F390992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 185 | 292 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300027462|Ga0210000_1001701|Ga0210000_10017012 |
| Length | 178 |
| Sequence | MRLNTLKPAPGAKKDRHRVGRGVGSGWGKTAGRGHKGQRARSGGFHKVGFEGGQMPLHRRLPKRGFNSPTRDDVAEVRTGDLQTIEAAEIDLAALKAAGLVSRKALAAKVILSGKLERKVSLKEIRVSKGARSMIEAAGGSIQITEKPAAPKKARKEKNKAAPVDADEGAKGGEGAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 146 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 178 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.68 |
| Nodule | 0 |
| Rhizoplane | 5.14 |
| Rhizosphere | 94.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10237014 | 3300005328 | Bacteria | 1212 |
| 2 | Ga0070676_10439817 | 3300005328 | Bacteria | 915 |
| 3 | Ga0070690_100189938 | 3300005330 | Bacteria | 1424 |
| 4 | Ga0068869_100973987 | 3300005334 | Bacteria | 737 |
| 5 | Ga0070682_100078799 | 3300005337 | Bacteria | 2126 |
| 6 | Ga0070660_100207764 | 3300005339 | Bacteria | 1589 |
| 7 | Ga0070689_100097369 | 3300005340 | Bacteria | 2326 |
| 8 | Ga0070689_100125528 | 3300005340 | Bacteria | 2053 |
| 9 | Ga0070687_100326076 | 3300005343 | Bacteria | 983 |
| 10 | Ga0070687_100469491 | 3300005343 | Bacteria | 841 |
| 11 | Ga0070661_100070251 | 3300005344 | Bacteria | 2575 |
| 12 | Ga0070669_100038463 | 3300005353 | Bacteria | 3474 |
| 13 | Ga0070675_100031603 | 3300005354 | Bacteria | 4281 |
| 14 | Ga0070675_100197083 | 3300005354 | Bacteria | 1747 |
| 15 | Ga0070671_100061543 | 3300005355 | Bacteria | 3126 |
| 16 | Ga0070674_100013903 | 3300005356 | Bacteria | 4990 |
| 17 | Ga0070674_100349690 | 3300005356 | Bacteria | 1193 |
| 18 | Ga0070674_101396948 | 3300005356 | Bacteria | 627 |
| 19 | Ga0070673_100135747 | 3300005364 | Bacteria | 2070 |
| 20 | Ga0070673_100282831 | 3300005364 | Bacteria | 1455 |
| 21 | Ga0070688_100103317 | 3300005365 | Bacteria | 1883 |
| 22 | Ga0070667_100186508 | 3300005367 | Bacteria | 1836 |
| 23 | Ga0070714_100028702 | 3300005435 | Bacteria | 4619 |
| 24 | Ga0070714_100133425 | 3300005435 | Bacteria | 2221 |
| 25 | Ga0070713_100562344 | 3300005436 | Bacteria | 1081 |
| 26 | Ga0070711_100268682 | 3300005439 | Bacteria | 1345 |
| 27 | Ga0070705_100003035 | 3300005440 | Bacteria | 8283 |
| 28 | Ga0070705_100121047 | 3300005440 | Bacteria | 1690 |
| 29 | Ga0070694_100076987 | 3300005444 | Bacteria | 2310 |
| 30 | Ga0070694_100205360 | 3300005444 | Bacteria | 1470 |
| 31 | Ga0070694_100470276 | 3300005444 | Bacteria | 996 |
| 32 | Ga0070678_100014745 | 3300005456 | Bacteria | 4942 |
| 33 | Ga0070678_100145064 | 3300005456 | Bacteria | 1904 |
| 34 | Ga0070678_101865624 | 3300005456 | Bacteria | 567 |
| 35 | Ga0070662_101191299 | 3300005457 | Bacteria | 655 |
| 36 | Ga0070681_10001245 | 3300005458 | Bacteria | 22156 |
| 37 | Ga0070681_10979396 | 3300005458 | Unclassified | 765 |
| 38 | Ga0068867_102001635 | 3300005459 | Bacteria | 548 |
| 39 | Ga0070685_10106861 | 3300005466 | Bacteria | 1718 |
| 40 | Ga0070685_10132747 | 3300005466 | Bacteria | 1559 |
| 41 | Ga0070685_11014244 | 3300005466 | Bacteria | 623 |
| 42 | Ga0070706_100357515 | 3300005467 | Bacteria | 1361 |
| 43 | Ga0070707_100386746 | 3300005468 | Bacteria | 1359 |
| 44 | Ga0070707_100490797 | 3300005468 | Bacteria | 1190 |
| 45 | Ga0070707_100719786 | 3300005468 | Bacteria | 961 |
| 46 | Ga0070707_100738564 | 3300005468 | Bacteria | 947 |
| 47 | Ga0070698_100279188 | 3300005471 | Bacteria | 1602 |
| 48 | Ga0070699_100047515 | 3300005518 | Bacteria | 3714 |
| 49 | Ga0070679_100525246 | 3300005530 | Bacteria | 1127 |
| 50 | Ga0070679_101046273 | 3300005530 | Bacteria | 761 |
| 51 | Ga0070679_101079593 | 3300005530 | Unclassified | 747 |
| 52 | Ga0070697_100081928 | 3300005536 | Bacteria | 2659 |
| 53 | Ga0068853_100595308 | 3300005539 | Bacteria | 1050 |
| 54 | Ga0070686_100008053 | 3300005544 | Bacteria | 5887 |
| 55 | Ga0070686_100032410 | 3300005544 | Bacteria | 3204 |
| 56 | Ga0070695_100001266 | 3300005545 | Bacteria | 13913 |
| 57 | Ga0070695_100145825 | 3300005545 | Bacteria | 1647 |
| 58 | Ga0070695_101033044 | 3300005545 | Bacteria | 670 |
| 59 | Ga0070696_100004428 | 3300005546 | Bacteria | 9371 |
| 60 | Ga0070696_100148912 | 3300005546 | Bacteria | 1716 |
| 61 | Ga0070696_100230801 | 3300005546 | Bacteria | 1392 |
| 62 | Ga0070696_100791559 | 3300005546 | Bacteria | 780 |
| 63 | Ga0070693_100156801 | 3300005547 | Bacteria | 1446 |
| 64 | Ga0070665_100737808 | 3300005548 | Bacteria | 998 |
| 65 | Ga0070704_100157332 | 3300005549 | Bacteria | 1794 |
| 66 | Ga0070704_100444944 | 3300005549 | Bacteria | 1115 |
| 67 | Ga0070664_100043698 | 3300005564 | Bacteria | 3782 |
| 68 | Ga0068857_100018107 | 3300005577 | Bacteria | 6179 |
| 69 | Ga0068857_100115674 | 3300005577 | Bacteria | 2413 |
| 70 | Ga0068854_101565790 | 3300005578 | Bacteria | 600 |
| 71 | Ga0068856_100211905 | 3300005614 | Bacteria | 1953 |
| 72 | Ga0070702_100424640 | 3300005615 | Bacteria | 957 |
| 73 | Ga0070702_100789881 | 3300005615 | Bacteria | 733 |
| 74 | Ga0068859_100259559 | 3300005617 | Bacteria | 1828 |
| 75 | Ga0068859_103018608 | 3300005617 | Bacteria | 514 |
