F390992

General Info

Members Datasets Scaffolds Average Seq Length
292 185 292 148

Family's Representative Sequence

Representative Sequence 3300027462|Ga0210000_1001701|Ga0210000_10017012
Length 178
Sequence MRLNTLKPAPGAKKDRHRVGRGVGSGWGKTAGRGHKGQRARSGGFHKVGFEGGQMPLHRRLPKRGFNSPTRDDVAEVRTGDLQTIEAAEIDLAALKAAGLVSRKALAAKVILSGKLERKVSLKEIRVSKGARSMIEAAGGSIQITEKPAAPKKARKEKNKAAPVDADEGAKGGEGAKA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 5.14
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10237014 3300005328 Bacteria 1212
2 Ga0070676_10439817 3300005328 Bacteria 915
3 Ga0070690_100189938 3300005330 Bacteria 1424
4 Ga0068869_100973987 3300005334 Bacteria 737
5 Ga0070682_100078799 3300005337 Bacteria 2126
6 Ga0070660_100207764 3300005339 Bacteria 1589
7 Ga0070689_100097369 3300005340 Bacteria 2326
8 Ga0070689_100125528 3300005340 Bacteria 2053
9 Ga0070687_100326076 3300005343 Bacteria 983
10 Ga0070687_100469491 3300005343 Bacteria 841
11 Ga0070661_100070251 3300005344 Bacteria 2575
12 Ga0070669_100038463 3300005353 Bacteria 3474
13 Ga0070675_100031603 3300005354 Bacteria 4281
14 Ga0070675_100197083 3300005354 Bacteria 1747
15 Ga0070671_100061543 3300005355 Bacteria 3126
16 Ga0070674_100013903 3300005356 Bacteria 4990
17 Ga0070674_100349690 3300005356 Bacteria 1193
18 Ga0070674_101396948 3300005356 Bacteria 627
19 Ga0070673_100135747 3300005364 Bacteria 2070
20 Ga0070673_100282831 3300005364 Bacteria 1455
21 Ga0070688_100103317 3300005365 Bacteria 1883
22 Ga0070667_100186508 3300005367 Bacteria 1836
23 Ga0070714_100028702 3300005435 Bacteria 4619
24 Ga0070714_100133425 3300005435 Bacteria 2221
25 Ga0070713_100562344 3300005436 Bacteria 1081
26 Ga0070711_100268682 3300005439 Bacteria 1345
27 Ga0070705_100003035 3300005440 Bacteria 8283
28 Ga0070705_100121047 3300005440 Bacteria 1690
29 Ga0070694_100076987 3300005444 Bacteria 2310
30 Ga0070694_100205360 3300005444 Bacteria 1470
31 Ga0070694_100470276 3300005444 Bacteria 996
32 Ga0070678_100014745 3300005456 Bacteria 4942
33 Ga0070678_100145064 3300005456 Bacteria 1904
34 Ga0070678_101865624 3300005456 Bacteria 567
35 Ga0070662_101191299 3300005457 Bacteria 655
36 Ga0070681_10001245 3300005458 Bacteria 22156
37 Ga0070681_10979396 3300005458 Unclassified 765
38 Ga0068867_102001635 3300005459 Bacteria 548
39 Ga0070685_10106861 3300005466 Bacteria 1718
40 Ga0070685_10132747 3300005466 Bacteria 1559
41 Ga0070685_11014244 3300005466 Bacteria 623
42 Ga0070706_100357515 3300005467 Bacteria 1361
43 Ga0070707_100386746 3300005468 Bacteria 1359
44 Ga0070707_100490797 3300005468 Bacteria 1190
45 Ga0070707_100719786 3300005468 Bacteria 961
46 Ga0070707_100738564 3300005468 Bacteria 947
47 Ga0070698_100279188 3300005471 Bacteria 1602
48 Ga0070699_100047515 3300005518 Bacteria 3714
49 Ga0070679_100525246 3300005530 Bacteria 1127
50 Ga0070679_101046273 3300005530 Bacteria 761
51 Ga0070679_101079593 3300005530 Unclassified 747
52 Ga0070697_100081928 3300005536 Bacteria 2659
53 Ga0068853_100595308 3300005539 Bacteria 1050
54 Ga0070686_100008053 3300005544 Bacteria 5887
55 Ga0070686_100032410 3300005544 Bacteria 3204
56 Ga0070695_100001266 3300005545 Bacteria 13913
57 Ga0070695_100145825 3300005545 Bacteria 1647
58 Ga0070695_101033044 3300005545 Bacteria 670
59 Ga0070696_100004428 3300005546 Bacteria 9371
60 Ga0070696_100148912 3300005546 Bacteria 1716
61 Ga0070696_100230801 3300005546 Bacteria 1392
62 Ga0070696_100791559 3300005546 Bacteria 780
63 Ga0070693_100156801 3300005547 Bacteria 1446
64 Ga0070665_100737808 3300005548 Bacteria 998
65 Ga0070704_100157332 3300005549 Bacteria 1794
66 Ga0070704_100444944 3300005549 Bacteria 1115
67 Ga0070664_100043698 3300005564 Bacteria 3782
68 Ga0068857_100018107 3300005577 Bacteria 6179
69 Ga0068857_100115674 3300005577 Bacteria 2413
70 Ga0068854_101565790 3300005578 Bacteria 600
71 Ga0068856_100211905 3300005614 Bacteria 1953
72 Ga0070702_100424640 3300005615 Bacteria 957
73 Ga0070702_100789881 3300005615 Bacteria 733
74 Ga0068859_100259559 3300005617 Bacteria 1828
75 Ga0068859_103018608 3300005617 Bacteria 514
76 Ga0068866_10101314 3300005718 Bacteria 1589
77 Ga0068861_101371111 3300005719 Bacteria 690
78 Ga0068870_10299886 3300005840 Bacteria 1014
