F390993

General Info

Members Datasets Scaffolds Average Seq Length
292 225 584 209

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10045771|Ga0268266_100457712
Length 225
Sequence MPEQKVLAPDPADAVHSHDVPAERPWSRLLKRGQTLRIVDIEGQQAVDALLYCAENPAERYSAQDTLRVQGSAYVGLGTRLISNKGRVMARITADSCGRHDTSAGCCSCESNAVRFGEAAKYQHACRENFLLELSRYGLGKRDIVANLNFFMNVPIDPSGKFTVVDGISAPGNHVDVTAEIDVIFVLSNCPQINNPCNGFNPTPVRVHVWDPPAAVRVRCGPTSG

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
190 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
197 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
198 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
199 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
200 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
201 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
207 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
211 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
212 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
213 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
217 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
218 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
219 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
222 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
223 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
224 2862574272 Streptomyces sp. AcE210 Isolate Nodule
225 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0.34
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.47
Nodule 0.34
Rhizoplane 4.45
Rhizosphere 64.73
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10045771 3300028379 Bacteria 3744
2 Ga0065714_10092554 3300005288 Bacteria 1871
3 Ga0070658_10000886 3300005327 Bacteria 25616
4 Ga0070670_100191779 3300005331 Bacteria 1775
5 Ga0070691_10002707 3300005341 Bacteria 7893
6 Ga0070709_10000319 3300005434 Bacteria 30574
7 Ga0070714_100004831 3300005435 Bacteria 10228
8 Ga0070714_100083148 3300005435 Bacteria 2791
9 Ga0070714_100083601 3300005435 Bacteria 2784
10 Ga0070713_100006513 3300005436 Bacteria 8104
11 Ga0070713_100023303 3300005436 Bacteria 4802
12 Ga0070713_100139055 3300005436 Bacteria 2149
13 Ga0070713_100197132 3300005436 Bacteria 1817
14 Ga0070710_10004237 3300005437 Bacteria 6800
15 Ga0070711_100001884 3300005439 Bacteria 11723
16 Ga0070694_100025628 3300005444 Bacteria 3815
17 Ga0070663_100077114 3300005455 Unclassified 2439
18 Ga0070706_100427455 3300005467 Bacteria 1233
19 Ga0070706_100556502 3300005467 Bacteria 1067
20 Ga0070698_100025331 3300005471 Bacteria 6184
21 Ga0070698_100439598 3300005471 Bacteria 1240
22 Ga0070697_100105783 3300005536 Bacteria 2341
23 Ga0070697_100255862 3300005536 Bacteria 1498
24 Ga0070695_100003656 3300005545 Bacteria 8965
25 Ga0070665_100024707 3300005548 Bacteria 6054
26 Ga0070704_100503337 3300005549 Bacteria 1051
27 Ga0068859_100193248 3300005617 Bacteria 2119
28 Ga0068864_100411528 3300005618 Bacteria 1287
