F391029

General Info

Members Datasets Scaffolds Average Seq Length
292 182 584 238

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0000286|Ga0373934_0000286_12843_13637
Length 264
Sequence VANRRRDLDHQRASPDTLVIAPAHRTARQGPRTCRLALFDIDGTLLRTDGAGRRAIHRALIEIFGETGPADHRFDGKTDPQIVRELMRVVGHEDEHIDARMQELFARYVVCLREELRDPEHRAVPLPGVVDLLAALKARDDVTLGLLTGNLMEGARAKLEAVGIDPDIFVIGAFGSDHEYRPELPAIAQRRAREMLGIDVPGRSVVVIGDTPADVECGRDIGARAIGVATGRYSTEELAAHGAVAVFTDLSETTAVVRAIMDDR

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 2.4
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 13.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0000286 3300035086 Bacteria 18178
2 Ga0070658_10000609 3300005327 Bacteria 31011
3 Ga0070658_10003341 3300005327 Bacteria 13233
4 Ga0070658_10013756 3300005327 Bacteria 6494
5 Ga0070658_10066782 3300005327 Bacteria 2938
6 Ga0070658_10460070 3300005327 Bacteria 1097
7 Ga0070683_100001847 3300005329 Bacteria 16521
8 Ga0070683_100002644 3300005329 Bacteria 14322
9 Ga0070683_100002690 3300005329 Bacteria 14204
10 Ga0070683_100011870 3300005329 Bacteria 7550
11 Ga0070683_100081619 3300005329 Bacteria 3027
12 Ga0070683_100145503 3300005329 Unclassified 2245
13 Ga0070683_100231730 3300005329 Bacteria 1756
14 Ga0070670_100067575 3300005331 Unclassified 3067
15 Ga0070677_10035531 3300005333 Bacteria 1933
16 Ga0070677_10116128 3300005333 Bacteria 1202
17 Ga0070680_100013108 3300005336 Bacteria 6452
18 Ga0070680_100017401 3300005336 Bacteria 5669
19 Ga0070680_100050541 3300005336 Unclassified 3391
20 Ga0070680_100112843 3300005336 Unclassified 2263
21 Ga0070660_100006754 3300005339 Bacteria 7962
22 Ga0070660_100041264 3300005339 Bacteria 3517
23 Ga0070660_100148209 3300005339 Bacteria 1886
24 Ga0070689_100226727 3300005340 Bacteria 1535
25 Ga0070687_100088243 3300005343 Unclassified 1709
26 Ga0070661_100000980 3300005344 Bacteria 20220
27 Ga0070661_100248794 3300005344 Bacteria 1371
28 Ga0070661_100295146 3300005344 Bacteria 1260
29 Ga0070668_100003438 3300005347 Bacteria 11689
30 Ga0070669_100017240 3300005353 Bacteria 5152
31 Ga0070675_100002771 3300005354 Bacteria 13184
32 Ga0070671_100304999 3300005355 Bacteria 1356
33 Ga0070671_100308807 3300005355 Bacteria 1347
34 Ga0070674_100170732 3300005356 Bacteria 1658
35 Ga0070673_100013235 3300005364 Bacteria 5697
36 Ga0070673_100147950 3300005364 Unclassified 1987
37 Ga0070673_100743321 3300005364 Bacteria 903
38 Ga0070659_100008931 3300005366 Bacteria 7345
39 Ga0070659_100034515 3300005366 Bacteria 3935
40 Ga0070659_100139629 3300005366 Bacteria 1972
41 Ga0070659_100153127 3300005366 Bacteria 1882
42 Ga0070709_10014127 3300005434 Bacteria 4510
43 Ga0070709_10149629 3300005434 Unclassified 1612
44 Ga0070714_100006293 3300005435 Bacteria 9152
45 Ga0070714_100162053 3300005435 Bacteria 2024
46 Ga0070713_100000373 3300005436 Bacteria 28702
47 Ga0070713_100018516 3300005436 Bacteria 5292
48 Ga0070713_100041402 3300005436 Bacteria 3753
49 Ga0070710_10087461 3300005437 Bacteria 1831
50 Ga0070663_100555841 3300005455 Unclassified 960
51 Ga0070678_100468129 3300005456 Bacteria 1107