79 Ga0068863_100523870 3300005841 Bacteria 1169
80 Ga0070715_10020627 3300006163 Bacteria 2544
81 Ga0070716_100348023 3300006173 Bacteria 1048
82 Ga0070716_100777943 3300006173 Bacteria 739
83 Ga0070716_101261444 3300006173 Bacteria 596
84 Ga0075362_10134088 3300006177 Bacteria 1180
85 Ga0097621_100001348 3300006237 Bacteria 16895
86 Ga0068871_100000763 3300006358 Bacteria 21687
87 Ga0068871_100954993 3300006358 Bacteria 797
88 Ga0075428_100494382 3300006844 Bacteria 1309
89 Ga0075430_100000579 3300006846 Bacteria 27829
90 Ga0075430_100363523 3300006846 Bacteria 1195
91 Ga0075431_100033449 3300006847 Bacteria 5298
92 Ga0075431_100580931 3300006847 Bacteria 1106
93 Ga0075433_10018168 3300006852 Bacteria 5840
94 Ga0075433_10651218 3300006852 Bacteria 924
95 Ga0075433_10890132 3300006852 Bacteria 777
96 Ga0075434_100000895 3300006871 Bacteria 23884
97 Ga0075434_100102926 3300006871 Bacteria 2863
98 Ga0075434_101160955 3300006871 Bacteria 785
99 Ga0068865_100259604 3300006881 Bacteria 1375
100 Ga0068865_100489046 3300006881 Bacteria 1024
101 Ga0075436_100002331 3300006914 Bacteria 13096
102 Ga0075436_100021757 3300006914 Bacteria 4401
103 Ga0097620_100259563 3300006931 Bacteria 1828
104 Ga0097620_103019280 3300006931 Bacteria 514
105 Ga0075435_100015133 3300007076 Bacteria 5791
106 Ga0075435_100115585 3300007076 Bacteria 2234
107 Ga0075435_100415110 3300007076 Bacteria 1159
108 Ga0075435_100677773 3300007076 Bacteria 895
109 Ga0075435_100822271 3300007076 Bacteria 809
110 Ga0099794_10020082 3300007265 Bacteria 3020
111 Ga0099794_10057533 3300007265 Bacteria 1884
112 Ga0111539_10204844 3300009094 Bacteria 2300
113 Ga0111539_11267859 3300009094 Bacteria 855
114 Ga0105245_10164075 3300009098 Bacteria 2110
115 Ga0105245_10286799 3300009098 Bacteria 1611
116 Ga0105245_11616326 3300009098 Bacteria 700
117 Ga0114129_10513170 3300009147 Bacteria 1564
118 Ga0114129_11525183 3300009147 Bacteria 820
119 Ga0105242_10500919 3300009176 Bacteria 1155
120 Ga0105242_11194767 3300009176 Bacteria 779
121 Ga0105248_10050767 3300009177 Bacteria 4652
122 Ga0105237_10936112 3300009545 Bacteria 873
123 Ga0105249_10618431 3300009553 Bacteria 1139
124 Ga0105239_13076412 3300010375 Bacteria 543
125 Ga0105246_11030147 3300011119 Bacteria 747
126 Ga0157373_10279442 3300013100 Bacteria 1183
127 Ga0157371_10589009 3300013102 Bacteria 827
128 Ga0157370_10003375 3300013104 Bacteria 18774
129 Ga0157378_10506662 3300013297 Bacteria 1206
130 Ga0157378_10599843 3300013297 Bacteria 1112
131 Ga0157375_10094247 3300013308 Bacteria 3062
132 Ga0157375_10224352 3300013308 Bacteria 2038
133 Ga0157375_10260554 3300013308 Bacteria 1895
134 Ga0157375_11047762 3300013308 Bacteria 953
135 Ga0157375_11747196 3300013308 Bacteria 737
136 Ga0157380_10052380 3300014326 Bacteria 3232
137 Ga0157376_10019067 3300014969 Bacteria 5277
138 Ga0157376_10555565 3300014969 Bacteria 1137
139 Ga0157376_12131433 3300014969 Bacteria 599
140 Ga0163161_10592393 3300017792 Bacteria 913
141 Ga0163161_11037269 3300017792 Bacteria 702
142 Ga0213872_10001745 3300021361 Bacteria 13647
143 Ga0207697_10436544 3300025315 Bacteria 581
144 Ga0207653_10106640 3300025885 Bacteria 996
145 Ga0207642_10949828 3300025899 Bacteria 552
146 Ga0207688_10015650 3300025901 Bacteria 4114
147 Ga0207645_10045884 3300025907 Bacteria 2792
148 Ga0207643_10425130 3300025908 Bacteria 842
149 Ga0207684_10199365 3300025910 Bacteria 1727
150 Ga0207707_10007445 3300025912 Bacteria 9539
151 Ga0207707_10835899 3300025912 Unclassified 765
152 Ga0207671_11038730 3300025914 Bacteria 645
153 Ga0207662_10092784 3300025918 Bacteria 1859
154 Ga0207662_10401884 3300025918 Bacteria 929
155 Ga0207657_10816904 3300025919 Bacteria 720
156 Ga0207649_10114226 3300025920 Bacteria 1809
157 Ga0207652_10169827 3300025921 Bacteria 1957
158 Ga0207652_10916168 3300025921 Unclassified 774
159 Ga0207646_10142712 3300025922 Bacteria 2157
160 Ga0207646_10431227 3300025922 Bacteria 1189
161 Ga0207646_10473574 3300025922 Bacteria 1129
162 Ga0207646_10944451 3300025922 Bacteria 764
163 Ga0207681_10241965 3300025923 Bacteria 1405
164 Ga0207650_10006120 3300025925 Bacteria 8199
165 Ga0207659_10149338 3300025926 Bacteria 1823
166 Ga0207659_10445573 3300025926 Bacteria 1090
