F391055

General Info

Members Datasets Scaffolds Average Seq Length
292 131 584 229

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0332507|Ga0395905_0332507_288_1052
Length 254
Sequence LGAIWIALNELARGTIMTRALVAALAISVAALPTVAQGQQASITQSIAGTRLDINATGEVTRVPDVAIISAGVVSRSATASAALQDSAARMQKVLAALRRAGVEDRDIQTSNVALNPEYRYPANQAPELVGYTASNTVTVRFRDLRASGAILDALVAQGANQINGPNLVVDKPEAALDEARARAVAIGRARAELYARSLGMRVARIVAVSEASSYGNQPVPMVMSAARMEAAQTKIEPGEQKLQVSLSITFELQ

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.71
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0332507 3300037471 Bacteria 1410
2 JGI24741J21665_1002828 3300001915 Bacteria 4369
3 JGI24740J21852_10000920 3300001979 Bacteria 13080
4 JGI24739J22299_10003393 3300001989 Bacteria 6078
5 JGI24735J21928_10009063 3300002067 Bacteria 3204
6 rootH1_10134058 3300003323 Bacteria 1098
7 Ga0070658_10008087 3300005327 Bacteria 8460
8 Ga0070658_10049504 3300005327 Bacteria 3404
9 Ga0070658_10302791 3300005327 Bacteria 1363
10 Ga0070658_10308766 3300005327 Unclassified 1349
11 Ga0070676_10176739 3300005328 Unclassified 1385
12 Ga0070683_100007342 3300005329 Bacteria 9310
13 Ga0070670_100003539 3300005331 Bacteria 12988
14 Ga0070666_10033816 3300005335 Bacteria 3386
15 Ga0070680_100059704 3300005336 Bacteria 3121
16 Ga0070680_100086943 3300005336 Bacteria 2585
17 Ga0070682_100006141 3300005337 Bacteria 6730
18 Ga0070660_100002159 3300005339 Bacteria 13554
19 Ga0070660_100009375 3300005339 Bacteria 6880
20 Ga0070660_100010910 3300005339 Bacteria 6432
21 Ga0070660_100011547 3300005339 Bacteria 6285
22 Ga0070660_100032743 3300005339 Bacteria 3914
23 Ga0070660_100143229 3300005339 Bacteria 1919
24 Ga0070661_100019297 3300005344 Bacteria 4860
25 Ga0070661_100057014 3300005344 Bacteria 2863
26 Ga0070661_100064840 3300005344 Bacteria 2684
27 Ga0070661_100166003 3300005344 Bacteria 1675
28 Ga0070661_100316991 3300005344 Bacteria 1217
29 Ga0070661_100382984 3300005344 Bacteria 1109
30 Ga0070675_100007959 3300005354 Bacteria 8215
31 Ga0070671_100001632 3300005355 Bacteria 16922
32 Ga0070673_100002443 3300005364 Bacteria 11325
33 Ga0070659_100006077 3300005366 Bacteria 8708
34 Ga0070659_100059735 3300005366 Bacteria 3010
35 Ga0070659_100137612 3300005366 Bacteria 1986
36 Ga0070667_100007567 3300005367 Bacteria 9012
37 Ga0070667_100364417 3300005367 Bacteria 1310
38 Ga0070709_10038899 3300005434 Bacteria 2915
39 Ga0070714_100076920 3300005435 Bacteria 2898
40 Ga0070713_100080201 3300005436 Bacteria 2782
41 Ga0070663_100008049 3300005455 Bacteria 6464
42 Ga0070663_100084328 3300005455 Bacteria 2342
43 Ga0070663_100112152 3300005455 Bacteria 2050
44 Ga0070663_100406853 3300005455 Bacteria 1113
45 Ga0070678_100324087 3300005456 Bacteria 1316
46 Ga0070662_100014353 3300005457 Bacteria 5291
47 Ga0070662_100036471 3300005457 Bacteria 3479
48 Ga0070662_100042331 3300005457 Bacteria 3253
49 Ga0070662_100108242 3300005457 Bacteria 2114
50 Ga0070662_100141113 3300005457 Bacteria 1867
51 Ga0070662_100174396 3300005457 Bacteria 1691
52 Ga0070662_100214528 3300005457 Bacteria 1533