29 Ga0068863_100171950 3300005841 Bacteria 2078
30 Ga0068860_100000223 3300005843 Bacteria 88152
31 Ga0068862_100171137 3300005844 Bacteria 1945
32 Ga0081455_10001119 3300005937 Bacteria 33516
33 Ga0081539_10042131 3300005985 Bacteria 2662
34 Ga0070717_10003598 3300006028 Bacteria 11118
35 Ga0070717_10053283 3300006028 Bacteria 3334
36 Ga0070717_10220964 3300006028 Bacteria 1665
37 Ga0070717_10304598 3300006028 Bacteria 1417
38 Ga0075368_10116834 3300006042 Bacteria 1103
39 Ga0075363_100009218 3300006048 Bacteria 4636
40 Ga0070716_100011752 3300006173 Bacteria 4415
41 Ga0070716_100154038 3300006173 Bacteria 1482
42 Ga0070716_100284911 3300006173 Bacteria 1142
43 Ga0070712_100011957 3300006175 Bacteria 5517
44 Ga0070712_100763214 3300006175 Bacteria 828
45 Ga0075367_10017274 3300006178 Bacteria 3957
46 Ga0075369_10013424 3300006186 Bacteria 3252
47 Ga0075366_10027043 3300006195 Bacteria 3364
48 Ga0068871_100832978 3300006358 Bacteria 852
49 Ga0075433_10008855 3300006852 Bacteria 8029
50 Ga0075434_100016105 3300006871 Bacteria 7184
51 Ga0068865_100239708 3300006881 Bacteria 1426
52 Ga0097620_100193266 3300006931 Bacteria 2119
53 Ga0099794_10001048 3300007265 Bacteria 9427
54 Ga0099794_10132429 3300007265 Bacteria 1259
55 Ga0099795_10006298 3300007788 Bacteria 3230
56 Ga0099795_10038245 3300007788 Bacteria 1693
57 Ga0105247_10140330 3300009101 Bacteria 1583
58 Ga0099796_10004290 3300010159 Bacteria 3429
59 Ga0099796_10018241 3300010159 Bacteria 2104
60 Ga0099796_10025879 3300010159 Bacteria 1858
61 Ga0099796_10039696 3300010159 Bacteria 1586
62 Ga0105239_10287882 3300010375 Bacteria 1850
63 Ga0105239_11142634 3300010375 Bacteria 897
64 Ga0163162_10830209 3300013306 Bacteria 1040
65 Ga0157375_10458216 3300013308 Bacteria 1441
66 Ga0157380_10216653 3300014326 Bacteria 1710
67 Ga0157379_10234782 3300014968 Bacteria 1663
68 Ga0157376_11090504 3300014969 Bacteria 824
69 Ga0163161_10023596 3300017792 Bacteria 4341
70 Ga0213876_10023900 3300021384 Bacteria 3227
71 Ga0213875_10044060 3300021388 Bacteria 2096
72 Ga0213871_10013983 3300021441 Bacteria 1896
73 Ga0209677_106078 3300025253 Bacteria 2967
74 Ga0209233_1000794 3300025261 Bacteria 14173
75 Ga0209455_1009538 3300025272 Bacteria 2541
76 Ga0207656_10145643 3300025321 Bacteria 1119
77 Ga0207692_10002089 3300025898 Bacteria 7627
78 Ga0207710_10059843 3300025900 Bacteria 1725
79 Ga0207647_10016025 3300025904 Bacteria 5124
80 Ga0207685_10036292 3300025905 Bacteria 1806
81 Ga0207699_10000325 3300025906 Bacteria 25458
82 Ga0207705_10000037 3300025909 Bacteria 197951
83 Ga0207684_10103149 3300025910 Bacteria 2439
84 Ga0207684_10375272 3300025910 Bacteria 1223
85 Ga0207693_10007370 3300025915 Bacteria 9045
86 Ga0207663_10000634 3300025916 Bacteria 15595
87 Ga0207663_10108185 3300025916 Bacteria 1882
88 Ga0207681_10264047 3300025923 Bacteria 1349
89 Ga0207694_10066891 3300025924 Bacteria 2804
90 Ga0207694_10435902 3300025924 Bacteria 1093