167 Ga0207687_10058540 3300025927 Bacteria 2711
168 Ga0207687_10179695 3300025927 Bacteria 1638
169 Ga0207687_10206550 3300025927 Bacteria 1538
170 Ga0207700_10344195 3300025928 Bacteria 1297
171 Ga0207664_10031712 3300025929 Bacteria 4045
172 Ga0207664_10135511 3300025929 Bacteria 2077
173 Ga0207644_10053954 3300025931 Bacteria 2894
174 Ga0207690_10362471 3300025932 Bacteria 1148
175 Ga0207706_10427965 3300025933 Bacteria 1146
176 Ga0207670_10233066 3300025936 Bacteria 1415
177 Ga0207669_10007833 3300025937 Bacteria 4974
178 Ga0207669_10138198 3300025937 Bacteria 1687
179 Ga0207704_10422375 3300025938 Bacteria 1057
180 Ga0207665_10281735 3300025939 Bacteria 1237
181 Ga0207665_10497210 3300025939 Bacteria 942
182 Ga0207665_10705761 3300025939 Bacteria 793
183 Ga0207691_10139756 3300025940 Bacteria 2135
184 Ga0207689_10157161 3300025942 Bacteria 1874
185 Ga0207689_10218202 3300025942 Bacteria 1576
186 Ga0207689_10699987 3300025942 Bacteria 854
187 Ga0207679_10068038 3300025945 Bacteria 2674
188 Ga0207667_10840162 3300025949 Bacteria 913
189 Ga0207651_10347271 3300025960 Bacteria 1248
190 Ga0207639_10845715 3300026041 Bacteria 854
191 Ga0207702_10200542 3300026078 Bacteria 1849
192 Ga0207702_10357591 3300026078 Bacteria 1399
193 Ga0207702_10533780 3300026078 Bacteria 1146
194 Ga0207641_10496995 3300026088 Bacteria 1184
195 Ga0207648_10314449 3300026089 Bacteria 1406
196 Ga0207648_10874432 3300026089 Bacteria 839
197 Ga0207648_10954265 3300026089 Bacteria 802
198 Ga0207648_11356488 3300026089 Bacteria 668
199 Ga0207648_11515509 3300026089 Bacteria 630
200 Ga0207676_10544515 3300026095 Bacteria 1108
201 Ga0207676_12066302 3300026095 Bacteria 568
202 Ga0207674_10509549 3300026116 Bacteria 1162
203 Ga0207675_100231108 3300026118 Bacteria 1785
204 Ga0207675_100314852 3300026118 Bacteria 1527
205 Ga0207683_10019065 3300026121 Bacteria 5855
206 Ga0207698_11776969 3300026142 Bacteria 632
207 Ga0209967_1010175 3300027364 Bacteria 1309
208 Ga0209981_1006436 3300027378 Bacteria 1571
209 Ga0210000_1001701 3300027462 Bacteria 3107
210 Ga0209999_1022867 3300027543 Bacteria 1151
211 Ga0209971_1086004 3300027682 Bacteria 767
212 Ga0209966_1034641 3300027695 Bacteria 1034
213 Ga0268266_10464284 3300028379 Bacteria 1205
214 Ga0307408_100414332 3300031548 Bacteria 1160
215 Ga0307408_100512708 3300031548 Bacteria 1052
216 Ga0307405_10460846 3300031731 Bacteria 1010
217 Ga0307406_10456284 3300031901 Bacteria 1027
218 Ga0307407_10662915 3300031903 Bacteria 783
219 Ga0307412_11422357 3300031911 Bacteria 628
220 Ga0307409_100275430 3300031995 Bacteria 1552
221 Ga0307416_101667438 3300032002 Bacteria 742
222 Ga0373950_0045633 3300034818 Bacteria 849
223 Ga0373934_0201767 3300035086 Bacteria 819
224 Ga0373954_0000068 3300035118 Bacteria 37051
225 Ga0373931_0105793 3300035691 Bacteria 1589
226 Ga0373933_0003112 3300035724 Bacteria 9250
227 Ga0373937_0002051 3300036401 Bacteria 16843
228 Ga0395900_0046031 3300037418 Bacteria 4493
229 Ga0436361_0050017 3300039447 Bacteria 26618
230 Ga0436361_0407783 3300039447 Bacteria 4760
231 Ga0450923_041600 3300042125 Bacteria 967
232 Ga0439434_0063513 3300042435 Bacteria 1157
233 Ga0451577_0001289 3300042876 Bacteria 34481
234 Ga0451577_0166082 3300042876 Bacteria 1988
235 Ga0453684_0095396 3300044712 Bacteria 3656
236 Ga0453684_0700771 3300044712 Bacteria 1100
237 Ga0451576_0057203 3300045051 Bacteria 4076
238 Ga0451576_0694652 3300045051 Bacteria 1069
239 Ga0495608_0180805 3300046511 Bacteria 1334
240 Ga0495642_0175141 3300046528 Bacteria 933
241 Ga0495598_0005018 3300046537 Bacteria 2906
242 Ga0495609_0319002 3300046538 Bacteria 631
243 Ga0495621_0018191 3300046539 Bacteria 2279
244 Ga0495621_0037951 3300046539 Bacteria 1678
245 Ga0495667_0215707 3300046559 Bacteria 1226
246 Ga0495659_0091635 3300046664 Bacteria 1168
247 Ga0495669_0077100 3300046684 Bacteria 1526
248 Ga0495589_0176053 3300046794 Bacteria 1016
249 Ga0496100_0361307 3300048903 Bacteria 1099
250 Ga0496101_0082387 3300048904 Bacteria 2381
251 Ga0496102_0073818 3300048905 Bacteria 3135
252 Ga0496105_0777296 3300048908 Bacteria 730
253 Ga0496106_1030977 3300048909 Bacteria 646
254 Ga0496107_0752648 3300048910 Bacteria 715
255 Ga0496108_0546694 3300048911 Bacteria 1010