53 Ga0068867_100421844 3300005459 Bacteria 1130
54 Ga0070679_100005864 3300005530 Bacteria 11405
55 Ga0070679_100330408 3300005530 Bacteria 1473
56 Ga0070684_100010053 3300005535 Bacteria 7479
57 Ga0070684_100018104 3300005535 Bacteria 5794
58 Ga0068853_100300986 3300005539 Bacteria 1482
59 Ga0068853_100529560 3300005539 Bacteria 1115
60 Ga0070672_100076663 3300005543 Bacteria 2671
61 Ga0070672_100217929 3300005543 Bacteria 1600
62 Ga0070672_100392844 3300005543 Unclassified 1188
63 Ga0070696_100194650 3300005546 Bacteria 1510
64 Ga0070693_100013687 3300005547 Bacteria 4139
65 Ga0070665_100004250 3300005548 Bacteria 15068
66 Ga0070665_100012382 3300005548 Bacteria 8596
67 Ga0070665_100833809 3300005548 Bacteria 935
68 Ga0068855_100074910 3300005563 Bacteria 3930
69 Ga0068855_100349114 3300005563 Bacteria 1630
70 Ga0068855_100926824 3300005563 Unclassified 919
71 Ga0070664_100002761 3300005564 Bacteria 14168
72 Ga0070664_100100720 3300005564 Bacteria 2512
73 Ga0070664_100150561 3300005564 Bacteria 2054
74 Ga0068854_100030782 3300005578 Bacteria 3725
75 Ga0068854_100128876 3300005578 Bacteria 1930
76 Ga0068856_100166583 3300005614 Bacteria 2215
77 Ga0068856_100349569 3300005614 Bacteria 1497
78 Ga0068856_100381023 3300005614 Bacteria 1430
79 Ga0068852_100307187 3300005616 Bacteria 1537
80 Ga0068852_100355139 3300005616 Bacteria 1432
81 Ga0068864_100474675 3300005618 Unclassified 1200
82 Ga0068858_100266563 3300005842 Bacteria 1629
83 Ga0070716_100026975 3300006173 Bacteria 3080
84 Ga0105248_10033216 3300009177 Bacteria 5763
85 Ga0105248_10167924 3300009177 Bacteria 2473
86 Ga0105248_10217399 3300009177 Bacteria 2152
87 Ga0157373_10035527 3300013100 Bacteria 3578
88 Ga0157371_10076868 3300013102 Bacteria 2364
89 Ga0157371_10093207 3300013102 Bacteria 2134
90 Ga0157371_10362502 3300013102 Bacteria 1056
91 Ga0157370_10026030 3300013104 Bacteria 5782
92 Ga0157370_10092916 3300013104 Bacteria 2831
93 Ga0157370_10201321 3300013104 Bacteria 1847
94 Ga0157370_10533241 3300013104 Unclassified 1077
95 Ga0157369_10001885 3300013105 Bacteria 25291
96 Ga0157369_10007345 3300013105 Bacteria 12686
97 Ga0157369_10209018 3300013105 Bacteria 2046
98 Ga0157374_10095936 3300013296 Bacteria 2836
99 Ga0157374_10184434 3300013296 Bacteria 2040
100 Ga0163162_10109962 3300013306 Bacteria 2853
101 Ga0157372_10253358 3300013307 Bacteria 2044
102 Ga0157372_10327580 3300013307 Bacteria 1783
103 Ga0157375_10015555 3300013308 Bacteria 6814
104 Ga0157376_10112370 3300014969 Bacteria 2400
105 Ga0207697_10019452 3300025315 Bacteria 2782
106 Ga0207688_10017136 3300025901 Bacteria 3937
107 Ga0207647_10010490 3300025904 Bacteria 6543
108 Ga0207645_10173278 3300025907 Bacteria 1415
109 Ga0207705_10003644 3300025909 Bacteria 11732
110 Ga0207705_10008779 3300025909 Bacteria 7367
111 Ga0207705_10010100 3300025909 Bacteria 6872
112 Ga0207705_10029212 3300025909 Bacteria 3930
113 Ga0207705_10170246 3300025909 Bacteria 1640
114 Ga0207705_10170941 3300025909 Bacteria 1636
115 Ga0207707_10002081 3300025912 Bacteria 18111
116 Ga0207707_10137104 3300025912 Bacteria 2139