91 Ga0207659_10385868 3300025926 Bacteria 1169
92 Ga0207700_10153878 3300025928 Bacteria 1903
93 Ga0207700_10255404 3300025928 Bacteria 1499
94 Ga0207664_10040666 3300025929 Bacteria 3617
95 Ga0207664_10043561 3300025929 Bacteria 3511
96 Ga0207664_10241322 3300025929 Bacteria 1574
97 Ga0207669_10084474 3300025937 Bacteria 2046
98 Ga0207665_10003069 3300025939 Bacteria 11212
99 Ga0207665_10167248 3300025939 Bacteria 1586
100 Ga0207691_10180912 3300025940 Bacteria 1842
101 Ga0207658_10568430 3300025986 Bacteria 1016
102 Ga0207703_10664578 3300026035 Bacteria 989
103 Ga0207678_10099173 3300026067 Unclassified 2488
104 Ga0207708_10237094 3300026075 Bacteria 1466
105 Ga0207702_10004080 3300026078 Bacteria 13108
106 Ga0207641_10288117 3300026088 Bacteria 1547
107 Ga0207676_10719214 3300026095 Bacteria 969
108 Ga0207674_10012079 3300026116 Bacteria 9673
109 Ga0207675_100046203 3300026118 Bacteria 4067
110 Ga0207698_10000516 3300026142 Bacteria 22421
111 Ga0209588_1003491 3300027671 Bacteria 4367
112 Ga0207428_10204355 3300027907 Bacteria 1486
113 Ga0268266_10011882 3300028379 Bacteria 7541
114 Ga0268264_10000119 3300028381 Bacteria 192507
115 Ga0307517_10003333 3300028786 Bacteria 25000
116 Ga0307511_10182942 3300030521 Bacteria 1125
117 Ga0265762_1025332 3300030760 Bacteria 1106
118 Ga0265331_10087342 3300031250 Bacteria 1444
119 Ga0307513_10051236 3300031456 Bacteria 4455
120 Ga0307513_10171802 3300031456 Bacteria 2044
121 Ga0307509_10098930 3300031507 Bacteria 2960
122 Ga0307508_10000020 3300031616 Bacteria 188730
123 Ga0307508_10149751 3300031616 Bacteria 1937
124 Ga0307514_10225499 3300031649 Bacteria 1143
125 Ga0265314_10016915 3300031711 Bacteria 5743
126 Ga0265342_10005199 3300031712 Bacteria 9999
127 Ga0307516_10007316 3300031730 Bacteria 12708
128 Ga0307516_10025611 3300031730 Bacteria 6005
129 Ga0307516_10163462 3300031730 Bacteria 1974
130 Ga0307410_10483445 3300031852 Bacteria 1016
131 Ga0307507_10098634 3300033179 Bacteria 2458
132 Ga0307507_10380204 3300033179 Bacteria 814
133 Ga0307510_10008359 3300033180 Bacteria 12332
134 Ga0307510_10348333 3300033180 Bacteria 932
135 Ga0373938_0008911 3300034957 Bacteria 1803
136 Ga0373928_0009060 3300035084 Bacteria 1942
137 Ga0373949_0014956 3300035090 Bacteria 1731
138 Ga0373932_0013923 3300035112 Bacteria 2012
139 Ga0373939_0012535 3300035114 Bacteria 2163
140 Ga0373941_0028460 3300035115 Bacteria 1641
141 Ga0373941_0048863 3300035115 Bacteria 1337
142 Ga0373962_0000915 3300035242 Bacteria 6773
143 Ga0373931_0036532 3300035691 Bacteria 2561
144 Ga0373935_0103616 3300035692 Bacteria 1879
145 Ga0373935_0203600 3300035692 Bacteria 1369
146 Ga0373933_0290573 3300035724 Bacteria 1057
147 Ga0373947_0470095 3300035725 Bacteria 853
148 Ga0373937_0048657 3300036401 Bacteria 3882
149 Ga0373937_0484392 3300036401 Bacteria 1175
150 Ga0373925_0121091 3300037068 Bacteria 2031
151 Ga0436364_0527289 3300037853 Bacteria 1484