256 Ga0496108_0559397 3300048911 Bacteria 997
257 Ga0496108_0714657 3300048911 Bacteria 868
258 Ga0496109_0181221 3300048912 Bacteria 1978
259 Ga0496109_0205494 3300048912 Bacteria 1852
260 Ga0496111_0606926 3300048914 Bacteria 801
261 Ga0496111_0920431 3300048914 Bacteria 629
262 Ga0496113_0126248 3300048916 Bacteria 2004
263 Ga0496114_0017684 3300048917 Bacteria 5758
264 Ga0501034_0054387 3300049571 Bacteria 4030
265 Ga0501036_0152508 3300049572 Bacteria 1949
266 Ga0501036_0866678 3300049572 Bacteria 742
267 Ga0501038_0044437 3300049574 Bacteria 3859
268 Ga0501039_1339543 3300049575 Bacteria 552
269 Ga0501040_0004087 3300049576 Bacteria 9485
270 Ga0501048_0581684 3300049582 Bacteria 804
271 Ga0501072_0642324 3300049588 Bacteria 836
272 Ga0501072_1117759 3300049588 Bacteria 613
273 Ga0501283_058074 3300049779 Bacteria 695
274 nmdc:mga03683_305180_c1 3300050489 Bacteria 747
275 nmdc:mga09592_319306_c1 3300050508 Bacteria 1345
276 nmdc:mga0qj67_1458_c1 3300050509 Bacteria 16584
277 nmdc:mga0qj67_418260_c1 3300050509 Bacteria 1081
278 nmdc:mga06r32_49740_c1 3300050510 Bacteria 4010
279 nmdc:mga0n895_1512541_c1 3300050512 Bacteria 637
280 nmdc:mga0n895_534271_c1 3300050512 Bacteria 1179
281 nmdc:mga0n895_570_c1 3300050512 Bacteria 25297
282 nmdc:mga0rr50_1083281_c1 3300050513 Bacteria 682
283 nmdc:mga0rr50_112452_c1 3300050513 Bacteria 2157
284 nmdc:mga0rr50_292514_c1 3300050513 Bacteria 1361
285 nmdc:mga0rr50_33874_c1 3300050513 Bacteria 3653
286 nmdc:mga0rr50_662405_c1 3300050513 Bacteria 891
287 nmdc:mga0rr50_74236_c1 3300050513 Bacteria 2602
288 nmdc:mga08x19_20089_c1 3300050514 Bacteria 4111
289 nmdc:mga08x19_340617_c1 3300050514 Bacteria 1046
290 nmdc:mga08x19_64591_c1 3300050514 Bacteria 2376
291 nmdc:mga0a205_110473_c1 3300050515 Bacteria 2648
292 nmdc:mga0a205_48126_c1 3300050515 Bacteria 4115

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10874432 Ga0207648_108744322 117
2 3300032002 Ga0307416_101667438 Ga0307416_1016674382 117
3 3300005467 Ga0070706_100357515 Ga0070706_1003575152 123
4 3300005468 Ga0070707_100719786 Ga0070707_1007197862 123
5 3300005471 Ga0070698_100279188 Ga0070698_1002791883 123
6 3300025910 Ga0207684_10199365 Ga0207684_101993654 123
7 3300025922 Ga0207646_10944451 Ga0207646_109444512 123
8 3300049574 Ga0501038_0044437 Ga0501038_0044437_1586_2017 125
9 3300050512 nmdc:mga0n895_1512541_c1 nmdc:mga0n895_1512541_c1_218_595 125
10 3300039447 Ga0436361_0407783 Ga0436361_0407783_3231_3665 126
11 3300009553 Ga0105249_10618431 Ga0105249_106184311 130
12 3300013102 Ga0157371_10589009 Ga0157371_105890093 130
13 3300025921 Ga0207652_10169827 Ga0207652_101698272 130
14 3300026041 Ga0207639_10845715 Ga0207639_108457152 130
15 3300005337 Ga0070682_100078799 Ga0070682_1000787994 131
16 3300005339 Ga0070660_100207764 Ga0070660_1002077642 131
17 3300005435 Ga0070714_100028702 Ga0070714_1000287022 131
18 3300005457 Ga0070662_101191299 Ga0070662_1011912991 131
19 3300005459 Ga0068867_102001635 Ga0068867_1020016351 131
20 3300005546 Ga0070696_100230801 Ga0070696_1002308012 131
21 3300009094 Ga0111539_11267859 Ga0111539_112678592 131
22 3300010375 Ga0105239_13076412 Ga0105239_130764121 131
23 3300013100 Ga0157373_10279442 Ga0157373_102794422 131
24 3300013104 Ga0157370_10003375 Ga0157370_1000337522 131
25 3300021361 Ga0213872_10001745 Ga0213872_100017456 131
26 3300025919 Ga0207657_10816904 Ga0207657_108169042 131
27 3300025929 Ga0207664_10031712 Ga0207664_100317124 131
28 3300025933 Ga0207706_10427965 Ga0207706_104279651 131
29 3300026078 Ga0207702_10533780 Ga0207702_105337801 131
30 3300037418 Ga0395900_0046031 Ga0395900_0046031_3929_4360 131
31 3300039447 Ga0436361_0050017 Ga0436361_0050017_17022_17453 131
32 3300048911 Ga0496108_0559397 Ga0496108_0559397_296_727 131
33 3300048912 Ga0496109_0181221 Ga0496109_0181221_282_713 131
34 3300048916 Ga0496113_0126248 Ga0496113_0126248_1282_1713 131
35 3300049571 Ga0501034_0054387 Ga0501034_0054387_850_1281 131
36 3300049572 Ga0501036_0152508 Ga0501036_0152508_514_945 131
37 3300005343 Ga0070687_100326076 Ga0070687_1003260762 132
38 3300005344 Ga0070661_100070251 Ga0070661_1000702513 132
39 3300005353 Ga0070669_100038463 Ga0070669_1000384637 132
40 3300005354 Ga0070675_100197083 Ga0070675_1001970833 132