| 76 | Ga0068866_10101314 | 3300005718 | Bacteria | 1589 |
| 77 | Ga0068861_101371111 | 3300005719 | Bacteria | 690 |
| 78 | Ga0068870_10299886 | 3300005840 | Bacteria | 1014 |
| 79 | Ga0068863_100523870 | 3300005841 | Bacteria | 1169 |
| 80 | Ga0070715_10020627 | 3300006163 | Bacteria | 2544 |
| 81 | Ga0070716_100348023 | 3300006173 | Bacteria | 1048 |
| 82 | Ga0070716_100777943 | 3300006173 | Bacteria | 739 |
| 83 | Ga0070716_101261444 | 3300006173 | Bacteria | 596 |
| 84 | Ga0075362_10134088 | 3300006177 | Bacteria | 1180 |
| 85 | Ga0097621_100001348 | 3300006237 | Bacteria | 16895 |
| 86 | Ga0068871_100000763 | 3300006358 | Bacteria | 21687 |
| 87 | Ga0068871_100954993 | 3300006358 | Bacteria | 797 |
| 88 | Ga0075428_100494382 | 3300006844 | Bacteria | 1309 |
| 89 | Ga0075430_100000579 | 3300006846 | Bacteria | 27829 |
| 90 | Ga0075430_100363523 | 3300006846 | Bacteria | 1195 |
| 91 | Ga0075431_100033449 | 3300006847 | Bacteria | 5298 |
| 92 | Ga0075431_100580931 | 3300006847 | Bacteria | 1106 |
| 93 | Ga0075433_10018168 | 3300006852 | Bacteria | 5840 |
| 94 | Ga0075433_10651218 | 3300006852 | Bacteria | 924 |
| 95 | Ga0075433_10890132 | 3300006852 | Bacteria | 777 |
| 96 | Ga0075434_100000895 | 3300006871 | Bacteria | 23884 |
| 97 | Ga0075434_100102926 | 3300006871 | Bacteria | 2863 |
| 98 | Ga0075434_101160955 | 3300006871 | Bacteria | 785 |
| 99 | Ga0068865_100259604 | 3300006881 | Bacteria | 1375 |
| 100 | Ga0068865_100489046 | 3300006881 | Bacteria | 1024 |
| 101 | Ga0075436_100002331 | 3300006914 | Bacteria | 13096 |
| 102 | Ga0075436_100021757 | 3300006914 | Bacteria | 4401 |
| 103 | Ga0097620_100259563 | 3300006931 | Bacteria | 1828 |
| 104 | Ga0097620_103019280 | 3300006931 | Bacteria | 514 |
| 105 | Ga0075435_100015133 | 3300007076 | Bacteria | 5791 |
| 106 | Ga0075435_100115585 | 3300007076 | Bacteria | 2234 |
| 107 | Ga0075435_100415110 | 3300007076 | Bacteria | 1159 |
| 108 | Ga0075435_100677773 | 3300007076 | Bacteria | 895 |
| 109 | Ga0075435_100822271 | 3300007076 | Bacteria | 809 |
| 110 | Ga0099794_10020082 | 3300007265 | Bacteria | 3020 |
| 111 | Ga0099794_10057533 | 3300007265 | Bacteria | 1884 |
| 112 | Ga0111539_10204844 | 3300009094 | Bacteria | 2300 |
| 113 | Ga0111539_11267859 | 3300009094 | Bacteria | 855 |
| 114 | Ga0105245_10164075 | 3300009098 | Bacteria | 2110 |
| 115 | Ga0105245_10286799 | 3300009098 | Bacteria | 1611 |
| 116 | Ga0105245_11616326 | 3300009098 | Bacteria | 700 |
| 117 | Ga0114129_10513170 | 3300009147 | Bacteria | 1564 |
| 118 | Ga0114129_11525183 | 3300009147 | Bacteria | 820 |
| 119 | Ga0105242_10500919 | 3300009176 | Bacteria | 1155 |
| 120 | Ga0105242_11194767 | 3300009176 | Bacteria | 779 |
| 121 | Ga0105248_10050767 | 3300009177 | Bacteria | 4652 |
| 122 | Ga0105237_10936112 | 3300009545 | Bacteria | 873 |
| 123 | Ga0105249_10618431 | 3300009553 | Bacteria | 1139 |
| 124 | Ga0105239_13076412 | 3300010375 | Bacteria | 543 |
| 125 | Ga0105246_11030147 | 3300011119 | Bacteria | 747 |
| 126 | Ga0157373_10279442 | 3300013100 | Bacteria | 1183 |
| 127 | Ga0157371_10589009 | 3300013102 | Bacteria | 827 |
| 128 | Ga0157370_10003375 | 3300013104 | Bacteria | 18774 |
| 129 | Ga0157378_10506662 | 3300013297 | Bacteria | 1206 |
| 130 | Ga0157378_10599843 | 3300013297 | Bacteria | 1112 |
| 131 | Ga0157375_10094247 | 3300013308 | Bacteria | 3062 |
| 132 | Ga0157375_10224352 | 3300013308 | Bacteria | 2038 |
| 133 | Ga0157375_10260554 | 3300013308 | Bacteria | 1895 |
| 134 | Ga0157375_11047762 | 3300013308 | Bacteria | 953 |
| 135 | Ga0157375_11747196 | 3300013308 | Bacteria | 737 |
| 136 | Ga0157380_10052380 | 3300014326 | Bacteria | 3232 |
| 137 | Ga0157376_10019067 | 3300014969 | Bacteria | 5277 |
| 138 | Ga0157376_10555565 | 3300014969 | Bacteria | 1137 |
| 139 | Ga0157376_12131433 | 3300014969 | Bacteria | 599 |
| 140 | Ga0163161_10592393 | 3300017792 | Bacteria | 913 |
| 141 | Ga0163161_11037269 | 3300017792 | Bacteria | 702 |
| 142 | Ga0213872_10001745 | 3300021361 | Bacteria | 13647 |
| 143 | Ga0207697_10436544 | 3300025315 | Bacteria | 581 |
| 144 | Ga0207653_10106640 | 3300025885 | Bacteria | 996 |
| 145 | Ga0207642_10949828 | 3300025899 | Bacteria | 552 |
| 146 | Ga0207688_10015650 | 3300025901 | Bacteria | 4114 |
| 147 | Ga0207645_10045884 | 3300025907 | Bacteria | 2792 |
| 148 | Ga0207643_10425130 | 3300025908 | Bacteria | 842 |
| 149 | Ga0207684_10199365 | 3300025910 | Bacteria | 1727 |
| 150 | Ga0207707_10007445 | 3300025912 | Bacteria | 9539 |
| 151 | Ga0207707_10835899 | 3300025912 | Unclassified | 765 |
| 152 | Ga0207671_11038730 | 3300025914 | Bacteria | 645 |
| 153 | Ga0207662_10092784 | 3300025918 | Bacteria | 1859 |
| 154 | Ga0207662_10401884 | 3300025918 | Bacteria | 929 |
| 155 | Ga0207657_10816904 | 3300025919 | Bacteria | 720 |
| 156 | Ga0207649_10114226 | 3300025920 | Bacteria | 1809 |
| 157 | Ga0207652_10169827 | 3300025921 | Bacteria | 1957 |
| 158 | Ga0207652_10916168 | 3300025921 | Unclassified | 774 |
| 159 | Ga0207646_10142712 | 3300025922 | Bacteria | 2157 |
| 160 | Ga0207646_10431227 | 3300025922 | Bacteria | 1189 |
| 161 | Ga0207646_10473574 | 3300025922 | Bacteria | 1129 |