152 Ga0436365_0624204 3300039437 Bacteria 13811
153 Ga0436360_0416271 3300039438 Bacteria 2415
154 Ga0436360_0927162 3300039438 Bacteria 1174
155 Ga0436363_0147380 3300039450 Bacteria 1143
156 Ga0451804_0280906 3300041463 Bacteria 779
157 Ga0450900_015421 3300042136 Bacteria 1027
158 Ga0466969_0057297 3300044656 Bacteria 1899
159 Ga0466966_0042727 3300044684 Bacteria 2907
160 Ga0466961_0101895 3300044693 Bacteria 1808
161 Ga0466964_0245557 3300044706 Bacteria 880
162 Ga0466959_0042906 3300045049 Bacteria 3335
163 Ga0495603_0000267 3300046455 Bacteria 27512
164 Ga0495603_0019881 3300046455 Bacteria 4067
165 Ga0495603_0217683 3300046455 Bacteria 1102
166 Ga0495629_0015704 3300046459 Bacteria 5436
167 Ga0495629_0149810 3300046459 Bacteria 1622
168 Ga0495638_0015226 3300046460 Bacteria 5170
169 Ga0495638_0036251 3300046460 Bacteria 3143
170 Ga0495641_0137468 3300046461 Bacteria 1091
171 Ga0495639_0046321 3300046475 Bacteria 1968
172 Ga0495662_0085054 3300046476 Bacteria 1540
173 Ga0495584_0290396 3300046491 Bacteria 831
174 Ga0495585_0082515 3300046492 Bacteria 1740
175 Ga0495594_0114318 3300046499 Bacteria 1523
176 Ga0495594_0189908 3300046499 Bacteria 1170
177 Ga0495594_0378817 3300046499 Bacteria 805
178 Ga0495608_0403053 3300046511 Bacteria 836
179 Ga0495643_0003961 3300046522 Bacteria 10594
180 Ga0495666_0043911 3300046526 Bacteria 2159
181 Ga0495645_0369309 3300046543 Bacteria 920
182 Ga0495634_0599199 3300046642 Bacteria 639
183 Ga0495611_0065561 3300046648 Bacteria 1655
184 Ga0495588_0015251 3300046674 Bacteria 3695
185 Ga0495623_0003021 3300046679 Bacteria 11072
186 Ga0495658_0020726 3300046683 Bacteria 3455
187 Ga0495613_0177941 3300046689 Bacteria 1507
188 Ga0495613_0517469 3300046689 Bacteria 802
189 Ga0495670_0118312 3300046691 Bacteria 1375
190 Ga0495671_0112291 3300046692 Bacteria 1331
191 Ga0495589_0000529 3300046794 Bacteria 26758
192 Ga0495589_0000937 3300046794 Bacteria 17884
193 Ga0495589_0106818 3300046794 Bacteria 1352
194 Ga0495660_0219218 3300046810 Bacteria 898
195 Ga0495604_0003192 3300047317 Bacteria 13101
196 Ga0495636_0053253 3300047318 Bacteria 1699
197 Ga0495676_0011241 3300047321 Bacteria 8092
198 Ga0495683_0093827 3300047323 Bacteria 1451
199 Ga0495683_0103402 3300047323 Bacteria 1367
200 Ga0495687_004235 3300047443 Bacteria 9836
201 Ga0495675_0010508 3300047444 Bacteria 5785
202 Ga0495675_0181625 3300047444 Bacteria 1288
203 Ga0495685_000725 3300047447 Bacteria 10124
204 Ga0495685_003392 3300047447 Bacteria 5084
205 Ga0495681_0004086 3300047470 Bacteria 10041
206 Ga0496100_1187039 3300048903 Bacteria 602
207 Ga0496102_0754472 3300048905 Bacteria 896
208 Ga0496103_0278018 3300048906 Bacteria 1077
209 Ga0496104_0009623 3300048907 Bacteria 8608
210 Ga0496105_0210597 3300048908 Bacteria 1584
211 Ga0496106_0001169 3300048909 Bacteria 19515
212 Ga0496108_0006623 3300048911 Bacteria 9389
213 Ga0496108_0726683 3300048911 Bacteria 860