41 3300005355 Ga0070671_100061543 Ga0070671_1000615435 132
42 3300005356 Ga0070674_101396948 Ga0070674_1013969482 132
43 3300005364 Ga0070673_100282831 Ga0070673_1002828313 132
44 3300005365 Ga0070688_100103317 Ga0070688_1001033174 132
45 3300005367 Ga0070667_100186508 Ga0070667_1001865082 132
46 3300005456 Ga0070678_100014745 Ga0070678_1000147459 132
47 3300005466 Ga0070685_10106861 Ga0070685_101068614 132
48 3300005564 Ga0070664_100043698 Ga0070664_1000436985 132
49 3300005840 Ga0068870_10299886 Ga0068870_102998862 132
50 3300005841 Ga0068863_100523870 Ga0068863_1005238702 132
51 3300006358 Ga0068871_100954993 Ga0068871_1009549931 132
52 3300006871 Ga0075434_101160955 Ga0075434_1011609552 132
53 3300006881 Ga0068865_100259604 Ga0068865_1002596043 132
54 3300007076 Ga0075435_100822271 Ga0075435_1008222711 132
55 3300009094 Ga0111539_10204844 Ga0111539_102048446 132
56 3300009176 Ga0105242_10500919 Ga0105242_105009192 132
57 3300009177 Ga0105248_10050767 Ga0105248_100507672 132
58 3300011119 Ga0105246_11030147 Ga0105246_110301472 132
59 3300013297 Ga0157378_10599843 Ga0157378_105998431 132
60 3300013308 Ga0157375_10260554 Ga0157375_102605545 132
61 3300014326 Ga0157380_10052380 Ga0157380_100523802 132
62 3300014969 Ga0157376_10555565 Ga0157376_105555653 132
63 3300017792 Ga0163161_10592393 Ga0163161_105923932 132
64 3300025908 Ga0207643_10425130 Ga0207643_104251303 132
65 3300025920 Ga0207649_10114226 Ga0207649_101142262 132
66 3300025925 Ga0207650_10006120 Ga0207650_100061208 132
67 3300025926 Ga0207659_10149338 Ga0207659_101493382 132
68 3300025931 Ga0207644_10053954 Ga0207644_100539545 132
69 3300025937 Ga0207669_10138198 Ga0207669_101381981 132
70 3300025940 Ga0207691_10139756 Ga0207691_101397563 132
71 3300025945 Ga0207679_10068038 Ga0207679_100680383 132
72 3300026088 Ga0207641_10496995 Ga0207641_104969952 132
73 3300026118 Ga0207675_100314852 Ga0207675_1003148523 132
74 3300026121 Ga0207683_10019065 Ga0207683_1001906511 132
75 3300046539 Ga0495621_0037951 Ga0495621_0037951_22_480 132
76 3300046794 Ga0495589_0176053 Ga0495589_0176053_323_781 132
77 3300050508 nmdc:mga09592_319306_c1 nmdc:mga09592_319306_c1_119_577 132
78 3300050513 nmdc:mga0rr50_1083281_c1 nmdc:mga0rr50_1083281_c1_188_646 132
79 3300014969 Ga0157376_12131433 Ga0157376_121314331 133
80 3300017792 Ga0163161_11037269 Ga0163161_110372692 133
81 3300048903 Ga0496100_0361307 Ga0496100_0361307_237_680 133
82 3300048904 Ga0496101_0082387 Ga0496101_0082387_1802_2245 133
83 3300048909 Ga0496106_1030977 Ga0496106_1030977_168_611 133
84 3300048911 Ga0496108_0714657 Ga0496108_0714657_259_702 133
85 3300048917 Ga0496114_0017684 Ga0496114_0017684_3146_3589 133
86 3300005440 Ga0070705_100121047 Ga0070705_1001210472 134
87 3300013308 Ga0157375_10094247 Ga0157375_100942475 134
88 3300026095 Ga0207676_12066302 Ga0207676_120663021 134
89 3300048914 Ga0496111_0606926 Ga0496111_0606926_126_626 134
90 3300027682 Ga0209971_1086004 Ga0209971_10860042 138
91 3300007265 Ga0099794_10020082 Ga0099794_100200827 139
92 3300025885 Ga0207653_10106640 Ga0207653_101066402 140
93 3300005615 Ga0070702_100424640 Ga0070702_1004246402 141
94 3300005435 Ga0070714_100133425 Ga0070714_1001334254 143
95 3300005436 Ga0070713_100562344 Ga0070713_1005623443 143
96 3300005545 Ga0070695_101033044 Ga0070695_1010330442 143
97 3300025929 Ga0207664_10135511 Ga0207664_101355114 143
98 3300025939 Ga0207665_10497210 Ga0207665_104972102 143
99 3300044712 Ga0453684_0700771 Ga0453684_0700771_231_668 143
100 3300049582 Ga0501048_0581684 Ga0501048_0581684_73_507 143
101 3300006852 Ga0075433_10651218 Ga0075433_106512182 144
102 3300006852 Ga0075433_10890132 Ga0075433_108901322 144
103 3300006914 Ga0075436_100002331 Ga0075436_10000233123 144
104 3300007076 Ga0075435_100677773 Ga0075435_1006777733 144
105 3300042876 Ga0451577_0166082 Ga0451577_0166082_1119_1685 144
106 3300044712 Ga0453684_0095396 Ga0453684_0095396_377_943 144
107 3300048908 Ga0496105_0777296 Ga0496105_0777296_16_450 144
108 3300050513 nmdc:mga0rr50_662405_c1 nmdc:mga0rr50_662405_c1_255_776 144
109 3300050514 nmdc:mga08x19_64591_c1 nmdc:mga08x19_64591_c1_373_885 144
110 3300050515 nmdc:mga0a205_110473_c1 nmdc:mga0a205_110473_c1_1535_2050 144