52 Ga0070662_100121212 3300005457 Bacteria 2005
53 Ga0070681_10003121 3300005458 Bacteria 15393
54 Ga0070681_10012350 3300005458 Bacteria 8469
55 Ga0070681_10064550 3300005458 Bacteria 3631
56 Ga0070681_10068093 3300005458 Bacteria 3527
57 Ga0070681_10309258 3300005458 Bacteria 1490
58 Ga0070699_100007942 3300005518 Bacteria 9212
59 Ga0070679_100002336 3300005530 Bacteria 17153
60 Ga0070679_100011766 3300005530 Bacteria 8342
61 Ga0070679_100046343 3300005530 Unclassified 4333
62 Ga0070679_100061811 3300005530 Bacteria 3733
63 Ga0070679_100089074 3300005530 Bacteria 3073
64 Ga0070679_100101417 3300005530 Bacteria 2865
65 Ga0070679_100195592 3300005530 Unclassified 1990
66 Ga0070679_100279025 3300005530 Unclassified 1624
67 Ga0070679_100349669 3300005530 Bacteria 1426
68 Ga0070684_100001527 3300005535 Bacteria 16734
69 Ga0070684_100003242 3300005535 Bacteria 12172
70 Ga0070684_100019938 3300005535 Bacteria 5558
71 Ga0070684_100023868 3300005535 Bacteria 5123
72 Ga0070684_100323088 3300005535 Bacteria 1417
73 Ga0070672_100009049 3300005543 Bacteria 6847
74 Ga0070696_100026632 3300005546 Bacteria 3933
75 Ga0068855_100004700 3300005563 Bacteria 16690
76 Ga0070664_100023504 3300005564 Bacteria 5092
77 Ga0070664_100090393 3300005564 Bacteria 2650
78 Ga0070664_100141431 3300005564 Unclassified 2119
79 Ga0070664_100185030 3300005564 Bacteria 1853
80 Ga0070664_100307093 3300005564 Bacteria 1435
81 Ga0070664_100350118 3300005564 Bacteria 1343
82 Ga0068857_100000695 3300005577 Bacteria 25023
83 Ga0068854_100040161 3300005578 Bacteria 3300
84 Ga0068856_100566341 3300005614 Bacteria 1157
85 Ga0070702_100034837 3300005615 Bacteria 2778
86 Ga0068852_100002159 3300005616 Bacteria 13499
87 Ga0068852_100014385 3300005616 Bacteria 6090
88 Ga0068852_100027090 3300005616 Bacteria 4667
89 Ga0068852_100263426 3300005616 Bacteria 1656
90 Ga0068859_100111067 3300005617 Bacteria 2803
91 Ga0068864_100298755 3300005618 Bacteria 1507
92 Ga0068866_10016506 3300005718 Bacteria 3302
93 Ga0068870_10009056 3300005840 Unclassified 4507
94 Ga0068858_100733965 3300005842 Bacteria 962
95 Ga0068860_100018280 3300005843 Bacteria 6823
96 Ga0070717_10003652 3300006028 Bacteria 11042
97 Ga0070712_100001791 3300006175 Bacteria 13136
98 Ga0070712_100098229 3300006175 Bacteria 2160
99 Ga0075433_10343598 3300006852 Unclassified 1319
100 Ga0075434_100001244 3300006871 Bacteria 21188
101 Ga0075434_100067018 3300006871 Unclassified 3577
102 Ga0068865_100012179 3300006881 Bacteria 5409
103 Ga0068865_100173593 3300006881 Bacteria 1654
104 Ga0097620_100111066 3300006931 Bacteria 2803
105 Ga0075435_100076810 3300007076 Bacteria 2737
106 Ga0075435_100710192 3300007076 Unclassified 874
107 Ga0105240_10009590 3300009093 Bacteria 13706
108 Ga0111539_10354403 3300009094 Bacteria 1708
109 Ga0114129_10045469 3300009147 Bacteria 6172
110 Ga0105241_10102581 3300009174 Bacteria 2277
111 Ga0105242_10003283 3300009176 Bacteria 12611
112 Ga0105248_10050256 3300009177 Bacteria 4676
113 Ga0105248_10084985 3300009177 Bacteria 3561
114 Ga0105248_10132527 3300009177 Bacteria 2812
115 Ga0105248_10152099 3300009177 Bacteria 2611