214 Ga0496109_0010253 3300048912 Bacteria 8001
215 Ga0496110_0008368 3300048913 Bacteria 8322
216 Ga0496111_0116186 3300048914 Bacteria 1973
217 Ga0496112_1094021 3300048915 Bacteria 715
218 Ga0496117_0023127 3300048920 Bacteria 4964
219 Ga0496117_0044801 3300048920 Bacteria 3202
220 Ga0496118_0006686 3300048921 Bacteria 12570
221 Ga0496119_0037612 3300048922 Bacteria 3141
222 Ga0496119_0045600 3300048922 Bacteria 2746
223 Ga0496121_0000089 3300048924 Bacteria 219007
224 Ga0496121_0069076 3300048924 Bacteria 2854
225 Ga0496121_0091387 3300048924 Bacteria 2377
226 Ga0496121_0342078 3300048924 Bacteria 999
227 Ga0496124_0008994 3300048927 Bacteria 10334
228 Ga0496125_0098285 3300048928 Bacteria 2166
229 Ga0496126_0008012 3300048929 Bacteria 11465
230 Ga0496126_0135043 3300048929 Bacteria 2129
231 Ga0496126_0146952 3300048929 Bacteria 2024
232 Ga0496126_0228020 3300048929 Bacteria 1562
233 Ga0501031_0263921 3300049568 Bacteria 1119
234 Ga0501034_0529419 3300049571 Bacteria 1090
235 Ga0501043_0588915 3300049579 Bacteria 823
236 Ga0501047_0009927 3300049581 Bacteria 9001
237 Ga0501047_0089137 3300049581 Bacteria 2962
238 Ga0501047_0433470 3300049581 Bacteria 1145
239 Ga0501044_0269262 3300049823 Bacteria 1640
240 nmdc:mga03683_10981_c1 3300050489 Bacteria 1577
241 nmdc:mga03n38_382736_c1 3300050490 Bacteria 771
242 nmdc:mga06z11_99226_c1 3300050494 Bacteria 1595
243 nmdc:mga04h51_162794_c1 3300050495 Bacteria 859
244 nmdc:mga08y16_548222_c1 3300050511 Bacteria 1170
245 nmdc:mga08y16_98843_c1 3300050511 Bacteria 3039
246 nmdc:mga0n895_14355_c1 3300050512 Bacteria 7192
247 nmdc:mga0a205_2030_c1 3300050515 Bacteria 17685
248 nmdc:mga0sz30_1842_c1 3300050516 Bacteria 7550
249 Ga0500635_0101213 3300053080 Bacteria 1060
250 Ga0500578_0003040 3300053086 Bacteria 12973
251 Ga0500578_0288698 3300053086 Bacteria 976
252 Ga0500646_0026743 3300053090 Bacteria 1566
253 Ga0500647_0030247 3300053091 Bacteria 2572
254 Ga0500651_0013691 3300053093 Bacteria 4950
255 Ga0500566_0024112 3300053094 Bacteria 3573
256 Ga0500566_0154498 3300053094 Bacteria 1203
257 Ga0500641_0020214 3300053096 Bacteria 2526
258 Ga0500654_008803 3300053099 Bacteria 6934
259 Ga0500556_0041824 3300053104 Bacteria 1618
260 Ga0500560_083584 3300053107 Bacteria 1062
261 Ga0500569_001933 3300053109 Bacteria 4008
262 Ga0500572_001640 3300053111 Bacteria 5872
263 Ga0500572_043419 3300053111 Bacteria 1314
264 Ga0500594_0162092 3300053118 Bacteria 723
265 Ga0500621_060512 3300053126 Bacteria 1530
266 Ga0500628_001094 3300053129 Bacteria 4727
267 Ga0500652_007936 3300053131 Bacteria 3508
268 Ga0500658_0004609 3300053134 Bacteria 5142
269 Ga0500559_0000818 3300053136 Bacteria 20202
270 Ga0500577_0042151 3300053142 Bacteria 1670
271 Ga0500577_0110731 3300053142 Bacteria 1133
272 Ga0500600_0048724 3300053149 Bacteria 2411
273 Ga0500603_066453 3300053150 Bacteria 1019
274 Ga0500604_0025916 3300053151 Bacteria 1688
275 Ga0500616_0013495 3300053153 Bacteria 4740