111 3300005334 Ga0068869_100973987 Ga0068869_1009739871 145
112 3300005440 Ga0070705_100003035 Ga0070705_10000303510 145
113 3300005456 Ga0070678_101865624 Ga0070678_1018656241 145
114 3300005468 Ga0070707_100490797 Ga0070707_1004907972 145
115 3300005546 Ga0070696_100004428 Ga0070696_10000442818 145
116 3300005548 Ga0070665_100737808 Ga0070665_1007378082 145
117 3300005549 Ga0070704_100444944 Ga0070704_1004449442 145
118 3300006847 Ga0075431_100580931 Ga0075431_1005809312 145
119 3300006914 Ga0075436_100021757 Ga0075436_1000217573 145
120 3300009098 Ga0105245_10164075 Ga0105245_101640752 145
121 3300013308 Ga0157375_11047762 Ga0157375_110477622 145
122 3300025922 Ga0207646_10431227 Ga0207646_104312273 145
123 3300025927 Ga0207687_10058540 Ga0207687_100585402 145
124 3300025942 Ga0207689_10699987 Ga0207689_106999872 145
125 3300026142 Ga0207698_11776969 Ga0207698_117769692 145
126 3300028379 Ga0268266_10464284 Ga0268266_104642842 145
127 3300035086 Ga0373934_0201767 Ga0373934_0201767_92_613 145
128 3300050513 nmdc:mga0rr50_74236_c1 nmdc:mga0rr50_74236_c1_508_1026 145
129 3300050514 nmdc:mga08x19_20089_c1 nmdc:mga08x19_20089_c1_3322_3840 145
130 3300005328 Ga0070676_10237014 Ga0070676_102370143 146
131 3300005328 Ga0070676_10439817 Ga0070676_104398173 146
132 3300005330 Ga0070690_100189938 Ga0070690_1001899383 146
133 3300005340 Ga0070689_100097369 Ga0070689_1000973692 146
134 3300005340 Ga0070689_100125528 Ga0070689_1001255284 146
135 3300005343 Ga0070687_100469491 Ga0070687_1004694912 146
136 3300005354 Ga0070675_100031603 Ga0070675_1000316037 146
137 3300005356 Ga0070674_100013903 Ga0070674_1000139034 146
138 3300005356 Ga0070674_100349690 Ga0070674_1003496902 146
139 3300005364 Ga0070673_100135747 Ga0070673_1001357472 146
140 3300005439 Ga0070711_100268682 Ga0070711_1002686823 146
141 3300005444 Ga0070694_100076987 Ga0070694_1000769874 146
142 3300005444 Ga0070694_100205360 Ga0070694_1002053602 146
143 3300005444 Ga0070694_100470276 Ga0070694_1004702763 146
144 3300005456 Ga0070678_100145064 Ga0070678_1001450642 146
145 3300005458 Ga0070681_10001245 Ga0070681_1000124522 146
146 3300005458 Ga0070681_10979396 Ga0070681_109793961 146
147 3300005466 Ga0070685_10132747 Ga0070685_101327472 146
148 3300005466 Ga0070685_11014244 Ga0070685_110142441 146
149 3300005468 Ga0070707_100386746 Ga0070707_1003867461 146
150 3300005468 Ga0070707_100738564 Ga0070707_1007385641 146
151 3300005518 Ga0070699_100047515 Ga0070699_1000475156 146
152 3300005530 Ga0070679_100525246 Ga0070679_1005252462 146
153 3300005530 Ga0070679_101046273 Ga0070679_1010462732 146
154 3300005530 Ga0070679_101079593 Ga0070679_1010795931 146
155 3300005536 Ga0070697_100081928 Ga0070697_1000819282 146
156 3300005539 Ga0068853_100595308 Ga0068853_1005953082 146
157 3300005544 Ga0070686_100008053 Ga0070686_10000805314 146
158 3300005544 Ga0070686_100032410 Ga0070686_1000324105 146
159 3300005545 Ga0070695_100001266 Ga0070695_10000126622 146
160 3300005545 Ga0070695_100145825 Ga0070695_1001458252 146
161 3300005546 Ga0070696_100148912 Ga0070696_1001489122 146
162 3300005546 Ga0070696_100791559 Ga0070696_1007915592 146
163 3300005547 Ga0070693_100156801 Ga0070693_1001568013 146
164 3300005549 Ga0070704_100157332 Ga0070704_1001573322 146
165 3300005577 Ga0068857_100018107 Ga0068857_1000181076 146
166 3300005577 Ga0068857_100115674 Ga0068857_1001156745 146
167 3300005578 Ga0068854_101565790 Ga0068854_1015657901 146
168 3300005614 Ga0068856_100211905 Ga0068856_1002119052 146
169 3300005615 Ga0070702_100789881 Ga0070702_1007898812 146
170 3300005617 Ga0068859_100259559 Ga0068859_1002595593 146
171 3300005617 Ga0068859_103018608 Ga0068859_1030186081 146
172 3300005718 Ga0068866_10101314 Ga0068866_101013142 146
173 3300005719 Ga0068861_101371111 Ga0068861_1013711111 146
174 3300006163 Ga0070715_10020627 Ga0070715_100206273 146
175 3300006173 Ga0070716_100348023 Ga0070716_1003480231 146
176 3300006173 Ga0070716_100777943 Ga0070716_1007779432 146
177 3300006173 Ga0070716_101261444 Ga0070716_1012614441 146
178 3300006177 Ga0075362_10134088 Ga0075362_101340882 146
179 3300006237 Ga0097621_100001348 Ga0097621_10000134812 146
180 3300006358 Ga0068871_100000763 Ga0068871_10000076320 146