116 Ga0157373_10027318 3300013100 Bacteria 4117
117 Ga0157373_10041352 3300013100 Bacteria 3297
118 Ga0157371_10678922 3300013102 Bacteria 770
119 Ga0157370_10006059 3300013104 Bacteria 13416
120 Ga0157370_10054258 3300013104 Bacteria 3820
121 Ga0157369_10004039 3300013105 Bacteria 17394
122 Ga0157369_10139412 3300013105 Bacteria 2567
123 Ga0157369_10422179 3300013105 Bacteria 1382
124 Ga0157369_10439532 3300013105 Unclassified 1351
125 Ga0157374_10437046 3300013296 Bacteria 1309
126 Ga0163162_10406644 3300013306 Bacteria 1494
127 Ga0157372_10004439 3300013307 Bacteria 14961
128 Ga0157372_10011599 3300013307 Bacteria 9380
129 Ga0157372_10033753 3300013307 Bacteria 5623
130 Ga0157372_10388215 3300013307 Bacteria 1627
131 Ga0157375_10214409 3300013308 Bacteria 2083
132 Ga0157375_10264558 3300013308 Unclassified 1881
133 Ga0157377_10153581 3300014745 Bacteria 1425
134 Ga0157379_10217506 3300014968 Unclassified 1731
135 Ga0206353_10183985 3300020082 Bacteria 2012
136 Ga0207692_10057732 3300025898 Bacteria 1997
137 Ga0207642_10102054 3300025899 Bacteria 1442
138 Ga0207699_10004917 3300025906 Bacteria 6395
139 Ga0207645_10027715 3300025907 Bacteria 3657
140 Ga0207643_10017962 3300025908 Bacteria 3873
141 Ga0207705_10001690 3300025909 Bacteria 17554
142 Ga0207705_10720660 3300025909 Bacteria 775
143 Ga0207654_10101468 3300025911 Unclassified 1774
144 Ga0207707_10001071 3300025912 Bacteria 26261
145 Ga0207707_10025427 3300025912 Bacteria 5180
146 Ga0207707_10025596 3300025912 Bacteria 5161
147 Ga0207707_10032671 3300025912 Bacteria 4555
148 Ga0207707_10038081 3300025912 Bacteria 4202
149 Ga0207707_10250880 3300025912 Unclassified 1537
150 Ga0207707_10277358 3300025912 Bacteria 1452
151 Ga0207695_10036551 3300025913 Bacteria 5309
152 Ga0207695_10058244 3300025913 Bacteria 4011
153 Ga0207693_10009986 3300025915 Bacteria 7717
154 Ga0207693_10018794 3300025915 Bacteria 5500
155 Ga0207663_10754710 3300025916 Unclassified 773
156 Ga0207660_10016376 3300025917 Bacteria 4906
157 Ga0207660_10047866 3300025917 Bacteria 3025
158 Ga0207662_10012420 3300025918 Bacteria 4743
159 Ga0207657_10002488 3300025919 Bacteria 19923
160 Ga0207657_10041553 3300025919 Unclassified 4066
161 Ga0207657_10079721 3300025919 Bacteria 2754
162 Ga0207649_10069135 3300025920 Bacteria 2248
163 Ga0207649_10086664 3300025920 Bacteria 2041
164 Ga0207652_10000449 3300025921 Bacteria 42477
165 Ga0207652_10003671 3300025921 Bacteria 12628
166 Ga0207652_10020628 3300025921 Bacteria 5430
167 Ga0207652_10025290 3300025921 Bacteria 4934
168 Ga0207652_10080548 3300025921 Bacteria 2847
169 Ga0207652_10142164 3300025921 Bacteria 2146
170 Ga0207652_10528208 3300025921 Bacteria 1061
171 Ga0207652_10534853 3300025921 Bacteria 1054
172 Ga0207659_10003837 3300025926 Bacteria 9059
173 Ga0207700_10000109 3300025928 Bacteria 49017
174 Ga0207700_10029708 3300025928 Bacteria 3861
175 Ga0207700_10066519 3300025928 Bacteria 2755
176 Ga0207664_10023708 3300025929 Bacteria 4602
177 Ga0207664_10029392 3300025929 Bacteria 4185
178 Ga0207664_10141762 3300025929 Bacteria 2034
