368 Ga0209051_1000649
369 Ga0209051_1002001
370 Ga0209051_1007020
371 Ga0207671_10044983
372 Ga0207694_11623535
373 Ga0207664_10055734
374 Ga0207664_10263762
375 Ga0207664_10531943
376 Ga0207664_10657440
377 Ga0207669_10051750
378 Ga0207665_10118435
379 Ga0207711_10036558
380 Ga0207667_10112074
381 Ga0207668_10006994
382 Ga0207639_10585670
383 Ga0207678_10508610
384 Ga0265760_10227499
385 Ga0307406_10724136
386 Ga0307415_100144488
387 Ga0395900_0361960
388 Ga0436364_0884220
389 Ga0436364_1134094
390 Ga0436365_0204440
391 Ga0436365_0586050
392 Ga0436365_1091168
393 Ga0436360_0034741
394 Ga0436361_0923433
395 Ga0436363_0123009
396 Ga0436363_0322251
397 Ga0451787_627651
398 Ga0451793_0837139
399 Ga0451795_0064239
400 Ga0451800_0587502
401 Ga0451802_2194342
402 Ga0451807_1651045
403 Ga0466969_0093039
404 Ga0466969_0283275
405 Ga0466972_0045234
406 Ga0466965_0001435
407 Ga0466965_0005303
408 Ga0466966_0041718
409 Ga0466963_0123153
410 Ga0466963_0355619
411 Ga0466963_0475454
412 Ga0466964_0106149
413 Ga0466964_0152139
414 Ga0466968_0015092
415 Ga0466970_0007164
416 Ga0466970_0039609
417 Ga0466970_0487366
418 Ga0466957_0032925
419 Ga0466957_0167267
420 Ga0466960_0002375
421 Ga0466960_0035431
422 Ga0466959_0127753
423 Ga0466958_0018180
424 Ga0466958_0702132
425 Ga0466967_0001186
426 Ga0466967_0095387
427 Ga0466967_0134719
428 Ga0466967_0140072
429 Ga0466967_0290552
430 Ga0495638_0002384
431 Ga0495605_0198310
432 Ga0495583_0365903
433 Ga0495606_0037929
434 Ga0495648_0003635
435 Ga0495665_0006812
436 Ga0495640_0417258
437 Ga0495668_0060549
438 Ga0495625_0379080
439 Ga0495581_0141333
440 Ga0495672_0026405
441 Ga0495673_0001541
442 Ga0495686_0004128
443 Ga0496100_0000948
444 Ga0496101_0000050
445 Ga0496101_0022337
446 Ga0496101_0158146
447 Ga0496102_0000001
448 Ga0496102_0142131
449 Ga0496103_0000007
450 Ga0496104_0037944
451 Ga0496105_0016974
452 Ga0496106_0039796
453 Ga0496106_0053303
454 Ga0496107_0030935
455 Ga0496107_0182917
456 Ga0496108_0000017
457 Ga0496108_0129107
458 Ga0496108_0581609
459 Ga0496108_0706904
460 Ga0496109_1042107
461 Ga0496110_0615122
462 Ga0496112_0039134
463 Ga0496112_0325390
464 Ga0496114_0023495
465 Ga0496115_0930545
466 Ga0496116_0000018
467 Ga0496117_0000015
468 Ga0496117_0131626
469 Ga0496118_0000012
470 Ga0496119_0000172
471 Ga0496119_0050516
472 Ga0496120_0001650
473 Ga0496120_0034599
474 Ga0496120_0218440
475 Ga0496121_0008042
476 Ga0496121_0169816
477 Ga0496123_0020791
478 Ga0496124_0608945
479 Ga0496125_0059316
480 Ga0496125_0196732
481 Ga0496126_0000920
482 Ga0496126_0005459
483 Ga0496126_0113194
484 Ga0496126_0472039
485 Ga0501031_0471932
486 Ga0501032_0000434
487 Ga0501032_0004932
488 Ga0501032_0008559
489 Ga0501033_0022693
490 Ga0501033_0122097
491 Ga0501034_0006590
492 Ga0501034_0011556
493 Ga0501034_0021644
494 Ga0501036_0024407
495 Ga0501036_0060996
496 Ga0501037_0001618
497 Ga0501037_0001660
498 Ga0501037_0059392
499 Ga0501037_0121656
500 Ga0501037_0157040
501 Ga0501038_0000030
502 Ga0501038_0004505
503 Ga0501038_0125838
504 Ga0501038_0523825
505 Ga0501039_0000128
506 Ga0501039_0000446
507 Ga0501043_0002260
508 Ga0501043_0005725
509 Ga0501043_0081017
510 Ga0501043_0155882
511 Ga0501046_0000628
512 Ga0501047_0016043
513 Ga0501047_0140748
514 Ga0501048_0115580
515 Ga0501067_0121934
516 Ga0501067_0343651
517 Ga0501070_0000369
518 Ga0501070_0001838
519 Ga0501070_0003981
520 Ga0501070_0104642
521 Ga0501070_0218013
522 Ga0501070_0310632
523 Ga0501072_0527947
524 Ga0501073_0025112
525 Ga0501073_0045602
526 Ga0501073_0125478
527 Ga0501080_0067245
528 Ga0501035_0000229
529 Ga0501035_0067848
530 Ga0501035_0267704
531 Ga0501044_0004868
532 Ga0501044_0049186
533 Ga0501044_0071251
534 Ga0501044_0445655
535 nmdc:mga03n38_102094_c1
536 nmdc:mga03n38_10978_c1
537 nmdc:mga03n38_2176_c1
538 nmdc:mga03n38_30306_c1
539 nmdc:mga03n38_359498_c1
540 nmdc:mga03n38_403099_c1
541 nmdc:mga03n38_547693_c1
542 nmdc:mga03n38_75253_c1
543 nmdc:mga00v17_123877_c1
544 nmdc:mga00v17_150317_c1
545 nmdc:mga00v17_3095_c1
546 nmdc:mga00v17_33464_c1
547 nmdc:mga00v17_4044_c1
548 nmdc:mga00v17_96631_c1
549 nmdc:mga0yw44_133115_c1
550 nmdc:mga0yw44_74768_c1
551 nmdc:mga06z11_45748_c2
552 nmdc:mga06z11_57437_c1
553 nmdc:mga07m45_208196_c1
554 nmdc:mga07m45_317409_c1
555 nmdc:mga07m45_350657_c1
556 nmdc:mga07m45_72457_c1
557 nmdc:mga08y16_704925_c1
558 nmdc:mga0sz30_111726_c1
559 nmdc:mga0sz30_237924_c1
560 Ga0500610_0002139
561 Ga0500578_0175699
562 Ga0500643_003856
563 Ga0500556_0128105
564 Ga0500562_008287
565 Ga0500642_0181835
566 Ga0500604_0189015
567 Ga0501084_0803922
568 Ga0466962_0033766
569 Ga0466962_0328630
570 2548696905
571 2566995849
572 2644488369
573 2671838874
574 2738888651
575 2744953549
576 2774857030
577 2842136200
578 2902795299
579 2902842886
580 2904537642
581 2919719648
582 2922558713
583 2929218398
584 2939583603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14231