276 Ga0500633_0001871 3300053160 Bacteria 4143
277 Ga0500634_0018265 3300053161 Bacteria 3764
278 Ga0500638_189507 3300053162 Bacteria 880
279 Ga0500639_033666 3300053163 Bacteria 2708
280 Ga0500636_0014203 3300053177 Bacteria 4682
281 Ga0500637_0386664 3300053178 Bacteria 731
282 Ga0500637_0535238 3300053178 Bacteria 571
283 Ga0500576_044866 3300053725 Bacteria 1980
284 Ga0500656_000308 3300053732 Bacteria 3439
285 Ga0500601_015115 3300053737 Bacteria 877
286 Ga0500587_001605 3300053739 Bacteria 3215
287 Ga0501084_0293529 3300054114 Bacteria 1373
288 2644523881 2643221694 Bacteria 4392972
289 2644667977 2643221722 Bacteria 4247614
290 2734975228 2734482000 Bacteria 5525167
291 2862581749 2862574272 Bacteria 10567477
292 2918508352 2918501144 Bacteria 8668083
293 Ga0268266_10045771
294 Ga0065714_10092554
295 Ga0070658_10000886
296 Ga0070670_100191779
297 Ga0070691_10002707
298 Ga0070709_10000319
299 Ga0070714_100004831
300 Ga0070714_100083148
301 Ga0070714_100083601
302 Ga0070713_100006513
303 Ga0070713_100023303
304 Ga0070713_100139055
305 Ga0070713_100197132
306 Ga0070710_10004237
307 Ga0070711_100001884
308 Ga0070694_100025628
309 Ga0070663_100077114
310 Ga0070706_100427455
311 Ga0070706_100556502
312 Ga0070698_100025331
313 Ga0070698_100439598
314 Ga0070697_100105783
315 Ga0070697_100255862
316 Ga0070695_100003656
317 Ga0070665_100024707
318 Ga0070704_100503337
319 Ga0068859_100193248
320 Ga0068864_100411528
321 Ga0068863_100171950
322 Ga0068860_100000223
323 Ga0068862_100171137
324 Ga0081455_10001119
325 Ga0081539_10042131
326 Ga0070717_10003598
327 Ga0070717_10053283
328 Ga0070717_10220964
329 Ga0070717_10304598
330 Ga0075368_10116834
331 Ga0075363_100009218
332 Ga0070716_100011752
333 Ga0070716_100154038
334 Ga0070716_100284911
335 Ga0070712_100011957
336 Ga0070712_100763214
337 Ga0075367_10017274
338 Ga0075369_10013424
339 Ga0075366_10027043
340 Ga0068871_100832978
341 Ga0075433_10008855
342 Ga0075434_100016105
343 Ga0068865_100239708
344 Ga0097620_100193266
345 Ga0099794_10001048
346 Ga0099794_10132429
347 Ga0099795_10006298
348 Ga0099795_10038245
349 Ga0105247_10140330
350 Ga0099796_10004290
351 Ga0099796_10018241
352 Ga0099796_10025879
353 Ga0099796_10039696
354 Ga0105239_10287882
355 Ga0105239_11142634
356 Ga0163162_10830209
357 Ga0157375_10458216
358 Ga0157380_10216653
359 Ga0157379_10234782
360 Ga0157376_11090504
361 Ga0163161_10023596
362 Ga0213876_10023900
363 Ga0213875_10044060
364 Ga0213871_10013983
365 Ga0209677_106078
366 Ga0209233_1000794
367 Ga0209455_1009538
368 Ga0207656_10145643
369 Ga0207692_10002089
370 Ga0207710_10059843
371 Ga0207647_10016025
372 Ga0207685_10036292
373 Ga0207699_10000325
374 Ga0207705_10000037
375 Ga0207684_10103149
376 Ga0207684_10375272
377 Ga0207693_10007370
378 Ga0207663_10000634
379 Ga0207663_10108185
380 Ga0207681_10264047
381 Ga0207694_10066891
382 Ga0207694_10435902
383 Ga0207659_10385868
384 Ga0207700_10153878