179 Ga0207644_10260840 3300025931 Unclassified 1386
180 Ga0207690_10138703 3300025932 Bacteria 1789
181 Ga0207690_10344850 3300025932 Bacteria 1176
182 Ga0207706_10045537 3300025933 Bacteria 3886
183 Ga0207686_10006574 3300025934 Bacteria 6261
184 Ga0207669_10070741 3300025937 Bacteria 2189
185 Ga0207704_10007389 3300025938 Bacteria 5187
186 Ga0207689_10524878 3300025942 Bacteria 993
187 Ga0207661_10003298 3300025944 Bacteria 11205
188 Ga0207661_10095603 3300025944 Bacteria 2484
189 Ga0207661_10129544 3300025944 Unclassified 2159
190 Ga0207661_10369641 3300025944 Bacteria 1296
191 Ga0207679_10008657 3300025945 Bacteria 6487
192 Ga0207679_10319148 3300025945 Bacteria 1345
193 Ga0207679_10437446 3300025945 Unclassified 1157
194 Ga0207667_10061363 3300025949 Unclassified 3932
195 Ga0207651_10009060 3300025960 Bacteria 5417
196 Ga0207651_10172870 3300025960 Bacteria 1706
197 Ga0207712_10222022 3300025961 Bacteria 1511
198 Ga0207640_10000847 3300025981 Bacteria 17372
199 Ga0207703_10201779 3300026035 Bacteria 1768
200 Ga0207639_10106988 3300026041 Unclassified 2271
201 Ga0207678_10588820 3300026067 Unclassified 975
202 Ga0207648_10054143 3300026089 Unclassified 3505
203 Ga0207676_10164104 3300026095 Bacteria 1928
204 Ga0207674_10004803 3300026116 Bacteria 16180
205 Ga0207674_10034245 3300026116 Bacteria 5313
206 Ga0207683_10479007 3300026121 Bacteria 1148
207 Ga0207698_10026924 3300026142 Bacteria 4074
208 Ga0207698_10058582 3300026142 Bacteria 2986
209 Ga0207698_10085960 3300026142 Bacteria 2556
210 Ga0265327_10001282 3300031251 Bacteria 33063
211 Ga0265327_10001774 3300031251 Bacteria 25451
212 Ga0307405_10476554 3300031731 Bacteria 995
213 Ga0307410_10013179 3300031852 Bacteria 4813
214 Ga0307410_10245724 3300031852 Unclassified 1389
215 Ga0307412_10225574 3300031911 Unclassified 1439
216 Ga0307409_100010212 3300031995 Bacteria 5820
217 Ga0307416_100172938 3300032002 Bacteria 2014
218 Ga0307411_10490402 3300032005 Bacteria 1037
219 Ga0373926_0000758 3300035083 Bacteria 9029
220 Ga0373936_0008707 3300035113 Unclassified 3821
221 Ga0373956_0000513 3300035119 Bacteria 15828
222 Ga0373943_0001191 3300035170 Bacteria 11617
223 Ga0373955_0000722 3300035172 Bacteria 14149
224 Ga0373935_0030323 3300035692 Unclassified 3351
225 Ga0373927_0003313 3300035695 Bacteria 11585
226 Ga0373947_0003522 3300035725 Bacteria 9249
227 Ga0373925_0001024 3300037068 Bacteria 25293
228 Ga0466966_0107897 3300044684 Bacteria 1718
229 Ga0466961_0215090 3300044693 Bacteria 1186
230 Ga0466961_0263897 3300044693 Bacteria 1056
231 Ga0466963_0194450 3300044694 Bacteria 1418
232 Ga0453684_0272784 3300044712 Bacteria 1932
233 Ga0451576_0224335 3300045051 Bacteria 1962
234 Ga0466958_0690159 3300045836 Bacteria 665
235 Ga0466967_0229475 3300045976 Bacteria 1767
236 Ga0495603_0010673 3300046455 Bacteria 5570
237 Ga0495629_0003484 3300046459 Bacteria 11898
238 Ga0495651_0025954 3300046462 Bacteria 4561
239 Ga0495580_0005572 3300046472 Bacteria 10377
240 Ga0495582_0001445 3300046473 Bacteria 13401
241 Ga0495639_0000193 3300046475 Bacteria 31937
242 Ga0495628_0003263 3300046516 Bacteria 14526