| 162 | Ga0207646_10944451 | 3300025922 | Bacteria | 764 |
| 163 | Ga0207681_10241965 | 3300025923 | Bacteria | 1405 |
| 164 | Ga0207650_10006120 | 3300025925 | Bacteria | 8199 |
| 165 | Ga0207659_10149338 | 3300025926 | Bacteria | 1823 |
| 166 | Ga0207659_10445573 | 3300025926 | Bacteria | 1090 |
| 167 | Ga0207687_10058540 | 3300025927 | Bacteria | 2711 |
| 168 | Ga0207687_10179695 | 3300025927 | Bacteria | 1638 |
| 169 | Ga0207687_10206550 | 3300025927 | Bacteria | 1538 |
| 170 | Ga0207700_10344195 | 3300025928 | Bacteria | 1297 |
| 171 | Ga0207664_10031712 | 3300025929 | Bacteria | 4045 |
| 172 | Ga0207664_10135511 | 3300025929 | Bacteria | 2077 |
| 173 | Ga0207644_10053954 | 3300025931 | Bacteria | 2894 |
| 174 | Ga0207690_10362471 | 3300025932 | Bacteria | 1148 |
| 175 | Ga0207706_10427965 | 3300025933 | Bacteria | 1146 |
| 176 | Ga0207670_10233066 | 3300025936 | Bacteria | 1415 |
| 177 | Ga0207669_10007833 | 3300025937 | Bacteria | 4974 |
| 178 | Ga0207669_10138198 | 3300025937 | Bacteria | 1687 |
| 179 | Ga0207704_10422375 | 3300025938 | Bacteria | 1057 |
| 180 | Ga0207665_10281735 | 3300025939 | Bacteria | 1237 |
| 181 | Ga0207665_10497210 | 3300025939 | Bacteria | 942 |
| 182 | Ga0207665_10705761 | 3300025939 | Bacteria | 793 |
| 183 | Ga0207691_10139756 | 3300025940 | Bacteria | 2135 |
| 184 | Ga0207689_10157161 | 3300025942 | Bacteria | 1874 |
| 185 | Ga0207689_10218202 | 3300025942 | Bacteria | 1576 |
| 186 | Ga0207689_10699987 | 3300025942 | Bacteria | 854 |
| 187 | Ga0207679_10068038 | 3300025945 | Bacteria | 2674 |
| 188 | Ga0207667_10840162 | 3300025949 | Bacteria | 913 |
| 189 | Ga0207651_10347271 | 3300025960 | Bacteria | 1248 |
| 190 | Ga0207639_10845715 | 3300026041 | Bacteria | 854 |
| 191 | Ga0207702_10200542 | 3300026078 | Bacteria | 1849 |
| 192 | Ga0207702_10357591 | 3300026078 | Bacteria | 1399 |
| 193 | Ga0207702_10533780 | 3300026078 | Bacteria | 1146 |
| 194 | Ga0207641_10496995 | 3300026088 | Bacteria | 1184 |
| 195 | Ga0207648_10314449 | 3300026089 | Bacteria | 1406 |
| 196 | Ga0207648_10874432 | 3300026089 | Bacteria | 839 |
| 197 | Ga0207648_10954265 | 3300026089 | Bacteria | 802 |
| 198 | Ga0207648_11356488 | 3300026089 | Bacteria | 668 |
| 199 | Ga0207648_11515509 | 3300026089 | Bacteria | 630 |
| 200 | Ga0207676_10544515 | 3300026095 | Bacteria | 1108 |
| 201 | Ga0207676_12066302 | 3300026095 | Bacteria | 568 |
| 202 | Ga0207674_10509549 | 3300026116 | Bacteria | 1162 |
| 203 | Ga0207675_100231108 | 3300026118 | Bacteria | 1785 |
| 204 | Ga0207675_100314852 | 3300026118 | Bacteria | 1527 |
| 205 | Ga0207683_10019065 | 3300026121 | Bacteria | 5855 |
| 206 | Ga0207698_11776969 | 3300026142 | Bacteria | 632 |
| 207 | Ga0209967_1010175 | 3300027364 | Bacteria | 1309 |
| 208 | Ga0209981_1006436 | 3300027378 | Bacteria | 1571 |
| 209 | Ga0210000_1001701 | 3300027462 | Bacteria | 3107 |
| 210 | Ga0209999_1022867 | 3300027543 | Bacteria | 1151 |
| 211 | Ga0209971_1086004 | 3300027682 | Bacteria | 767 |
| 212 | Ga0209966_1034641 | 3300027695 | Bacteria | 1034 |
| 213 | Ga0268266_10464284 | 3300028379 | Bacteria | 1205 |
| 214 | Ga0307408_100414332 | 3300031548 | Bacteria | 1160 |
| 215 | Ga0307408_100512708 | 3300031548 | Bacteria | 1052 |
| 216 | Ga0307405_10460846 | 3300031731 | Bacteria | 1010 |
| 217 | Ga0307406_10456284 | 3300031901 | Bacteria | 1027 |
| 218 | Ga0307407_10662915 | 3300031903 | Bacteria | 783 |
| 219 | Ga0307412_11422357 | 3300031911 | Bacteria | 628 |
| 220 | Ga0307409_100275430 | 3300031995 | Bacteria | 1552 |
| 221 | Ga0307416_101667438 | 3300032002 | Bacteria | 742 |
| 222 | Ga0373950_0045633 | 3300034818 | Bacteria | 849 |
| 223 | Ga0373934_0201767 | 3300035086 | Bacteria | 819 |
| 224 | Ga0373954_0000068 | 3300035118 | Bacteria | 37051 |
| 225 | Ga0373931_0105793 | 3300035691 | Bacteria | 1589 |
| 226 | Ga0373933_0003112 | 3300035724 | Bacteria | 9250 |
| 227 | Ga0373937_0002051 | 3300036401 | Bacteria | 16843 |
| 228 | Ga0395900_0046031 | 3300037418 | Bacteria | 4493 |
| 229 | Ga0436361_0050017 | 3300039447 | Bacteria | 26618 |
| 230 | Ga0436361_0407783 | 3300039447 | Bacteria | 4760 |
| 231 | Ga0450923_041600 | 3300042125 | Bacteria | 967 |
| 232 | Ga0439434_0063513 | 3300042435 | Bacteria | 1157 |
| 233 | Ga0451577_0001289 | 3300042876 | Bacteria | 34481 |
| 234 | Ga0451577_0166082 | 3300042876 | Bacteria | 1988 |
| 235 | Ga0453684_0095396 | 3300044712 | Bacteria | 3656 |
| 236 | Ga0453684_0700771 | 3300044712 | Bacteria | 1100 |
| 237 | Ga0451576_0057203 | 3300045051 | Bacteria | 4076 |
| 238 | Ga0451576_0694652 | 3300045051 | Bacteria | 1069 |
| 239 | Ga0495608_0180805 | 3300046511 | Bacteria | 1334 |
| 240 | Ga0495642_0175141 | 3300046528 | Bacteria | 933 |
| 241 | Ga0495598_0005018 | 3300046537 | Bacteria | 2906 |
| 242 | Ga0495609_0319002 | 3300046538 | Bacteria | 631 |
| 243 | Ga0495621_0018191 | 3300046539 | Bacteria | 2279 |
| 244 | Ga0495621_0037951 | 3300046539 | Bacteria | 1678 |
| 245 | Ga0495667_0215707 | 3300046559 | Bacteria | 1226 |
| 246 | Ga0495659_0091635 | 3300046664 | Bacteria | 1168 |
| 247 | Ga0495669_0077100 | 3300046684 | Bacteria | 1526 |