385 Ga0207700_10255404
386 Ga0207664_10040666
387 Ga0207664_10043561
388 Ga0207664_10241322
389 Ga0207669_10084474
390 Ga0207665_10003069
391 Ga0207665_10167248
392 Ga0207691_10180912
393 Ga0207658_10568430
394 Ga0207703_10664578
395 Ga0207678_10099173
396 Ga0207708_10237094
397 Ga0207702_10004080
398 Ga0207641_10288117
399 Ga0207676_10719214
400 Ga0207674_10012079
401 Ga0207675_100046203
402 Ga0207698_10000516
403 Ga0209588_1003491
404 Ga0207428_10204355
405 Ga0268266_10011882
406 Ga0268264_10000119
407 Ga0307517_10003333
408 Ga0307511_10182942
409 Ga0265762_1025332
410 Ga0265331_10087342
411 Ga0307513_10051236
412 Ga0307513_10171802
413 Ga0307509_10098930
414 Ga0307508_10000020
415 Ga0307508_10149751
416 Ga0307514_10225499
417 Ga0265314_10016915
418 Ga0265342_10005199
419 Ga0307516_10007316
420 Ga0307516_10025611
421 Ga0307516_10163462
422 Ga0307410_10483445
423 Ga0307507_10098634
424 Ga0307507_10380204
425 Ga0307510_10008359
426 Ga0307510_10348333
427 Ga0373938_0008911
428 Ga0373928_0009060
429 Ga0373949_0014956
430 Ga0373932_0013923
431 Ga0373939_0012535
432 Ga0373941_0028460
433 Ga0373941_0048863
434 Ga0373962_0000915
435 Ga0373931_0036532
436 Ga0373935_0103616
437 Ga0373935_0203600
438 Ga0373933_0290573
439 Ga0373947_0470095
440 Ga0373937_0048657
441 Ga0373937_0484392
442 Ga0373925_0121091
443 Ga0436364_0527289
444 Ga0436365_0624204
445 Ga0436360_0416271
446 Ga0436360_0927162
447 Ga0436363_0147380
448 Ga0451804_0280906
449 Ga0450900_015421
450 Ga0466969_0057297
451 Ga0466966_0042727
452 Ga0466961_0101895
453 Ga0466964_0245557
454 Ga0466959_0042906
455 Ga0495603_0000267
456 Ga0495603_0019881
457 Ga0495603_0217683
458 Ga0495629_0015704
459 Ga0495629_0149810
460 Ga0495638_0015226
461 Ga0495638_0036251
462 Ga0495641_0137468
463 Ga0495639_0046321
464 Ga0495662_0085054
465 Ga0495584_0290396
466 Ga0495585_0082515
467 Ga0495594_0114318
468 Ga0495594_0189908
469 Ga0495594_0378817
470 Ga0495608_0403053
471 Ga0495643_0003961
472 Ga0495666_0043911
473 Ga0495645_0369309
474 Ga0495634_0599199
475 Ga0495611_0065561
476 Ga0495588_0015251
477 Ga0495623_0003021
478 Ga0495658_0020726
479 Ga0495613_0177941
480 Ga0495613_0517469
481 Ga0495670_0118312
482 Ga0495671_0112291
483 Ga0495589_0000529
484 Ga0495589_0000937
485 Ga0495589_0106818
486 Ga0495660_0219218
487 Ga0495604_0003192
488 Ga0495636_0053253
489 Ga0495676_0011241
490 Ga0495683_0093827
491 Ga0495683_0103402
492 Ga0495687_004235
493 Ga0495675_0010508
494 Ga0495675_0181625
495 Ga0495685_000725
496 Ga0495685_003392
497 Ga0495681_0004086
498 Ga0496100_1187039
499 Ga0496102_0754472
500 Ga0496103_0278018
501 Ga0496104_0009623
502 Ga0496105_0210597
503 Ga0496106_0001169
504 Ga0496108_0006623
505 Ga0496108_0726683
506 Ga0496109_0010253
507 Ga0496110_0008368
508 Ga0496111_0116186
509 Ga0496112_1094021
510 Ga0496117_0023127
511 Ga0496117_0044801
512 Ga0496118_0006686
513 Ga0496119_0037612
514 Ga0496119_0045600
515 Ga0496121_0000089
516 Ga0496121_0069076