243 Ga0495630_0003923 3300046517 Bacteria 10396
244 Ga0495630_0007326 3300046517 Bacteria 7879
245 Ga0495663_0009020 3300046525 Bacteria 2765
246 Ga0495652_0021990 3300046529 Bacteria 5666
247 Ga0495665_0000024 3300046531 Bacteria 59245
248 Ga0495586_0067125 3300046535 Unclassified 1956
249 Ga0495587_0000415 3300046536 Bacteria 30020
250 Ga0495621_0040663 3300046539 Bacteria 1630
251 Ga0495645_0001764 3300046543 Bacteria 14716
252 Ga0495667_0228702 3300046559 Bacteria 1186
253 Ga0495635_0000274 3300046663 Bacteria 33218
254 Ga0495588_0001712 3300046674 Bacteria 9341
255 Ga0495657_0164960 3300046675 Bacteria 1368
256 Ga0495599_0017881 3300046678 Bacteria 4413
257 Ga0495658_0000579 3300046683 Bacteria 19988
258 Ga0495613_0011499 3300046689 Bacteria 6584
259 Ga0495600_0000321 3300046809 Bacteria 25438
260 Ga0495581_0000376 3300047315 Bacteria 22363
261 Ga0495581_0080430 3300047315 Bacteria 1886
262 Ga0495674_0008830 3300047319 Bacteria 9585
263 Ga0495680_0041252 3300047322 Bacteria 3672
264 Ga0495675_0136029 3300047444 Bacteria 1525
265 Ga0495675_0153159 3300047444 Bacteria 1423
266 Ga0495593_0000715 3300047673 Bacteria 19217
267 Ga0495602_0032559 3300048088 Bacteria 4906
268 Ga0495614_0000001 3300048089 Bacteria 137656
269 Ga0496100_0449876 3300048903 Unclassified 987
270 Ga0496101_0281416 3300048904 Bacteria 1300
271 Ga0496107_0069478 3300048910 Bacteria 2557
272 Ga0496109_0426732 3300048912 Unclassified 1252
273 Ga0496110_0453876 3300048913 Bacteria 1168
274 Ga0496112_0002879 3300048915 Bacteria 13997
275 Ga0496113_0017213 3300048916 Bacteria 5013
276 Ga0501037_0076447 3300049573 Bacteria 2431
277 Ga0501047_0065454 3300049581 Bacteria 3504
278 Ga0501069_0215659 3300049585 Bacteria 1115
279 nmdc:mga05p37_376364_c1 3300050507 Bacteria 1665
280 nmdc:mga0qj67_363729_c1 3300050509 Bacteria 1169
281 nmdc:mga0n895_115888_c1 3300050512 Unclassified 2698
282 nmdc:mga0n895_24479_c1 3300050512 Bacteria 5690
283 nmdc:mga0n895_689805_c1 3300050512 Bacteria 1018
284 nmdc:mga0rr50_276123_c1 3300050513 Bacteria 1401
285 nmdc:mga08x19_15087_c1 3300050514 Unclassified 4694
286 nmdc:mga0a205_349680_c1 3300050515 Unclassified 1346
287 Ga0495601_0032821 3300053077 Bacteria 3233
288 Ga0495619_0001805 3300053085 Bacteria 14242
289 Ga0500642_0134463 3300053130 Bacteria 1159
290 Ga0500568_0001546 3300053139 Bacteria 14621
291 Ga0500622_0019299 3300053156 Bacteria 3621
292 Ga0466962_0213275 3300061719 Bacteria 945
293 Ga0373934_0000286
294 Ga0070658_10000609
295 Ga0070658_10003341
296 Ga0070658_10013756
297 Ga0070658_10066782
298 Ga0070658_10460070
299 Ga0070683_100001847
300 Ga0070683_100002644
301 Ga0070683_100002690
302 Ga0070683_100011870
303 Ga0070683_100081619
304 Ga0070683_100145503
305 Ga0070683_100231730
306 Ga0070670_100067575
307 Ga0070677_10035531
308 Ga0070677_10116128
309 Ga0070680_100013108
310 Ga0070680_100017401
311 Ga0070680_100050541
312 Ga0070680_100112843
313 Ga0070660_100006754
314 Ga0070660_100041264
315 Ga0070660_100148209
316 Ga0070689_100226727
317 Ga0070687_100088243
318 Ga0070661_100000980
319 Ga0070661_100248794
320 Ga0070661_100295146