| 248 | Ga0495589_0176053 | 3300046794 | Bacteria | 1016 |
| 249 | Ga0496100_0361307 | 3300048903 | Bacteria | 1099 |
| 250 | Ga0496101_0082387 | 3300048904 | Bacteria | 2381 |
| 251 | Ga0496102_0073818 | 3300048905 | Bacteria | 3135 |
| 252 | Ga0496105_0777296 | 3300048908 | Bacteria | 730 |
| 253 | Ga0496106_1030977 | 3300048909 | Bacteria | 646 |
| 254 | Ga0496107_0752648 | 3300048910 | Bacteria | 715 |
| 255 | Ga0496108_0546694 | 3300048911 | Bacteria | 1010 |
| 256 | Ga0496108_0559397 | 3300048911 | Bacteria | 997 |
| 257 | Ga0496108_0714657 | 3300048911 | Bacteria | 868 |
| 258 | Ga0496109_0181221 | 3300048912 | Bacteria | 1978 |
| 259 | Ga0496109_0205494 | 3300048912 | Bacteria | 1852 |
| 260 | Ga0496111_0606926 | 3300048914 | Bacteria | 801 |
| 261 | Ga0496111_0920431 | 3300048914 | Bacteria | 629 |
| 262 | Ga0496113_0126248 | 3300048916 | Bacteria | 2004 |
| 263 | Ga0496114_0017684 | 3300048917 | Bacteria | 5758 |
| 264 | Ga0501034_0054387 | 3300049571 | Bacteria | 4030 |
| 265 | Ga0501036_0152508 | 3300049572 | Bacteria | 1949 |
| 266 | Ga0501036_0866678 | 3300049572 | Bacteria | 742 |
| 267 | Ga0501038_0044437 | 3300049574 | Bacteria | 3859 |
| 268 | Ga0501039_1339543 | 3300049575 | Bacteria | 552 |
| 269 | Ga0501040_0004087 | 3300049576 | Bacteria | 9485 |
| 270 | Ga0501048_0581684 | 3300049582 | Bacteria | 804 |
| 271 | Ga0501072_0642324 | 3300049588 | Bacteria | 836 |
| 272 | Ga0501072_1117759 | 3300049588 | Bacteria | 613 |
| 273 | Ga0501283_058074 | 3300049779 | Bacteria | 695 |
| 274 | nmdc:mga03683_305180_c1 | 3300050489 | Bacteria | 747 |
| 275 | nmdc:mga09592_319306_c1 | 3300050508 | Bacteria | 1345 |
| 276 | nmdc:mga0qj67_1458_c1 | 3300050509 | Bacteria | 16584 |
| 277 | nmdc:mga0qj67_418260_c1 | 3300050509 | Bacteria | 1081 |
| 278 | nmdc:mga06r32_49740_c1 | 3300050510 | Bacteria | 4010 |
| 279 | nmdc:mga0n895_1512541_c1 | 3300050512 | Bacteria | 637 |
| 280 | nmdc:mga0n895_534271_c1 | 3300050512 | Bacteria | 1179 |
| 281 | nmdc:mga0n895_570_c1 | 3300050512 | Bacteria | 25297 |
| 282 | nmdc:mga0rr50_1083281_c1 | 3300050513 | Bacteria | 682 |
| 283 | nmdc:mga0rr50_112452_c1 | 3300050513 | Bacteria | 2157 |
| 284 | nmdc:mga0rr50_292514_c1 | 3300050513 | Bacteria | 1361 |
| 285 | nmdc:mga0rr50_33874_c1 | 3300050513 | Bacteria | 3653 |
| 286 | nmdc:mga0rr50_662405_c1 | 3300050513 | Bacteria | 891 |
| 287 | nmdc:mga0rr50_74236_c1 | 3300050513 | Bacteria | 2602 |
| 288 | nmdc:mga08x19_20089_c1 | 3300050514 | Bacteria | 4111 |
| 289 | nmdc:mga08x19_340617_c1 | 3300050514 | Bacteria | 1046 |
| 290 | nmdc:mga08x19_64591_c1 | 3300050514 | Bacteria | 2376 |
| 291 | nmdc:mga0a205_110473_c1 | 3300050515 | Bacteria | 2648 |
| 292 | nmdc:mga0a205_48126_c1 | 3300050515 | Bacteria | 4115 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10874432 | Ga0207648_108744322 | 117 |
| 2 | 3300032002 | Ga0307416_101667438 | Ga0307416_1016674382 | 117 |
| 3 | 3300005467 | Ga0070706_100357515 | Ga0070706_1003575152 | 123 |
| 4 | 3300005468 | Ga0070707_100719786 | Ga0070707_1007197862 | 123 |
| 5 | 3300005471 | Ga0070698_100279188 | Ga0070698_1002791883 | 123 |
| 6 | 3300025910 | Ga0207684_10199365 | Ga0207684_101993654 | 123 |
| 7 | 3300025922 | Ga0207646_10944451 | Ga0207646_109444512 | 123 |
| 8 | 3300049574 | Ga0501038_0044437 | Ga0501038_0044437_1586_2017 | 125 |
| 9 | 3300050512 | nmdc:mga0n895_1512541_c1 | nmdc:mga0n895_1512541_c1_218_595 | 125 |
| 10 | 3300039447 | Ga0436361_0407783 | Ga0436361_0407783_3231_3665 | 126 |
| 11 | 3300009553 | Ga0105249_10618431 | Ga0105249_106184311 | 130 |
| 12 | 3300013102 | Ga0157371_10589009 | Ga0157371_105890093 | 130 |
| 13 | 3300025921 | Ga0207652_10169827 | Ga0207652_101698272 | 130 |
| 14 | 3300026041 | Ga0207639_10845715 | Ga0207639_108457152 | 130 |
| 15 | 3300005337 | Ga0070682_100078799 | Ga0070682_1000787994 | 131 |
| 16 | 3300005339 | Ga0070660_100207764 | Ga0070660_1002077642 | 131 |
| 17 | 3300005435 | Ga0070714_100028702 | Ga0070714_1000287022 | 131 |
| 18 | 3300005457 | Ga0070662_101191299 | Ga0070662_1011912991 | 131 |
| 19 | 3300005459 | Ga0068867_102001635 | Ga0068867_1020016351 | 131 |
| 20 | 3300005546 | Ga0070696_100230801 | Ga0070696_1002308012 | 131 |
| 21 | 3300009094 | Ga0111539_11267859 | Ga0111539_112678592 | 131 |
| 22 | 3300010375 | Ga0105239_13076412 | Ga0105239_130764121 | 131 |
| 23 | 3300013100 | Ga0157373_10279442 | Ga0157373_102794422 | 131 |
| 24 | 3300013104 | Ga0157370_10003375 | Ga0157370_1000337522 | 131 |
| 25 | 3300021361 | Ga0213872_10001745 | Ga0213872_100017456 | 131 |
| 26 | 3300025919 | Ga0207657_10816904 | Ga0207657_108169042 | 131 |
| 27 | 3300025929 | Ga0207664_10031712 | Ga0207664_100317124 | 131 |
| 28 | 3300025933 | Ga0207706_10427965 | Ga0207706_104279651 | 131 |
| 29 | 3300026078 | Ga0207702_10533780 | Ga0207702_105337801 | 131 |
| 30 | 3300037418 | Ga0395900_0046031 | Ga0395900_0046031_3929_4360 | 131 |
| 31 | 3300039447 | Ga0436361_0050017 | Ga0436361_0050017_17022_17453 | 131 |
| 32 | 3300048911 | Ga0496108_0559397 | Ga0496108_0559397_296_727 | 131 |
| 33 | 3300048912 | Ga0496109_0181221 | Ga0496109_0181221_282_713 | 131 |
| 34 | 3300048916 | Ga0496113_0126248 | Ga0496113_0126248_1282_1713 | 131 |