117 Ga0207693_10009507 3300025915 Bacteria 7920
118 Ga0207660_10007004 3300025917 Bacteria 7301
119 Ga0207660_10017887 3300025917 Bacteria 4718
120 Ga0207657_10001566 3300025919 Bacteria 24548
121 Ga0207657_10015685 3300025919 Bacteria 7330
122 Ga0207657_10031505 3300025919 Bacteria 4802
123 Ga0207657_10049957 3300025919 Bacteria 3641
124 Ga0207657_10134721 3300025919 Bacteria 2022
125 Ga0207649_10014979 3300025920 Bacteria 4353
126 Ga0207649_10028520 3300025920 Bacteria 3287
127 Ga0207649_10029041 3300025920 Bacteria 3263
128 Ga0207649_10037152 3300025920 Bacteria 2940
129 Ga0207649_10133910 3300025920 Bacteria 1687
130 Ga0207652_10011284 3300025921 Bacteria 7197
131 Ga0207652_10048566 3300025921 Bacteria 3628
132 Ga0207650_10546874 3300025925 Bacteria 970
133 Ga0207659_10005317 3300025926 Bacteria 7803
134 Ga0207700_10028753 3300025928 Bacteria 3914
135 Ga0207664_10095812 3300025929 Bacteria 2442
136 Ga0207644_10001980 3300025931 Bacteria 13250
137 Ga0207644_10296110 3300025931 Unclassified 1303
138 Ga0207690_10002372 3300025932 Bacteria 11415
139 Ga0207690_10038969 3300025932 Bacteria 3097
140 Ga0207690_10145509 3300025932 Bacteria 1752
141 Ga0207706_10003399 3300025933 Bacteria 15203
142 Ga0207706_10008560 3300025933 Bacteria 9430
143 Ga0207706_10022308 3300025933 Bacteria 5680
144 Ga0207706_10130390 3300025933 Bacteria 2211
145 Ga0207706_10163598 3300025933 Bacteria 1956
146 Ga0207706_10166191 3300025933 Bacteria 1939
147 Ga0207706_10366026 3300025933 Unclassified 1252
148 Ga0207669_10008581 3300025937 Bacteria 4807
149 Ga0207665_10010820 3300025939 Bacteria 5988
150 Ga0207691_10006392 3300025940 Bacteria 11381
151 Ga0207691_10312480 3300025940 Bacteria 1348
152 Ga0207691_10376190 3300025940 Unclassified 1213
153 Ga0207711_10019137 3300025941 Bacteria 5699
154 Ga0207711_10255476 3300025941 Bacteria 1610
155 Ga0207661_10039476 3300025944 Bacteria 3705
156 Ga0207679_10017661 3300025945 Bacteria 4763
157 Ga0207679_10039603 3300025945 Bacteria 3367
158 Ga0207679_10136922 3300025945 Bacteria 1973
159 Ga0207679_10237936 3300025945 Bacteria 1541
160 Ga0207667_10159532 3300025949 Bacteria 2320
161 Ga0207651_10000667 3300025960 Bacteria 14642
162 Ga0207651_10154584 3300025960 Bacteria 1790
163 Ga0207651_10235993 3300025960 Bacteria 1488
164 Ga0207640_10015025 3300025981 Bacteria 4472
165 Ga0207658_10187510 3300025986 Bacteria 1716
166 Ga0207639_10176796 3300026041 Bacteria 1812
167 Ga0207639_10263984 3300026041 Bacteria 1507
168 Ga0207639_10782122 3300026041 Unclassified 889
169 Ga0207678_10002521 3300026067 Bacteria 16679
170 Ga0207678_10009359 3300026067 Bacteria 8623
171 Ga0207678_10020481 3300026067 Bacteria 5799
172 Ga0207678_10020731 3300026067 Bacteria 5762
173 Ga0207648_10281465 3300026089 Bacteria 1487
174 Ga0207674_10020470 3300026116 Bacteria 7147
175 Ga0207683_10002201 3300026121 Bacteria 17133
176 Ga0207698_10081649 3300026142 Bacteria 2610
177 Ga0207698_10632789 3300026142 Unclassified 1058
178 Ga0268266_10009097 3300028379 Bacteria 8771
179 Ga0268266_10021455 3300028379 Bacteria 5502