321 Ga0070668_100003438
322 Ga0070669_100017240
323 Ga0070675_100002771
324 Ga0070671_100304999
325 Ga0070671_100308807
326 Ga0070674_100170732
327 Ga0070673_100013235
328 Ga0070673_100147950
329 Ga0070673_100743321
330 Ga0070659_100008931
331 Ga0070659_100034515
332 Ga0070659_100139629
333 Ga0070659_100153127
334 Ga0070709_10014127
335 Ga0070709_10149629
336 Ga0070714_100006293
337 Ga0070714_100162053
338 Ga0070713_100000373
339 Ga0070713_100018516
340 Ga0070713_100041402
341 Ga0070710_10087461
342 Ga0070663_100555841
343 Ga0070678_100468129
344 Ga0070662_100121212
345 Ga0070681_10003121
346 Ga0070681_10012350
347 Ga0070681_10064550
348 Ga0070681_10068093
349 Ga0070681_10309258
350 Ga0070699_100007942
351 Ga0070679_100002336
352 Ga0070679_100011766
353 Ga0070679_100046343
354 Ga0070679_100061811
355 Ga0070679_100089074
356 Ga0070679_100101417
357 Ga0070679_100195592
358 Ga0070679_100279025
359 Ga0070679_100349669
360 Ga0070684_100001527
361 Ga0070684_100003242
362 Ga0070684_100019938
363 Ga0070684_100023868
364 Ga0070684_100323088
365 Ga0070672_100009049
366 Ga0070696_100026632
367 Ga0068855_100004700
368 Ga0070664_100023504
369 Ga0070664_100090393
370 Ga0070664_100141431
371 Ga0070664_100185030
372 Ga0070664_100307093
373 Ga0070664_100350118
374 Ga0068857_100000695
375 Ga0068854_100040161
376 Ga0068856_100566341
377 Ga0070702_100034837
378 Ga0068852_100002159
379 Ga0068852_100014385
380 Ga0068852_100027090
381 Ga0068852_100263426
382 Ga0068859_100111067
383 Ga0068864_100298755
384 Ga0068866_10016506
385 Ga0068870_10009056
386 Ga0068858_100733965
387 Ga0068860_100018280
388 Ga0070717_10003652
389 Ga0070712_100001791
390 Ga0070712_100098229
391 Ga0075433_10343598
392 Ga0075434_100001244
393 Ga0075434_100067018
394 Ga0068865_100012179
395 Ga0068865_100173593
396 Ga0097620_100111066
397 Ga0075435_100076810
398 Ga0075435_100710192
399 Ga0105240_10009590
400 Ga0111539_10354403
401 Ga0114129_10045469
402 Ga0105241_10102581
403 Ga0105242_10003283
404 Ga0105248_10050256
405 Ga0105248_10084985
406 Ga0105248_10132527
407 Ga0105248_10152099
408 Ga0157373_10027318
409 Ga0157373_10041352
410 Ga0157371_10678922
411 Ga0157370_10006059
412 Ga0157370_10054258
413 Ga0157369_10004039
414 Ga0157369_10139412
415 Ga0157369_10422179
416 Ga0157369_10439532
417 Ga0157374_10437046
418 Ga0163162_10406644
419 Ga0157372_10004439
420 Ga0157372_10011599
421 Ga0157372_10033753
422 Ga0157372_10388215
423 Ga0157375_10214409
424 Ga0157375_10264558
425 Ga0157377_10153581
426 Ga0157379_10217506
427 Ga0206353_10183985
428 Ga0207692_10057732
429 Ga0207642_10102054
430 Ga0207699_10004917
431 Ga0207645_10027715
432 Ga0207643_10017962
433 Ga0207705_10001690
434 Ga0207705_10720660
435 Ga0207654_10101468
436 Ga0207707_10001071
437 Ga0207707_10025427
438 Ga0207707_10025596
439 Ga0207707_10032671
440 Ga0207707_10038081
441 Ga0207707_10250880
442 Ga0207707_10277358
443 Ga0207695_10036551
444 Ga0207695_10058244
445 Ga0207693_10009986
446 Ga0207693_10018794
447 Ga0207663_10754710
448 Ga0207660_10016376
449 Ga0207660_10047866
450 Ga0207662_10012420
451 Ga0207657_10002488