| 35 | 3300049571 | Ga0501034_0054387 | Ga0501034_0054387_850_1281 | 131 |
| 36 | 3300049572 | Ga0501036_0152508 | Ga0501036_0152508_514_945 | 131 |
| 37 | 3300005343 | Ga0070687_100326076 | Ga0070687_1003260762 | 132 |
| 38 | 3300005344 | Ga0070661_100070251 | Ga0070661_1000702513 | 132 |
| 39 | 3300005353 | Ga0070669_100038463 | Ga0070669_1000384637 | 132 |
| 40 | 3300005354 | Ga0070675_100197083 | Ga0070675_1001970833 | 132 |
| 41 | 3300005355 | Ga0070671_100061543 | Ga0070671_1000615435 | 132 |
| 42 | 3300005356 | Ga0070674_101396948 | Ga0070674_1013969482 | 132 |
| 43 | 3300005364 | Ga0070673_100282831 | Ga0070673_1002828313 | 132 |
| 44 | 3300005365 | Ga0070688_100103317 | Ga0070688_1001033174 | 132 |
| 45 | 3300005367 | Ga0070667_100186508 | Ga0070667_1001865082 | 132 |
| 46 | 3300005456 | Ga0070678_100014745 | Ga0070678_1000147459 | 132 |
| 47 | 3300005466 | Ga0070685_10106861 | Ga0070685_101068614 | 132 |
| 48 | 3300005564 | Ga0070664_100043698 | Ga0070664_1000436985 | 132 |
| 49 | 3300005840 | Ga0068870_10299886 | Ga0068870_102998862 | 132 |
| 50 | 3300005841 | Ga0068863_100523870 | Ga0068863_1005238702 | 132 |
| 51 | 3300006358 | Ga0068871_100954993 | Ga0068871_1009549931 | 132 |
| 52 | 3300006871 | Ga0075434_101160955 | Ga0075434_1011609552 | 132 |
| 53 | 3300006881 | Ga0068865_100259604 | Ga0068865_1002596043 | 132 |
| 54 | 3300007076 | Ga0075435_100822271 | Ga0075435_1008222711 | 132 |
| 55 | 3300009094 | Ga0111539_10204844 | Ga0111539_102048446 | 132 |
| 56 | 3300009176 | Ga0105242_10500919 | Ga0105242_105009192 | 132 |
| 57 | 3300009177 | Ga0105248_10050767 | Ga0105248_100507672 | 132 |
| 58 | 3300011119 | Ga0105246_11030147 | Ga0105246_110301472 | 132 |
| 59 | 3300013297 | Ga0157378_10599843 | Ga0157378_105998431 | 132 |
| 60 | 3300013308 | Ga0157375_10260554 | Ga0157375_102605545 | 132 |
| 61 | 3300014326 | Ga0157380_10052380 | Ga0157380_100523802 | 132 |
| 62 | 3300014969 | Ga0157376_10555565 | Ga0157376_105555653 | 132 |
| 63 | 3300017792 | Ga0163161_10592393 | Ga0163161_105923932 | 132 |
| 64 | 3300025908 | Ga0207643_10425130 | Ga0207643_104251303 | 132 |
| 65 | 3300025920 | Ga0207649_10114226 | Ga0207649_101142262 | 132 |
| 66 | 3300025925 | Ga0207650_10006120 | Ga0207650_100061208 | 132 |
| 67 | 3300025926 | Ga0207659_10149338 | Ga0207659_101493382 | 132 |
| 68 | 3300025931 | Ga0207644_10053954 | Ga0207644_100539545 | 132 |
| 69 | 3300025937 | Ga0207669_10138198 | Ga0207669_101381981 | 132 |
| 70 | 3300025940 | Ga0207691_10139756 | Ga0207691_101397563 | 132 |
| 71 | 3300025945 | Ga0207679_10068038 | Ga0207679_100680383 | 132 |
| 72 | 3300026088 | Ga0207641_10496995 | Ga0207641_104969952 | 132 |
| 73 | 3300026118 | Ga0207675_100314852 | Ga0207675_1003148523 | 132 |
| 74 | 3300026121 | Ga0207683_10019065 | Ga0207683_1001906511 | 132 |
| 75 | 3300046539 | Ga0495621_0037951 | Ga0495621_0037951_22_480 | 132 |
| 76 | 3300046794 | Ga0495589_0176053 | Ga0495589_0176053_323_781 | 132 |
| 77 | 3300050508 | nmdc:mga09592_319306_c1 | nmdc:mga09592_319306_c1_119_577 | 132 |
| 78 | 3300050513 | nmdc:mga0rr50_1083281_c1 | nmdc:mga0rr50_1083281_c1_188_646 | 132 |
| 79 | 3300014969 | Ga0157376_12131433 | Ga0157376_121314331 | 133 |
| 80 | 3300017792 | Ga0163161_11037269 | Ga0163161_110372692 | 133 |
| 81 | 3300048903 | Ga0496100_0361307 | Ga0496100_0361307_237_680 | 133 |
| 82 | 3300048904 | Ga0496101_0082387 | Ga0496101_0082387_1802_2245 | 133 |
| 83 | 3300048909 | Ga0496106_1030977 | Ga0496106_1030977_168_611 | 133 |
| 84 | 3300048911 | Ga0496108_0714657 | Ga0496108_0714657_259_702 | 133 |
| 85 | 3300048917 | Ga0496114_0017684 | Ga0496114_0017684_3146_3589 | 133 |
| 86 | 3300005440 | Ga0070705_100121047 | Ga0070705_1001210472 | 134 |
| 87 | 3300013308 | Ga0157375_10094247 | Ga0157375_100942475 | 134 |
| 88 | 3300026095 | Ga0207676_12066302 | Ga0207676_120663021 | 134 |
| 89 | 3300048914 | Ga0496111_0606926 | Ga0496111_0606926_126_626 | 134 |
| 90 | 3300027682 | Ga0209971_1086004 | Ga0209971_10860042 | 138 |
| 91 | 3300007265 | Ga0099794_10020082 | Ga0099794_100200827 | 139 |
| 92 | 3300025885 | Ga0207653_10106640 | Ga0207653_101066402 | 140 |
| 93 | 3300005615 | Ga0070702_100424640 | Ga0070702_1004246402 | 141 |
| 94 | 3300005435 | Ga0070714_100133425 | Ga0070714_1001334254 | 143 |
| 95 | 3300005436 | Ga0070713_100562344 | Ga0070713_1005623443 | 143 |
| 96 | 3300005545 | Ga0070695_101033044 | Ga0070695_1010330442 | 143 |
| 97 | 3300025929 | Ga0207664_10135511 | Ga0207664_101355114 | 143 |
| 98 | 3300025939 | Ga0207665_10497210 | Ga0207665_104972102 | 143 |
| 99 | 3300044712 | Ga0453684_0700771 | Ga0453684_0700771_231_668 | 143 |
| 100 | 3300049582 | Ga0501048_0581684 | Ga0501048_0581684_73_507 | 143 |
| 101 | 3300006852 | Ga0075433_10651218 | Ga0075433_106512182 | 144 |
| 102 | 3300006852 | Ga0075433_10890132 | Ga0075433_108901322 | 144 |
| 103 | 3300006914 | Ga0075436_100002331 | Ga0075436_10000233123 | 144 |
| 104 | 3300007076 | Ga0075435_100677773 | Ga0075435_1006777733 | 144 |
| 105 | 3300042876 | Ga0451577_0166082 | Ga0451577_0166082_1119_1685 | 144 |
| 106 | 3300044712 | Ga0453684_0095396 | Ga0453684_0095396_377_943 | 144 |