180 Ga0307408_100119771 3300031548 Bacteria 2037
181 Ga0307408_100727884 3300031548 Bacteria 894
182 Ga0307405_10083944 3300031731 Bacteria 2089
183 Ga0307413_10147171 3300031824 Bacteria 1636
184 Ga0307413_10321893 3300031824 Bacteria 1181
185 Ga0307410_10191509 3300031852 Bacteria 1555
186 Ga0307410_10222607 3300031852 Bacteria 1452
187 Ga0307410_10229150 3300031852 Bacteria 1433
188 Ga0307406_10041985 3300031901 Bacteria 2853
189 Ga0307407_10009979 3300031903 Bacteria 4452
190 Ga0307407_10108141 3300031903 Bacteria 1740
191 Ga0307407_10112478 3300031903 Bacteria 1711
192 Ga0307412_10152604 3300031911 Bacteria 1706
193 Ga0307412_10185837 3300031911 Bacteria 1567
194 Ga0307412_10738663 3300031911 Bacteria 848
195 Ga0307409_100054957 3300031995 Bacteria 3070
196 Ga0307409_100600569 3300031995 Bacteria 1088
197 Ga0307416_100096991 3300032002 Bacteria 2551
198 Ga0307416_100405000 3300032002 Bacteria 1403
199 Ga0307414_10088622 3300032004 Bacteria 2290
200 Ga0307414_10125267 3300032004 Bacteria 1983
201 Ga0307411_10084775 3300032005 Bacteria 2192
202 Ga0307415_100080629 3300032126 Bacteria 2322
203 Ga0307415_100086068 3300032126 Bacteria 2260
204 Ga0307415_100400848 3300032126 Bacteria 1171
205 Ga0373923_0006424 3300035111 Bacteria 4064
206 Ga0373954_0011077 3300035118 Bacteria 3990
207 Ga0373957_0058508 3300035120 Bacteria 1489
208 Ga0373943_0013933 3300035170 Bacteria 3636
209 Ga0373955_0048506 3300035172 Bacteria 2303
210 Ga0373935_0165846 3300035692 Bacteria 1508
211 Ga0373933_0144844 3300035724 Bacteria 1502
212 Ga0395899_0000140 3300037312 Bacteria 109989
213 Ga0395899_0003919 3300037312 Bacteria 11735
214 Ga0395899_0006082 3300037312 Bacteria 9362
215 Ga0395899_0025428 3300037312 Bacteria 4470
216 Ga0395899_0034743 3300037312 Bacteria 3786
217 Ga0395899_0178827 3300037312 Bacteria 1490
218 Ga0395899_0259052 3300037312 Bacteria 1190
219 Ga0395900_0000075 3300037418 Bacteria 183525
220 Ga0395900_0005245 3300037418 Bacteria 13598
221 Ga0395900_0027489 3300037418 Bacteria 5828
222 Ga0395900_0125124 3300037418 Bacteria 2636
223 Ga0395900_0146919 3300037418 Bacteria 2410
224 Ga0395900_0350991 3300037418 Bacteria 1448
225 Ga0395900_0370746 3300037418 Bacteria 1401
226 Ga0395900_0428414 3300037418 Bacteria 1282
227 Ga0395898_0000055 3300037466 Bacteria 278557
228 Ga0395898_0004667 3300037466 Bacteria 14931
229 Ga0395898_0042404 3300037466 Bacteria 4489
230 Ga0395898_0219985 3300037466 Bacteria 1811
231 Ga0395898_0946359 3300037466 Bacteria 798
232 Ga0395905_0000089 3300037471 Bacteria 152196
233 Ga0395905_0003012 3300037471 Bacteria 18251
234 Ga0395905_0009007 3300037471 Bacteria 9795
235 Ga0395905_0026842 3300037471 Bacteria 5431
236 Ga0395905_0067192 3300037471 Bacteria 3358
237 Ga0395905_0098037 3300037471 Bacteria 2752
238 Ga0395905_0170955 3300037471 Bacteria 2041
239 Ga0395905_0336447 3300037471 Bacteria 1400
240 Ga0395905_0488086 3300037471 Bacteria 1131
241 Ga0395905_0758076 3300037471 Unclassified 873
242 Ga0395905_0777282 3300037471 Bacteria 860
243 Ga0395901_0000418 3300038443 Bacteria 50129