517 Ga0496121_0091387
518 Ga0496121_0342078
519 Ga0496124_0008994
520 Ga0496125_0098285
521 Ga0496126_0008012
522 Ga0496126_0135043
523 Ga0496126_0146952
524 Ga0496126_0228020
525 Ga0501031_0263921
526 Ga0501034_0529419
527 Ga0501043_0588915
528 Ga0501047_0009927
529 Ga0501047_0089137
530 Ga0501047_0433470
531 Ga0501044_0269262
532 nmdc:mga03683_10981_c1
533 nmdc:mga03n38_382736_c1
534 nmdc:mga06z11_99226_c1
535 nmdc:mga04h51_162794_c1
536 nmdc:mga08y16_548222_c1
537 nmdc:mga08y16_98843_c1
538 nmdc:mga0n895_14355_c1
539 nmdc:mga0a205_2030_c1
540 nmdc:mga0sz30_1842_c1
541 Ga0500635_0101213
542 Ga0500578_0003040
543 Ga0500578_0288698
544 Ga0500646_0026743
545 Ga0500647_0030247
546 Ga0500651_0013691
547 Ga0500566_0024112
548 Ga0500566_0154498
549 Ga0500641_0020214
550 Ga0500654_008803
551 Ga0500556_0041824
552 Ga0500560_083584
553 Ga0500569_001933
554 Ga0500572_001640
555 Ga0500572_043419
556 Ga0500594_0162092
557 Ga0500621_060512
558 Ga0500628_001094
559 Ga0500652_007936
560 Ga0500658_0004609
561 Ga0500559_0000818
562 Ga0500577_0042151
563 Ga0500577_0110731
564 Ga0500600_0048724
565 Ga0500603_066453
566 Ga0500604_0025916
567 Ga0500616_0013495
568 Ga0500633_0001871
569 Ga0500634_0018265
570 Ga0500638_189507
571 Ga0500639_033666
572 Ga0500636_0014203
573 Ga0500637_0386664
574 Ga0500637_0535238
575 Ga0500576_044866
576 Ga0500656_000308
577 Ga0500601_015115
578 Ga0500587_001605
579 Ga0501084_0293529
580 2644523881
581 2644667977
582 2734975228
583 2862581749
584 2918508352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09347

DUF1989

Domain of unknown function (DUF1989)

18

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.8019 20 214
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.7647 17 217
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.7171 20 214
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.7041 17 217
4c0h-assembly2.cif.gz_A extended interface between pcf11p and clp1p and structural basis for atp loss in gly135arg point mutant 0.6281 27 197
ID Description Score Start End Superfamily
af_Q4DN69_1_81_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.663 22 214 2.60.120.1030
af_A4I5R9_1_86_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6538 27 194 2.60.120.1030
af_E7F3I6_19_100_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6453 24 217 2.60.120.1030
af_Q4DN69_1_81_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6417 22 214 2.60.120.1030
af_E7F3I6_19_100_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6384 24 217 2.60.120.1030
ID Description Score Start End GO Terms
AF-A0A1Y6JGH3-F1-model_v4 DUF1989 domain-containing protein 0.892 20 219
AF-A0A4V2XPN6-F1-model_v4 DUF1989 domain-containing protein 0.8878 20 219
AF-A0A2M9P8I4-F1-model_v4 DUF1989 domain-containing protein 0.8563 26 152
AF-A0LVE4-F1-model_v4 DUF1989 domain-containing protein 0.8548 16 217
AF-A0A258LXV5-F1-model_v4 Urea carboxylase 0.8544 26 152

Map