452 Ga0207657_10041553
453 Ga0207657_10079721
454 Ga0207649_10069135
455 Ga0207649_10086664
456 Ga0207652_10000449
457 Ga0207652_10003671
458 Ga0207652_10020628
459 Ga0207652_10025290
460 Ga0207652_10080548
461 Ga0207652_10142164
462 Ga0207652_10528208
463 Ga0207652_10534853
464 Ga0207659_10003837
465 Ga0207700_10000109
466 Ga0207700_10029708
467 Ga0207700_10066519
468 Ga0207664_10023708
469 Ga0207664_10029392
470 Ga0207664_10141762
471 Ga0207644_10260840
472 Ga0207690_10138703
473 Ga0207690_10344850
474 Ga0207706_10045537
475 Ga0207686_10006574
476 Ga0207669_10070741
477 Ga0207704_10007389
478 Ga0207689_10524878
479 Ga0207661_10003298
480 Ga0207661_10095603
481 Ga0207661_10129544
482 Ga0207661_10369641
483 Ga0207679_10008657
484 Ga0207679_10319148
485 Ga0207679_10437446
486 Ga0207667_10061363
487 Ga0207651_10009060
488 Ga0207651_10172870
489 Ga0207712_10222022
490 Ga0207640_10000847
491 Ga0207703_10201779
492 Ga0207639_10106988
493 Ga0207678_10588820
494 Ga0207648_10054143
495 Ga0207676_10164104
496 Ga0207674_10004803
497 Ga0207674_10034245
498 Ga0207683_10479007
499 Ga0207698_10026924
500 Ga0207698_10058582
501 Ga0207698_10085960
502 Ga0265327_10001282
503 Ga0265327_10001774
504 Ga0307405_10476554
505 Ga0307410_10013179
506 Ga0307410_10245724
507 Ga0307412_10225574
508 Ga0307409_100010212
509 Ga0307416_100172938
510 Ga0307411_10490402
511 Ga0373926_0000758
512 Ga0373936_0008707
513 Ga0373956_0000513
514 Ga0373943_0001191
515 Ga0373955_0000722
516 Ga0373935_0030323
517 Ga0373927_0003313
518 Ga0373947_0003522
519 Ga0373925_0001024
520 Ga0466966_0107897
521 Ga0466961_0215090
522 Ga0466961_0263897
523 Ga0466963_0194450
524 Ga0453684_0272784
525 Ga0451576_0224335
526 Ga0466958_0690159
527 Ga0466967_0229475
528 Ga0495603_0010673
529 Ga0495629_0003484
530 Ga0495651_0025954
531 Ga0495580_0005572
532 Ga0495582_0001445
533 Ga0495639_0000193
534 Ga0495628_0003263
535 Ga0495630_0003923
536 Ga0495630_0007326
537 Ga0495663_0009020
538 Ga0495652_0021990
539 Ga0495665_0000024
540 Ga0495586_0067125
541 Ga0495587_0000415
542 Ga0495621_0040663
543 Ga0495645_0001764
544 Ga0495667_0228702
545 Ga0495635_0000274
546 Ga0495588_0001712
547 Ga0495657_0164960
548 Ga0495599_0017881
549 Ga0495658_0000579
550 Ga0495613_0011499
551 Ga0495600_0000321
552 Ga0495581_0000376
553 Ga0495581_0080430
554 Ga0495674_0008830
555 Ga0495680_0041252
556 Ga0495675_0136029
557 Ga0495675_0153159
558 Ga0495593_0000715
559 Ga0495602_0032559
560 Ga0495614_0000001
561 Ga0496100_0449876
562 Ga0496101_0281416
563 Ga0496107_0069478
564 Ga0496109_0426732
565 Ga0496110_0453876
566 Ga0496112_0002879
567 Ga0496113_0017213
568 Ga0501037_0076447
569 Ga0501047_0065454
570 Ga0501069_0215659
571 nmdc:mga05p37_376364_c1
572 nmdc:mga0qj67_363729_c1
573 nmdc:mga0n895_115888_c1
574 nmdc:mga0n895_24479_c1
575 nmdc:mga0n895_689805_c1
576 nmdc:mga0rr50_276123_c1
577 nmdc:mga08x19_15087_c1
578 nmdc:mga0a205_349680_c1
579 Ga0495601_0032821
580 Ga0495619_0001805
581 Ga0500642_0134463
582 Ga0500568_0001546
583 Ga0500622_0019299
584 Ga0466962_0213275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