| 107 | 3300048908 | Ga0496105_0777296 | Ga0496105_0777296_16_450 | 144 |
| 108 | 3300050513 | nmdc:mga0rr50_662405_c1 | nmdc:mga0rr50_662405_c1_255_776 | 144 |
| 109 | 3300050514 | nmdc:mga08x19_64591_c1 | nmdc:mga08x19_64591_c1_373_885 | 144 |
| 110 | 3300050515 | nmdc:mga0a205_110473_c1 | nmdc:mga0a205_110473_c1_1535_2050 | 144 |
| 111 | 3300005334 | Ga0068869_100973987 | Ga0068869_1009739871 | 145 |
| 112 | 3300005440 | Ga0070705_100003035 | Ga0070705_10000303510 | 145 |
| 113 | 3300005456 | Ga0070678_101865624 | Ga0070678_1018656241 | 145 |
| 114 | 3300005468 | Ga0070707_100490797 | Ga0070707_1004907972 | 145 |
| 115 | 3300005546 | Ga0070696_100004428 | Ga0070696_10000442818 | 145 |
| 116 | 3300005548 | Ga0070665_100737808 | Ga0070665_1007378082 | 145 |
| 117 | 3300005549 | Ga0070704_100444944 | Ga0070704_1004449442 | 145 |
| 118 | 3300006847 | Ga0075431_100580931 | Ga0075431_1005809312 | 145 |
| 119 | 3300006914 | Ga0075436_100021757 | Ga0075436_1000217573 | 145 |
| 120 | 3300009098 | Ga0105245_10164075 | Ga0105245_101640752 | 145 |
| 121 | 3300013308 | Ga0157375_11047762 | Ga0157375_110477622 | 145 |
| 122 | 3300025922 | Ga0207646_10431227 | Ga0207646_104312273 | 145 |
| 123 | 3300025927 | Ga0207687_10058540 | Ga0207687_100585402 | 145 |
| 124 | 3300025942 | Ga0207689_10699987 | Ga0207689_106999872 | 145 |
| 125 | 3300026142 | Ga0207698_11776969 | Ga0207698_117769692 | 145 |
| 126 | 3300028379 | Ga0268266_10464284 | Ga0268266_104642842 | 145 |
| 127 | 3300035086 | Ga0373934_0201767 | Ga0373934_0201767_92_613 | 145 |
| 128 | 3300050513 | nmdc:mga0rr50_74236_c1 | nmdc:mga0rr50_74236_c1_508_1026 | 145 |
| 129 | 3300050514 | nmdc:mga08x19_20089_c1 | nmdc:mga08x19_20089_c1_3322_3840 | 145 |
| 130 | 3300005328 | Ga0070676_10237014 | Ga0070676_102370143 | 146 |
| 131 | 3300005328 | Ga0070676_10439817 | Ga0070676_104398173 | 146 |
| 132 | 3300005330 | Ga0070690_100189938 | Ga0070690_1001899383 | 146 |
| 133 | 3300005340 | Ga0070689_100097369 | Ga0070689_1000973692 | 146 |
| 134 | 3300005340 | Ga0070689_100125528 | Ga0070689_1001255284 | 146 |
| 135 | 3300005343 | Ga0070687_100469491 | Ga0070687_1004694912 | 146 |
| 136 | 3300005354 | Ga0070675_100031603 | Ga0070675_1000316037 | 146 |
| 137 | 3300005356 | Ga0070674_100013903 | Ga0070674_1000139034 | 146 |
| 138 | 3300005356 | Ga0070674_100349690 | Ga0070674_1003496902 | 146 |
| 139 | 3300005364 | Ga0070673_100135747 | Ga0070673_1001357472 | 146 |
| 140 | 3300005439 | Ga0070711_100268682 | Ga0070711_1002686823 | 146 |
| 141 | 3300005444 | Ga0070694_100076987 | Ga0070694_1000769874 | 146 |
| 142 | 3300005444 | Ga0070694_100205360 | Ga0070694_1002053602 | 146 |
| 143 | 3300005444 | Ga0070694_100470276 | Ga0070694_1004702763 | 146 |
| 144 | 3300005456 | Ga0070678_100145064 | Ga0070678_1001450642 | 146 |
| 145 | 3300005458 | Ga0070681_10001245 | Ga0070681_1000124522 | 146 |
| 146 | 3300005458 | Ga0070681_10979396 | Ga0070681_109793961 | 146 |
| 147 | 3300005466 | Ga0070685_10132747 | Ga0070685_101327472 | 146 |
| 148 | 3300005466 | Ga0070685_11014244 | Ga0070685_110142441 | 146 |
| 149 | 3300005468 | Ga0070707_100386746 | Ga0070707_1003867461 | 146 |
| 150 | 3300005468 | Ga0070707_100738564 | Ga0070707_1007385641 | 146 |
| 151 | 3300005518 | Ga0070699_100047515 | Ga0070699_1000475156 | 146 |
| 152 | 3300005530 | Ga0070679_100525246 | Ga0070679_1005252462 | 146 |
| 153 | 3300005530 | Ga0070679_101046273 | Ga0070679_1010462732 | 146 |
| 154 | 3300005530 | Ga0070679_101079593 | Ga0070679_1010795931 | 146 |
| 155 | 3300005536 | Ga0070697_100081928 | Ga0070697_1000819282 | 146 |
| 156 | 3300005539 | Ga0068853_100595308 | Ga0068853_1005953082 | 146 |
| 157 | 3300005544 | Ga0070686_100008053 | Ga0070686_10000805314 | 146 |
| 158 | 3300005544 | Ga0070686_100032410 | Ga0070686_1000324105 | 146 |
| 159 | 3300005545 | Ga0070695_100001266 | Ga0070695_10000126622 | 146 |
| 160 | 3300005545 | Ga0070695_100145825 | Ga0070695_1001458252 | 146 |
| 161 | 3300005546 | Ga0070696_100148912 | Ga0070696_1001489122 | 146 |
| 162 | 3300005546 | Ga0070696_100791559 | Ga0070696_1007915592 | 146 |
| 163 | 3300005547 | Ga0070693_100156801 | Ga0070693_1001568013 | 146 |
| 164 | 3300005549 | Ga0070704_100157332 | Ga0070704_1001573322 | 146 |
| 165 | 3300005577 | Ga0068857_100018107 | Ga0068857_1000181076 | 146 |
| 166 | 3300005577 | Ga0068857_100115674 | Ga0068857_1001156745 | 146 |
| 167 | 3300005578 | Ga0068854_101565790 | Ga0068854_1015657901 | 146 |
| 168 | 3300005614 | Ga0068856_100211905 | Ga0068856_1002119052 | 146 |
| 169 | 3300005615 | Ga0070702_100789881 | Ga0070702_1007898812 | 146 |
| 170 | 3300005617 | Ga0068859_100259559 | Ga0068859_1002595593 | 146 |
| 171 | 3300005617 | Ga0068859_103018608 | Ga0068859_1030186081 | 146 |
| 172 | 3300005718 | Ga0068866_10101314 | Ga0068866_101013142 | 146 |
| 173 | 3300005719 | Ga0068861_101371111 | Ga0068861_1013711111 | 146 |
| 174 | 3300006163 | Ga0070715_10020627 | Ga0070715_100206273 | 146 |
| 175 | 3300006173 | Ga0070716_100348023 | Ga0070716_1003480231 | 146 |
| 176 | 3300006173 | Ga0070716_100777943 | Ga0070716_1007779432 | 146 |