GXWXG

GXWXG protein

70

128

0.98

PF14232

DUF4334

Domain of unknown function (DUF4334)

137

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mve-assembly2.cif.gz_B crystal structure of tcur_1030 protein from thermomonospora curvata 0.8902 2 155
4mve-assembly2.cif.gz_B crystal structure of tcur_1030 protein from thermomonospora curvata 0.8788 2 155
3tf8-assembly1.cif.gz_A crystal structure of an h-nox protein from nostoc sp. pcc 7120 0.6596 112 153
1qwx-assembly2.cif.gz_B crystal structure of a staphylococcal inhibitor/chaperone 0.6392 107 155
1nyc-assembly2.cif.gz_B staphostatins resemble lipocalins, not cystatins in fold. 0.6107 107 155
ID Description Score Start End Superfamily
4mveB00 Mainly Beta;Beta Barrel;Lipocalin;GXWXG domain 0.8854 4 155 2.40.128.580
4mveB00 Mainly Beta;Beta Barrel;Lipocalin;GXWXG domain 0.8677 4 155 2.40.128.580
1nycB00 Mainly Beta;Beta Barrel;Staphostatins;beta-Barrel protease inhibitors 0.6107 107 155 2.40.310.10
af_Q8I328_29_387_3.60.21.70 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Alkaline phosphatase D (PhoD) 0.5803 116 153 3.60.21.70
af_Q4TTB0_48_317_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5789 95 155 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A2S8MMJ3-F1-model_v4 deleted 0.985 38 155
AF-A0A2T2ZRJ7-F1-model_v4 DUF4334 domain-containing protein 0.9822 20 155
AF-A0A6G3V2L2-F1-model_v4 deleted 0.9807 52 134
AF-X7ZKS4-F1-model_v4 Putative phenylalanine aminotransferase domain protein 0.9784 4 155 GO:0008483
GO:0009058
GO:0030170
AF-A0A2S8MMJ3-F1-model_v4 deleted 0.9768 38 155

Map