184

253

0.87

PF12710

HAD

haloacid dehalogenase-like hydrolase

37

219

0.79

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

37

228

0.78

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

34

222

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hcf-assembly1.cif.gz_A crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution 0.8556 2 215
2hcf-assembly1.cif.gz_A crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution 0.8445 2 215
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.7535 165 200
4gib-assembly2.cif.gz_B 2.27 angstrom crystal structure of beta-phosphoglucomutase (pgmb) from clostridium difficile 0.7368 1 213
4gib-assembly2.cif.gz_B 2.27 angstrom crystal structure of beta-phosphoglucomutase (pgmb) from clostridium difficile 0.7254 1 213
ID Description Score Start End Superfamily
2hcfA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9153 19 81 1.10.150.240
2hcfA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8619 19 81 1.10.150.240
2hcfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7448 2 215 3.40.50.1000
2hcfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7317 2 215 3.40.50.1000
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7233 159 200 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V7HGS6-F1-model_v4 Hydrolase 0.9213 1 216 GO:0016787
AF-A0A7W1ENQ8-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9183 37 213 GO:0016787
AF-A0A7Y3E3S1-F1-model_v4 HAD hydrolase-like protein 0.9175 1 213 GO:0005829
GO:0006281
GO:0008967
AF-A0A2V7HGS6-F1-model_v4 Hydrolase 0.9173 1 216 GO:0016787
AF-A0A1G0PFY2-F1-model_v4 Hydrolase 0.9161 1 215 GO:0003824

Map