| 177 | 3300006173 | Ga0070716_101261444 | Ga0070716_1012614441 | 146 |
| 178 | 3300006177 | Ga0075362_10134088 | Ga0075362_101340882 | 146 |
| 179 | 3300006237 | Ga0097621_100001348 | Ga0097621_10000134812 | 146 |
| 180 | 3300006358 | Ga0068871_100000763 | Ga0068871_10000076320 | 146 |
| 181 | 3300006844 | Ga0075428_100494382 | Ga0075428_1004943821 | 146 |
| 182 | 3300006846 | Ga0075430_100000579 | Ga0075430_10000057922 | 146 |
| 183 | 3300006846 | Ga0075430_100363523 | Ga0075430_1003635232 | 146 |
| 184 | 3300006847 | Ga0075431_100033449 | Ga0075431_1000334498 | 146 |
| 185 | 3300006852 | Ga0075433_10018168 | Ga0075433_100181686 | 146 |
| 186 | 3300006871 | Ga0075434_100000895 | Ga0075434_10000089517 | 146 |
| 187 | 3300006871 | Ga0075434_100102926 | Ga0075434_1001029266 | 146 |
| 188 | 3300006881 | Ga0068865_100489046 | Ga0068865_1004890462 | 146 |
| 189 | 3300006931 | Ga0097620_100259563 | Ga0097620_1002595633 | 146 |
| 190 | 3300006931 | Ga0097620_103019280 | Ga0097620_1030192801 | 146 |
| 191 | 3300007076 | Ga0075435_100015133 | Ga0075435_1000151337 | 146 |
| 192 | 3300007076 | Ga0075435_100115585 | Ga0075435_1001155853 | 146 |
| 193 | 3300007076 | Ga0075435_100415110 | Ga0075435_1004151102 | 146 |
| 194 | 3300007265 | Ga0099794_10057533 | Ga0099794_100575334 | 146 |
| 195 | 3300009098 | Ga0105245_10286799 | Ga0105245_102867993 | 146 |
| 196 | 3300009098 | Ga0105245_11616326 | Ga0105245_116163261 | 146 |
| 197 | 3300009147 | Ga0114129_10513170 | Ga0114129_105131702 | 146 |
| 198 | 3300009147 | Ga0114129_11525183 | Ga0114129_115251832 | 146 |
| 199 | 3300009176 | Ga0105242_11194767 | Ga0105242_111947672 | 146 |
| 200 | 3300009545 | Ga0105237_10936112 | Ga0105237_109361122 | 146 |
| 201 | 3300013297 | Ga0157378_10506662 | Ga0157378_105066623 | 146 |
| 202 | 3300013308 | Ga0157375_10224352 | Ga0157375_102243522 | 146 |
| 203 | 3300013308 | Ga0157375_11747196 | Ga0157375_117471962 | 146 |
| 204 | 3300014969 | Ga0157376_10019067 | Ga0157376_100190678 | 146 |
| 205 | 3300025315 | Ga0207697_10436544 | Ga0207697_104365441 | 146 |
| 206 | 3300025899 | Ga0207642_10949828 | Ga0207642_109498282 | 146 |
| 207 | 3300025901 | Ga0207688_10015650 | Ga0207688_100156503 | 146 |
| 208 | 3300025907 | Ga0207645_10045884 | Ga0207645_100458842 | 146 |
| 209 | 3300025912 | Ga0207707_10007445 | Ga0207707_100074457 | 146 |
| 210 | 3300025912 | Ga0207707_10835899 | Ga0207707_108358991 | 146 |
| 211 | 3300025914 | Ga0207671_11038730 | Ga0207671_110387302 | 146 |
| 212 | 3300025918 | Ga0207662_10092784 | Ga0207662_100927842 | 146 |
| 213 | 3300025918 | Ga0207662_10401884 | Ga0207662_104018841 | 146 |
| 214 | 3300025921 | Ga0207652_10916168 | Ga0207652_109161682 | 146 |
| 215 | 3300025922 | Ga0207646_10142712 | Ga0207646_101427125 | 146 |
| 216 | 3300025922 | Ga0207646_10473574 | Ga0207646_104735742 | 146 |
| 217 | 3300025923 | Ga0207681_10241965 | Ga0207681_102419652 | 146 |
| 218 | 3300025926 | Ga0207659_10445573 | Ga0207659_104455733 | 146 |
| 219 | 3300025927 | Ga0207687_10179695 | Ga0207687_101796953 | 146 |
| 220 | 3300025927 | Ga0207687_10206550 | Ga0207687_102065502 | 146 |
| 221 | 3300025928 | Ga0207700_10344195 | Ga0207700_103441953 | 146 |
| 222 | 3300025932 | Ga0207690_10362471 | Ga0207690_103624712 | 146 |
| 223 | 3300025936 | Ga0207670_10233066 | Ga0207670_102330663 | 146 |
| 224 | 3300025937 | Ga0207669_10007833 | Ga0207669_100078338 | 146 |
| 225 | 3300025938 | Ga0207704_10422375 | Ga0207704_104223753 | 146 |
| 226 | 3300025939 | Ga0207665_10281735 | Ga0207665_102817352 | 146 |
| 227 | 3300025939 | Ga0207665_10705761 | Ga0207665_107057612 | 146 |
| 228 | 3300025942 | Ga0207689_10157161 | Ga0207689_101571613 | 146 |
| 229 | 3300025942 | Ga0207689_10218202 | Ga0207689_102182022 | 146 |
| 230 | 3300025949 | Ga0207667_10840162 | Ga0207667_108401622 | 146 |
| 231 | 3300025960 | Ga0207651_10347271 | Ga0207651_103472713 | 146 |
| 232 | 3300026078 | Ga0207702_10200542 | Ga0207702_102005422 | 146 |
| 233 | 3300026078 | Ga0207702_10357591 | Ga0207702_103575912 | 146 |
| 234 | 3300026089 | Ga0207648_10314449 | Ga0207648_103144492 | 146 |
| 235 | 3300026089 | Ga0207648_10954265 | Ga0207648_109542651 | 146 |
| 236 | 3300026089 | Ga0207648_11356488 | Ga0207648_113564882 | 146 |
| 237 | 3300026089 | Ga0207648_11515509 | Ga0207648_115155092 | 146 |
| 238 | 3300026095 | Ga0207676_10544515 | Ga0207676_105445153 | 146 |
| 239 | 3300026116 | Ga0207674_10509549 | Ga0207674_105095492 | 146 |
| 240 | 3300026118 | Ga0207675_100231108 | Ga0207675_1002311084 | 146 |
| 241 | 3300027364 | Ga0209967_1010175 | Ga0209967_10101752 | 146 |
| 242 | 3300027378 | Ga0209981_1006436 | Ga0209981_10064363 | 146 |
| 243 | 3300027462 | Ga0210000_1001701 | Ga0210000_10017012 | 146 |
| 244 | 3300027543 | Ga0209999_1022867 | Ga0209999_10228673 | 146 |
| 245 | 3300027695 | Ga0209966_1034641 | Ga0209966_10346412 | 146 |
| 246 | 3300031548 | Ga0307408_100414332 | Ga0307408_1004143322 | 146 |
| 247 | 3300031548 | Ga0307408_100512708 | Ga0307408_1005127082 | 146 |
| 248 | 3300031731 | Ga0307405_10460846 | Ga0307405_104608462 | 146 |
| 249 | 3300031901 | Ga0307406_10456284 | Ga0307406_104562841 | 146 |