181 3300006844 Ga0075428_100494382 Ga0075428_1004943821 146
182 3300006846 Ga0075430_100000579 Ga0075430_10000057922 146
183 3300006846 Ga0075430_100363523 Ga0075430_1003635232 146
184 3300006847 Ga0075431_100033449 Ga0075431_1000334498 146
185 3300006852 Ga0075433_10018168 Ga0075433_100181686 146
186 3300006871 Ga0075434_100000895 Ga0075434_10000089517 146
187 3300006871 Ga0075434_100102926 Ga0075434_1001029266 146
188 3300006881 Ga0068865_100489046 Ga0068865_1004890462 146
189 3300006931 Ga0097620_100259563 Ga0097620_1002595633 146
190 3300006931 Ga0097620_103019280 Ga0097620_1030192801 146
191 3300007076 Ga0075435_100015133 Ga0075435_1000151337 146
192 3300007076 Ga0075435_100115585 Ga0075435_1001155853 146
193 3300007076 Ga0075435_100415110 Ga0075435_1004151102 146
194 3300007265 Ga0099794_10057533 Ga0099794_100575334 146
195 3300009098 Ga0105245_10286799 Ga0105245_102867993 146
196 3300009098 Ga0105245_11616326 Ga0105245_116163261 146
197 3300009147 Ga0114129_10513170 Ga0114129_105131702 146
198 3300009147 Ga0114129_11525183 Ga0114129_115251832 146
199 3300009176 Ga0105242_11194767 Ga0105242_111947672 146
200 3300009545 Ga0105237_10936112 Ga0105237_109361122 146
201 3300013297 Ga0157378_10506662 Ga0157378_105066623 146
202 3300013308 Ga0157375_10224352 Ga0157375_102243522 146
203 3300013308 Ga0157375_11747196 Ga0157375_117471962 146
204 3300014969 Ga0157376_10019067 Ga0157376_100190678 146
205 3300025315 Ga0207697_10436544 Ga0207697_104365441 146
206 3300025899 Ga0207642_10949828 Ga0207642_109498282 146
207 3300025901 Ga0207688_10015650 Ga0207688_100156503 146
208 3300025907 Ga0207645_10045884 Ga0207645_100458842 146
209 3300025912 Ga0207707_10007445 Ga0207707_100074457 146
210 3300025912 Ga0207707_10835899 Ga0207707_108358991 146
211 3300025914 Ga0207671_11038730 Ga0207671_110387302 146
212 3300025918 Ga0207662_10092784 Ga0207662_100927842 146
213 3300025918 Ga0207662_10401884 Ga0207662_104018841 146
214 3300025921 Ga0207652_10916168 Ga0207652_109161682 146
215 3300025922 Ga0207646_10142712 Ga0207646_101427125 146
216 3300025922 Ga0207646_10473574 Ga0207646_104735742 146
217 3300025923 Ga0207681_10241965 Ga0207681_102419652 146
218 3300025926 Ga0207659_10445573 Ga0207659_104455733 146
219 3300025927 Ga0207687_10179695 Ga0207687_101796953 146
220 3300025927 Ga0207687_10206550 Ga0207687_102065502 146
221 3300025928 Ga0207700_10344195 Ga0207700_103441953 146
222 3300025932 Ga0207690_10362471 Ga0207690_103624712 146
223 3300025936 Ga0207670_10233066 Ga0207670_102330663 146
224 3300025937 Ga0207669_10007833 Ga0207669_100078338 146
225 3300025938 Ga0207704_10422375 Ga0207704_104223753 146
226 3300025939 Ga0207665_10281735 Ga0207665_102817352 146
227 3300025939 Ga0207665_10705761 Ga0207665_107057612 146
228 3300025942 Ga0207689_10157161 Ga0207689_101571613 146
229 3300025942 Ga0207689_10218202 Ga0207689_102182022 146
230 3300025949 Ga0207667_10840162 Ga0207667_108401622 146
231 3300025960 Ga0207651_10347271 Ga0207651_103472713 146
232 3300026078 Ga0207702_10200542 Ga0207702_102005422 146
233 3300026078 Ga0207702_10357591 Ga0207702_103575912 146
234 3300026089 Ga0207648_10314449 Ga0207648_103144492 146
235 3300026089 Ga0207648_10954265 Ga0207648_109542651 146
236 3300026089 Ga0207648_11356488 Ga0207648_113564882 146
237 3300026089 Ga0207648_11515509 Ga0207648_115155092 146
238 3300026095 Ga0207676_10544515 Ga0207676_105445153 146
239 3300026116 Ga0207674_10509549 Ga0207674_105095492 146
240 3300026118 Ga0207675_100231108 Ga0207675_1002311084 146
241 3300027364 Ga0209967_1010175 Ga0209967_10101752 146
242 3300027378 Ga0209981_1006436 Ga0209981_10064363 146
243 3300027462 Ga0210000_1001701 Ga0210000_10017012 146
244 3300027543 Ga0209999_1022867 Ga0209999_10228673 146
245 3300027695 Ga0209966_1034641 Ga0209966_10346412 146
246 3300031548 Ga0307408_100414332 Ga0307408_1004143322 146
247 3300031548 Ga0307408_100512708 Ga0307408_1005127082 146
248 3300031731 Ga0307405_10460846 Ga0307405_104608462 146
249 3300031901 Ga0307406_10456284 Ga0307406_104562841 146
250 3300031903 Ga0307407_10662915 Ga0307407_106629151 146
251 3300031911 Ga0307412_11422357 Ga0307412_114223571 146
252 3300031995 Ga0307409_100275430 Ga0307409_1002754303 146
253 3300034818 Ga0373950_0045633 Ga0373950_0045633_134_586 146
254 3300035118 Ga0373954_0000068 Ga0373954_0000068_27049_27576 146
255 3300035691 Ga0373931_0105793 Ga0373931_0105793_835_1371 146
256 3300035724 Ga0373933_0003112 Ga0373933_0003112_7968_8495 146
257 3300036401 Ga0373937_0002051 Ga0373937_0002051_5270_5797 146
258 3300042125 Ga0450923_041600 Ga0450923_041600_136_669 146
259 3300042435 Ga0439434_0063513 Ga0439434_0063513_345_881 146
260 3300042876 Ga0451577_0001289 Ga0451577_0001289_32164_32643 146
261 3300045051 Ga0451576_0057203 Ga0451576_0057203_474_1025 146
262 3300045051 Ga0451576_0694652 Ga0451576_0694652_302_817 146
263 3300046511 Ga0495608_0180805 Ga0495608_0180805_553_1080 146
264 3300046528 Ga0495642_0175141 Ga0495642_0175141_28_561 146
265 3300046537 Ga0495598_0005018 Ga0495598_0005018_520_1038 146
266 3300046538 Ga0495609_0319002 Ga0495609_0319002_148_618 146
267 3300046539 Ga0495621_0018191 Ga0495621_0018191_1277_1795 146
268 3300046559 Ga0495667_0215707 Ga0495667_0215707_226_753 146
269 3300046664 Ga0495659_0091635 Ga0495659_0091635_111_641 146
270 3300046684 Ga0495669_0077100 Ga0495669_0077100_478_1011 146
271 3300048905 Ga0496102_0073818 Ga0496102_0073818_179_619 146
272 3300048910 Ga0496107_0752648 Ga0496107_0752648_50_490 146
273 3300048911 Ga0496108_0546694 Ga0496108_0546694_383_823 146
274 3300048912 Ga0496109_0205494 Ga0496109_0205494_85_525 146
275 3300048914 Ga0496111_0920431 Ga0496111_0920431_45_485 146
276 3300049572 Ga0501036_0866678 Ga0501036_0866678_54_566 146
277 3300049575 Ga0501039_1339543 Ga0501039_1339543_31_537 146
278 3300049576 Ga0501040_0004087 Ga0501040_0004087_6989_7522 146
279 3300049588 Ga0501072_0642324 Ga0501072_0642324_139_651 146
280 3300049588 Ga0501072_1117759 Ga0501072_1117759_58_591 146
281 3300049779 Ga0501283_058074 Ga0501283_058074_91_633 146
282 3300050489 nmdc:mga03683_305180_c1 nmdc:mga03683_305180_c1_130_666 146
283 3300050509 nmdc:mga0qj67_1458_c1 nmdc:mga0qj67_1458_c1_11668_12201 146
284 3300050509 nmdc:mga0qj67_418260_c1 nmdc:mga0qj67_418260_c1_524_1042 146
285 3300050510 nmdc:mga06r32_49740_c1 nmdc:mga06r32_49740_c1_1609_2121 146
286 3300050512 nmdc:mga0n895_534271_c1 nmdc:mga0n895_534271_c1_104_649 146
287 3300050512 nmdc:mga0n895_570_c1 nmdc:mga0n895_570_c1_15435_15947 146
288 3300050513 nmdc:mga0rr50_112452_c1 nmdc:mga0rr50_112452_c1_519_1046 146
289 3300050513 nmdc:mga0rr50_292514_c1 nmdc:mga0rr50_292514_c1_606_1172 146
290 3300050513 nmdc:mga0rr50_33874_c1 nmdc:mga0rr50_33874_c1_341_853 146
291 3300050514 nmdc:mga08x19_340617_c1 nmdc:mga08x19_340617_c1_448_978 146
292 3300050515 nmdc:mga0a205_48126_c1 nmdc:mga0a205_48126_c1_536_1063 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

27

143

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.8158 75 142
8hl5-assembly1.cif.gz_L18E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8087 77 144
7am2-assembly1.cif.gz_G intermediate assembly of the large subunit from leishmania major mitochondrial ribosome 0.7709 76 144
6zu5-assembly1.cif.gz_LQ0 structure of the paranosema locustae ribosome in complex with lso2 0.7522 76 144
6hix-assembly1.cif.gz_AP cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.7461 74 142
ID Description Score Start End Superfamily
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9602 76 144 3.100.10.10
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9341 76 144 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8958 76 144 3.100.10.10
af_Q9Y7M5_108_185_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8718 77 143 3.100.10.10
af_Q8ILG7_161_247_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8681 74 146 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A080LUN8-F1-model_v4 50S ribosomal protein L15 1.003 74 144 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4Q3ZTU2-F1-model_v4 deleted 0.9907 73 143
AF-A0A661D962-F1-model_v4 50S ribosomal protein L15 0.9895 73 144 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-D4DRP2-F1-model_v4 50S ribosomal protein L15 0.9872 73 144 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A523MHP9-F1-model_v4 50S ribosomal protein L15 0.9784 87 144 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
77.37 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map