244 Ga0395901_0000874 3300038443 Bacteria 33249
245 Ga0395901_0006456 3300038443 Bacteria 11883
246 Ga0395901_0007257 3300038443 Bacteria 11183
247 Ga0395901_0056843 3300038443 Bacteria 4070
248 Ga0395901_0174228 3300038443 Bacteria 2256
249 Ga0395901_0328222 3300038443 Bacteria 1582
250 Ga0395901_0661429 3300038443 Bacteria 1047
251 Ga0450892_007581 3300042130 Bacteria 918
252 Ga0466969_0023366 3300044656 Bacteria 3187
253 Ga0466972_0029969 3300044658 Bacteria 2679
254 Ga0466966_0024596 3300044684 Bacteria 3939
255 Ga0466961_0022088 3300044693 Bacteria 4094
256 Ga0466961_0035328 3300044693 Bacteria 3210
257 Ga0466961_0185991 3300044693 Bacteria 1289
258 Ga0466963_0008222 3300044694 Bacteria 6252
259 Ga0466963_0036765 3300044694 Bacteria 3194
260 Ga0466964_0001471 3300044706 Bacteria 8054
261 Ga0466971_0001055 3300044719 Bacteria 11418
262 Ga0466971_0090668 3300044719 Bacteria 1400
263 Ga0466968_0000855 3300044735 Bacteria 10651
264 Ga0466970_0011069 3300044765 Bacteria 4593
265 Ga0466970_0026133 3300044765 Bacteria 3060
266 Ga0466970_0054577 3300044765 Bacteria 2134
267 Ga0466957_0001248 3300044842 Bacteria 13268
268 Ga0466957_0011931 3300044842 Bacteria 5023
269 Ga0466957_0030820 3300044842 Bacteria 3203
270 Ga0466959_0030468 3300045049 Bacteria 3995
271 Ga0466958_0004445 3300045836 Bacteria 7404
272 Ga0466958_0037766 3300045836 Unclassified 2895
273 Ga0466958_0039909 3300045836 Bacteria 2821
274 Ga0466958_0170554 3300045836 Bacteria 1377
275 Ga0466967_0004618 3300045976 Bacteria 9334
276 Ga0466967_0010851 3300045976 Bacteria 6862
277 Ga0466967_0018839 3300045976 Bacteria 5532
278 Ga0466967_0113352 3300045976 Unclassified 2494
279 Ga0466967_0276831 3300045976 Bacteria 1609
280 Ga0466967_0384902 3300045976 Unclassified 1362
281 Ga0466967_0887674 3300045976 Bacteria 886
282 Ga0495602_0076238 3300048088 Bacteria 2842
283 Ga0496107_0303507 3300048910 Bacteria 1188
284 Ga0496108_0000229 3300048911 Bacteria 50203
285 Ga0496108_0083906 3300048911 Bacteria 2703
286 Ga0496109_0440532 3300048912 Bacteria 1231
287 Ga0496112_0053383 3300048915 Bacteria 3969
288 Ga0501067_0042650 3300049583 Bacteria 2519
289 Ga0466962_0011290 3300061719 Bacteria 4302
290 Ga0466962_0025351 3300061719 Bacteria 2847
291 Ga0466962_0049564 3300061719 Bacteria 2007
292 Ga0466962_0124114 3300061719 Bacteria 1247
293 Ga0395905_0332507
294 JGI24741J21665_1002828
295 JGI24740J21852_10000920
296 JGI24739J22299_10003393
297 JGI24735J21928_10009063
298 rootH1_10134058
299 Ga0070658_10008087
300 Ga0070658_10049504
301 Ga0070658_10302791
302 Ga0070658_10308766
303 Ga0070676_10176739
304 Ga0070683_100007342
305 Ga0070670_100003539
306 Ga0070666_10033816
307 Ga0070680_100059704
308 Ga0070680_100086943
309 Ga0070682_100006141
310 Ga0070660_100002159
311 Ga0070660_100009375
312 Ga0070660_100010910
313 Ga0070660_100011547
314 Ga0070660_100032743
315 Ga0070660_100143229
316 Ga0070661_100019297
317 Ga0070661_100057014
318 Ga0070661_100064840
319 Ga0070661_100166003
320 Ga0070661_100316991
321 Ga0070661_100382984
322 Ga0070675_100007959
323 Ga0070671_100001632
324 Ga0070673_100002443
325 Ga0070659_100006077
326 Ga0070659_100059735
327 Ga0070659_100137612
328 Ga0070667_100007567
329 Ga0070667_100364417
330 Ga0070709_10038899
331 Ga0070714_100076920
332 Ga0070713_100080201
333 Ga0070663_100008049
334 Ga0070663_100084328
335 Ga0070663_100112152
336 Ga0070663_100406853
337 Ga0070678_100324087
338 Ga0070662_100014353
339 Ga0070662_100036471
340 Ga0070662_100042331
341 Ga0070662_100108242
342 Ga0070662_100141113
343 Ga0070662_100174396
344 Ga0070662_100214528
345 Ga0068867_100421844
346 Ga0070679_100005864
347 Ga0070679_100330408
348 Ga0070684_100010053
349 Ga0070684_100018104
350 Ga0068853_100300986
351 Ga0068853_100529560
352 Ga0070672_100076663
353 Ga0070672_100217929
354 Ga0070672_100392844
355 Ga0070696_100194650
356 Ga0070693_100013687
357 Ga0070665_100004250
358 Ga0070665_100012382
359 Ga0070665_100833809
360 Ga0068855_100074910
361 Ga0068855_100349114
362 Ga0068855_100926824
363 Ga0070664_100002761
364 Ga0070664_100100720
365 Ga0070664_100150561
366 Ga0068854_100030782
367 Ga0068854_100128876
368 Ga0068856_100166583
369 Ga0068856_100349569
370 Ga0068856_100381023
371 Ga0068852_100307187
372 Ga0068852_100355139
373 Ga0068864_100474675
374 Ga0068858_100266563
375 Ga0070716_100026975
376 Ga0105248_10033216
377 Ga0105248_10167924
378 Ga0105248_10217399
379 Ga0157373_10035527
380 Ga0157371_10076868
381 Ga0157371_10093207
382 Ga0157371_10362502
383 Ga0157370_10026030
384 Ga0157370_10092916
385 Ga0157370_10201321
386 Ga0157370_10533241
387 Ga0157369_10001885
388 Ga0157369_10007345
389 Ga0157369_10209018
390 Ga0157374_10095936
391 Ga0157374_10184434
392 Ga0163162_10109962
393 Ga0157372_10253358
394 Ga0157372_10327580
395 Ga0157375_10015555
396 Ga0157376_10112370
397 Ga0207697_10019452
398 Ga0207688_10017136
399 Ga0207647_10010490
400 Ga0207645_10173278
401 Ga0207705_10003644
402 Ga0207705_10008779
403 Ga0207705_10010100
404 Ga0207705_10029212
405 Ga0207705_10170246
406 Ga0207705_10170941
407 Ga0207707_10002081
408 Ga0207707_10137104
409 Ga0207693_10009507
410 Ga0207660_10007004
411 Ga0207660_10017887
412 Ga0207657_10001566
413 Ga0207657_10015685
414 Ga0207657_10031505
415 Ga0207657_10049957
416 Ga0207657_10134721
417 Ga0207649_10014979
418 Ga0207649_10028520
419 Ga0207649_10029041
420 Ga0207649_10037152
421 Ga0207649_10133910
422 Ga0207652_10011284
423 Ga0207652_10048566
424 Ga0207650_10546874
425 Ga0207659_10005317
426 Ga0207700_10028753
427 Ga0207664_10095812
428 Ga0207644_10001980
429 Ga0207644_10296110
430 Ga0207690_10002372
431 Ga0207690_10038969
432 Ga0207690_10145509
433 Ga0207706_10003399
434 Ga0207706_10008560
435 Ga0207706_10022308
436 Ga0207706_10130390
437 Ga0207706_10163598
438 Ga0207706_10166191
439 Ga0207706_10366026
440 Ga0207669_10008581
441 Ga0207665_10010820
442 Ga0207691_10006392
443 Ga0207691_10312480
444 Ga0207691_10376190
445 Ga0207711_10019137
446 Ga0207711_10255476
447 Ga0207661_10039476
448 Ga0207679_10017661
449 Ga0207679_10039603
450 Ga0207679_10136922
451 Ga0207679_10237936
452 Ga0207667_10159532
453 Ga0207651_10000667
454 Ga0207651_10154584
455 Ga0207651_10235993
456 Ga0207640_10015025
457 Ga0207658_10187510
458 Ga0207639_10176796
459 Ga0207639_10263984
460 Ga0207639_10782122
461 Ga0207678_10002521
462 Ga0207678_10009359
463 Ga0207678_10020481
464 Ga0207678_10020731
465 Ga0207648_10281465
466 Ga0207674_10020470
467 Ga0207683_10002201
468 Ga0207698_10081649
469 Ga0207698_10632789
470 Ga0268266_10009097
471 Ga0268266_10021455
472 Ga0307408_100119771
473 Ga0307408_100727884
474 Ga0307405_10083944
475 Ga0307413_10147171
476 Ga0307413_10321893
477 Ga0307410_10191509
478 Ga0307410_10222607
479 Ga0307410_10229150
480 Ga0307406_10041985
481 Ga0307407_10009979
482 Ga0307407_10108141
483 Ga0307407_10112478
484 Ga0307412_10152604
485 Ga0307412_10185837
486 Ga0307412_10738663
487 Ga0307409_100054957
488 Ga0307409_100600569
489 Ga0307416_100096991
490 Ga0307416_100405000
491 Ga0307414_10088622
492 Ga0307414_10125267
493 Ga0307411_10084775
494 Ga0307415_100080629
495 Ga0307415_100086068
496 Ga0307415_100400848
497 Ga0373923_0006424
498 Ga0373954_0011077
499 Ga0373957_0058508
500 Ga0373943_0013933
501 Ga0373955_0048506
502 Ga0373935_0165846
503 Ga0373933_0144844
504 Ga0395899_0000140
505 Ga0395899_0003919
506 Ga0395899_0006082
507 Ga0395899_0025428
508 Ga0395899_0034743
509 Ga0395899_0178827
510 Ga0395899_0259052
511 Ga0395900_0000075
512 Ga0395900_0005245
513 Ga0395900_0027489
514 Ga0395900_0125124
515 Ga0395900_0146919
516 Ga0395900_0350991
517 Ga0395900_0370746
518 Ga0395900_0428414
519 Ga0395898_0000055
520 Ga0395898_0004667
521 Ga0395898_0042404
522 Ga0395898_0219985
523 Ga0395898_0946359
524 Ga0395905_0000089
525 Ga0395905_0003012
526 Ga0395905_0009007
527 Ga0395905_0026842
528 Ga0395905_0067192
529 Ga0395905_0098037
530 Ga0395905_0170955
531 Ga0395905_0336447
532 Ga0395905_0488086
533 Ga0395905_0758076
534 Ga0395905_0777282
535 Ga0395901_0000418
536 Ga0395901_0000874
537 Ga0395901_0006456
538 Ga0395901_0007257
539 Ga0395901_0056843
540 Ga0395901_0174228
541 Ga0395901_0328222
542 Ga0395901_0661429
543 Ga0450892_007581
544 Ga0466969_0023366
545 Ga0466972_0029969
546 Ga0466966_0024596
547 Ga0466961_0022088
548 Ga0466961_0035328
549 Ga0466961_0185991
550 Ga0466963_0008222
551 Ga0466963_0036765
552 Ga0466964_0001471
553 Ga0466971_0001055
554 Ga0466971_0090668
555 Ga0466968_0000855
556 Ga0466970_0011069
557 Ga0466970_0026133
558 Ga0466970_0054577
559 Ga0466957_0001248
560 Ga0466957_0011931
561 Ga0466957_0030820
562 Ga0466959_0030468
563 Ga0466958_0004445
564 Ga0466958_0037766
565 Ga0466958_0039909
566 Ga0466958_0170554
567 Ga0466967_0004618
568 Ga0466967_0010851
569 Ga0466967_0018839
570 Ga0466967_0113352
571 Ga0466967_0276831
572 Ga0466967_0384902
573 Ga0466967_0887674
574 Ga0495602_0076238
575 Ga0496107_0303507
576 Ga0496108_0000229
577 Ga0496108_0083906
578 Ga0496109_0440532
579 Ga0496112_0053383
580 Ga0501067_0042650
581 Ga0466962_0011290
582 Ga0466962_0025351
583 Ga0466962_0049564
584 Ga0466962_0124114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04402

SIMPL

Protein of unknown function (DUF541)

52

251

0.93

Map