| 250 | 3300031903 | Ga0307407_10662915 | Ga0307407_106629151 | 146 |
| 251 | 3300031911 | Ga0307412_11422357 | Ga0307412_114223571 | 146 |
| 252 | 3300031995 | Ga0307409_100275430 | Ga0307409_1002754303 | 146 |
| 253 | 3300034818 | Ga0373950_0045633 | Ga0373950_0045633_134_586 | 146 |
| 254 | 3300035118 | Ga0373954_0000068 | Ga0373954_0000068_27049_27576 | 146 |
| 255 | 3300035691 | Ga0373931_0105793 | Ga0373931_0105793_835_1371 | 146 |
| 256 | 3300035724 | Ga0373933_0003112 | Ga0373933_0003112_7968_8495 | 146 |
| 257 | 3300036401 | Ga0373937_0002051 | Ga0373937_0002051_5270_5797 | 146 |
| 258 | 3300042125 | Ga0450923_041600 | Ga0450923_041600_136_669 | 146 |
| 259 | 3300042435 | Ga0439434_0063513 | Ga0439434_0063513_345_881 | 146 |
| 260 | 3300042876 | Ga0451577_0001289 | Ga0451577_0001289_32164_32643 | 146 |
| 261 | 3300045051 | Ga0451576_0057203 | Ga0451576_0057203_474_1025 | 146 |
| 262 | 3300045051 | Ga0451576_0694652 | Ga0451576_0694652_302_817 | 146 |
| 263 | 3300046511 | Ga0495608_0180805 | Ga0495608_0180805_553_1080 | 146 |
| 264 | 3300046528 | Ga0495642_0175141 | Ga0495642_0175141_28_561 | 146 |
| 265 | 3300046537 | Ga0495598_0005018 | Ga0495598_0005018_520_1038 | 146 |
| 266 | 3300046538 | Ga0495609_0319002 | Ga0495609_0319002_148_618 | 146 |
| 267 | 3300046539 | Ga0495621_0018191 | Ga0495621_0018191_1277_1795 | 146 |
| 268 | 3300046559 | Ga0495667_0215707 | Ga0495667_0215707_226_753 | 146 |
| 269 | 3300046664 | Ga0495659_0091635 | Ga0495659_0091635_111_641 | 146 |
| 270 | 3300046684 | Ga0495669_0077100 | Ga0495669_0077100_478_1011 | 146 |
| 271 | 3300048905 | Ga0496102_0073818 | Ga0496102_0073818_179_619 | 146 |
| 272 | 3300048910 | Ga0496107_0752648 | Ga0496107_0752648_50_490 | 146 |
| 273 | 3300048911 | Ga0496108_0546694 | Ga0496108_0546694_383_823 | 146 |
| 274 | 3300048912 | Ga0496109_0205494 | Ga0496109_0205494_85_525 | 146 |
| 275 | 3300048914 | Ga0496111_0920431 | Ga0496111_0920431_45_485 | 146 |
| 276 | 3300049572 | Ga0501036_0866678 | Ga0501036_0866678_54_566 | 146 |
| 277 | 3300049575 | Ga0501039_1339543 | Ga0501039_1339543_31_537 | 146 |
| 278 | 3300049576 | Ga0501040_0004087 | Ga0501040_0004087_6989_7522 | 146 |
| 279 | 3300049588 | Ga0501072_0642324 | Ga0501072_0642324_139_651 | 146 |
| 280 | 3300049588 | Ga0501072_1117759 | Ga0501072_1117759_58_591 | 146 |
| 281 | 3300049779 | Ga0501283_058074 | Ga0501283_058074_91_633 | 146 |
| 282 | 3300050489 | nmdc:mga03683_305180_c1 | nmdc:mga03683_305180_c1_130_666 | 146 |
| 283 | 3300050509 | nmdc:mga0qj67_1458_c1 | nmdc:mga0qj67_1458_c1_11668_12201 | 146 |
| 284 | 3300050509 | nmdc:mga0qj67_418260_c1 | nmdc:mga0qj67_418260_c1_524_1042 | 146 |
| 285 | 3300050510 | nmdc:mga06r32_49740_c1 | nmdc:mga06r32_49740_c1_1609_2121 | 146 |
| 286 | 3300050512 | nmdc:mga0n895_534271_c1 | nmdc:mga0n895_534271_c1_104_649 | 146 |
| 287 | 3300050512 | nmdc:mga0n895_570_c1 | nmdc:mga0n895_570_c1_15435_15947 | 146 |
| 288 | 3300050513 | nmdc:mga0rr50_112452_c1 | nmdc:mga0rr50_112452_c1_519_1046 | 146 |
| 289 | 3300050513 | nmdc:mga0rr50_292514_c1 | nmdc:mga0rr50_292514_c1_606_1172 | 146 |
| 290 | 3300050513 | nmdc:mga0rr50_33874_c1 | nmdc:mga0rr50_33874_c1_341_853 | 146 |
| 291 | 3300050514 | nmdc:mga08x19_340617_c1 | nmdc:mga08x19_340617_c1_448_978 | 146 |
| 292 | 3300050515 | nmdc:mga0a205_48126_c1 | nmdc:mga0a205_48126_c1_536_1063 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w2b-assembly1.cif.gz_N | trigger factor ribosome binding domain in complex with 50s | 0.8158 | 75 | 142 |
| 8hl5-assembly1.cif.gz_L18E | cryo-em structures and translocation mechanism of crenarchaeota ribosome | 0.8087 | 77 | 144 |
| 7am2-assembly1.cif.gz_G | intermediate assembly of the large subunit from leishmania major mitochondrial ribosome | 0.7709 | 76 | 144 |
| 6zu5-assembly1.cif.gz_LQ0 | structure of the paranosema locustae ribosome in complex with lso2 | 0.7522 | 76 | 144 |
| 6hix-assembly1.cif.gz_AP | cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit | 0.7461 | 74 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P02413_75_144_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9602 | 76 | 144 | 3.100.10.10 |
| af_P02413_75_144_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9341 | 76 | 144 | 3.100.10.10 |
| 5v7qL01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8958 | 76 | 144 | 3.100.10.10 |
| af_Q9Y7M5_108_185_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8718 | 77 | 143 | 3.100.10.10 |
| af_Q8ILG7_161_247_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8681 | 74 | 146 | 3.100.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A080LUN8-F1-model_v4 | 50S ribosomal protein L15 | 1.003 | 74 | 144 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A4Q3ZTU2-F1-model_v4 | deleted | 0.9907 | 73 | 143 |
|
| AF-A0A661D962-F1-model_v4 | 50S ribosomal protein L15 | 0.9895 | 73 | 144 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-D4DRP2-F1-model_v4 | 50S ribosomal protein L15 | 0.9872 | 73 | 144 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A523MHP9-F1-model_v4 | 50S ribosomal protein L15 | 0.9784 | 87 | 144 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar