F390902

General Info

Members Datasets Scaffolds Average Seq Length
292 205 292 275

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10324910|Ga0105241_103249101
Length 278
Sequence MSAVALPTAPAPVDLSSVKARQQAAWSTGDYAVVGTTLQSVGEDLCEAIDLRSGSRVLDVAAGNGNATLAAARRWCDVTSTDYVAALLDAGRARADAEGHTIAFQQADAENLPFADATYDVVLSTFGVMFTPNQEKAAAELARVCRPGGTIGLANWTPGSFIGQVFKTIGKYVPPAAGVKSPALWGTRARLVELFGDSARQITTVTRTFTFRYCSPAHWIDVFRSYYGPMNKTFAALDAWKQADFTRDLMALLVEGNRADDGTLVLPSEYLEVVVTRR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 5.14
Rhizosphere 89.04
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10007993 3300003659 Bacteria 2245
2 JGI25404J52841_10045760 3300003659 Bacteria 923
3 Ga0065712_10084010 3300005290 Bacteria 2795
4 Ga0065707_10165528 3300005295 Bacteria 1525
5 Ga0070676_10001400 3300005328 Bacteria 12178
6 Ga0070690_100007299 3300005330 Bacteria 6328
7 Ga0070670_100012523 3300005331 Bacteria 7258
8 Ga0070670_100018036 3300005331 Bacteria 6058
9 Ga0070677_10137921 3300005333 Bacteria 1121
10 Ga0068869_100007174 3300005334 Bacteria 7104
11 Ga0070666_10020541 3300005335 Bacteria 4270
12 Ga0070660_100137715 3300005339 Bacteria 1957
13 Ga0070687_100005132 3300005343 Bacteria 5279
14 Ga0070661_100178925 3300005344 Bacteria 1613
15 Ga0070671_100000285 3300005355 Bacteria 34428
16 Ga0070671_100230444 3300005355 Bacteria 1572
17 Ga0070671_100310351 3300005355 Bacteria 1343
18 Ga0070673_100035254 3300005364 Bacteria 3792
19 Ga0070673_100071492 3300005364 Bacteria 2788
20 Ga0070673_100104238 3300005364 Bacteria 2341
21 Ga0070659_100039381 3300005366 Bacteria 3690
22 Ga0070713_100067190 3300005436 Bacteria 3018
23 Ga0070710_10000838 3300005437 Bacteria 14792
24 Ga0070711_100100264 3300005439 Bacteria 2105
25 Ga0070700_100005120 3300005441 Bacteria 6919
26 Ga0070678_100050072 3300005456 Bacteria 3019
27 Ga0070678_100068096 3300005456 Bacteria 2652
28 Ga0070681_10322964 3300005458 Bacteria 1453
29 Ga0070706_100083689 3300005467 Bacteria 2956
30 Ga0070707_100062600 3300005468 Bacteria 3569
31 Ga0070684_100061643 3300005535 Bacteria 3283
32 Ga0070697_100132291 3300005536 Bacteria 2093
33 Ga0068853_100029539 3300005539 Bacteria 4622
34 Ga0068853_100088118 3300005539 Bacteria 2724
35 Ga0070672_100248546 3300005543 Bacteria 1497
36 Ga0070665_100302396 3300005548 Bacteria 1603
37 Ga0070665_100393256 3300005548 Bacteria 1394
38 Ga0068855_100048366 3300005563 Bacteria 5019
39 Ga0068855_100354113 3300005563 Bacteria 1617
40 Ga0068855_100762304 3300005563 Bacteria 1031
41 Ga0070664_100080306 3300005564 Bacteria 2809
42 Ga0070664_100299278 3300005564 Bacteria 1453
43 Ga0068856_100017094 3300005614 Bacteria 7031
44 Ga0068852_100025497 3300005616 Bacteria 4791
45 Ga0068852_100030366 3300005616 Bacteria 4448
46 Ga0068852_100126425 3300005616 Bacteria 2348
47 Ga0068852_100686198 3300005616 Bacteria 1033
48 Ga0068864_100117742 3300005618 Bacteria 2372
49 Ga0068866_10015110 3300005718 Bacteria 3425
50 Ga0068861_100052062 3300005719 Bacteria 3110
51 Ga0068851_10018655 3300005834 Bacteria 3344
52 Ga0068863_100008780 3300005841 Bacteria 9869
53 Ga0068863_100046661 3300005841 Bacteria 4112
54 Ga0068858_100001019 3300005842 Bacteria 28891
55 Ga0068860_100000932 3300005843 Bacteria 32353
56 Ga0068862_100080649 3300005844 Bacteria 2822
57 Ga0081455_10123446 3300005937 Bacteria 2037
58 Ga0081455_10242145 3300005937 Bacteria 1325
59 Ga0081540_1000178 3300005983 Bacteria 66386
60 Ga0081540_1000766 3300005983 Bacteria 29582
61 Ga0081540_1003843 3300005983 Bacteria 11743
62 Ga0081540_1004935 3300005983 Bacteria 10034
63 Ga0081540_1005466 3300005983 Bacteria 9479
64 Ga0081539_10096549 3300005985 Bacteria 1515
65 Ga0070717_10020448 3300006028 Bacteria 5206
66 Ga0075363_100001498 3300006048 Bacteria 8906
67 Ga0075363_100117766 3300006048 Bacteria 1481
68 Ga0075364_10004134 3300006051 Bacteria 8328
69 Ga0070715_10006309 3300006163 Bacteria 4022
70 Ga0070716_100016776 3300006173 Bacteria 3786
71 Ga0070716_100289618 3300006173 Bacteria 1134
72 Ga0075362_10002227 3300006177 Bacteria 6445
73 Ga0075367_10082702 3300006178 Bacteria 1944
74 Ga0075366_10028952 3300006195 Bacteria 3252
75 Ga0097621_100133049 3300006237 Bacteria 2118
76 Ga0097621_100191884 3300006237 Bacteria 1769
77 Ga0075370_10079879 3300006353 Bacteria 1879
78 Ga0068871_100009304 3300006358 Bacteria 7110
79 Ga0075428_100311125 3300006844 Bacteria 1693
80 Ga0075431_100062977 3300006847 Bacteria 3827
81 Ga0075431_100100818 3300006847 Bacteria 2980
82 Ga0105245_10903349 3300009098 Bacteria 925
83 Ga0105241_10324910 3300009174 Bacteria 1328
84 Ga0105242_10011327 3300009176 Bacteria 6854
85 Ga0105248_10123629 3300009177 Bacteria 2919
86 Ga0105248_10143512 3300009177 Bacteria 2694
87 Ga0105237_10085369 3300009545 Bacteria 3147
88 Ga0105238_10044708 3300009551 Bacteria 4477
89 Ga0105238_10053806 3300009551 Bacteria 4045
90 Ga0105238_10224644 3300009551 Bacteria 1854
91 Ga0105249_10035639 3300009553 Bacteria 4512
92 Ga0105249_10135402 3300009553 Bacteria 2356
93 Ga0105239_10086262 3300010375 Bacteria 3460
94 Ga0157370_10004885 3300013104 Bacteria 15203
95 Ga0157369_10000308 3300013105 Bacteria 65409
96 Ga0157369_10443290 3300013105 Bacteria 1345
97 Ga0157374_10580516 3300013296 Bacteria 1130
98 Ga0163162_10007006 3300013306 Bacteria 10935
99 Ga0163162_10029215 3300013306 Bacteria 5455
100 Ga0157375_10004636 3300013308 Bacteria 11946
101 Ga0163163_10289200 3300014325 Bacteria 1691
102 Ga0157380_10002941 3300014326 Bacteria 11583
103 Ga0157379_10012854 3300014968 Bacteria 7321
104 Ga0157379_10094340 3300014968 Bacteria 2685
105 Ga0157376_10082962 3300014969 Bacteria 2756
106 Ga0163161_10007488 3300017792 Bacteria 7545
107 Ga0207656_10199664 3300025321 Bacteria 966
108 Ga0207692_10112803 3300025898 Bacteria 1510
109 Ga0207680_10016768 3300025903 Bacteria 3854
110 Ga0207699_10068203 3300025906 Bacteria 2165
111 Ga0207645_10001649 3300025907 Bacteria 18179
112 Ga0207705_10142525 3300025909 Bacteria 1790
113 Ga0207684_10033867 3300025910 Bacteria 4345
114 Ga0207671_10156732 3300025914 Bacteria 1762
115 Ga0207662_10009456 3300025918 Bacteria 5365
116 Ga0207657_10131612 3300025919 Bacteria 2050
117 Ga0207649_10056296 3300025920 Bacteria 2455
118 Ga0207681_10000549 3300025923 Bacteria 25898
119 Ga0207694_10014081 3300025924 Bacteria 6029
120 Ga0207694_10153714 3300025924 Bacteria 1855
121 Ga0207650_10014959 3300025925 Bacteria 5398
122 Ga0207659_10200687 3300025926 Bacteria 1593
123 Ga0207644_10000317 3300025931 Bacteria 31456
124 Ga0207644_10376044 3300025931 Bacteria 1158
125 Ga0207690_10025763 3300025932 Bacteria 3697
126 Ga0207690_10056064 3300025932 Bacteria 2657
127 Ga0207706_10012035 3300025933 Bacteria 7883
128 Ga0207686_10004448 3300025934 Bacteria 7511
129 Ga0207709_10009424 3300025935 Bacteria 5372
130 Ga0207670_10068666 3300025936 Bacteria 2443
131 Ga0207704_10091414 3300025938 Bacteria 2000
132 Ga0207665_10009090 3300025939 Bacteria 6524
133 Ga0207711_10011417 3300025941 Bacteria 7384
134 Ga0207711_10016161 3300025941 Bacteria 6195
135 Ga0207689_10002306 3300025942 Bacteria 17864
136 Ga0207661_10322256 3300025944 Bacteria 1389
137 Ga0207679_10035122 3300025945 Bacteria 3543
138 Ga0207679_10061078 3300025945 Bacteria 2804
139 Ga0207667_10296177 3300025949 Bacteria 1653
140 Ga0207651_10005443 3300025960 Bacteria 6535
141 Ga0207712_10020366 3300025961 Bacteria 4343
142 Ga0207712_10085302 3300025961 Bacteria 2310
143 Ga0207658_10000522 3300025986 Bacteria 35086
144 Ga0207677_10105188 3300026023 Bacteria 2088
145 Ga0207703_10000176 3300026035 Bacteria 74238
146 Ga0207639_10329050 3300026041 Bacteria 1359
147 Ga0207678_10020746 3300026067 Bacteria 5759
148 Ga0207708_10031213 3300026075 Bacteria 4043
149 Ga0207641_10004775 3300026088 Bacteria 11689
150 Ga0207676_10026840 3300026095 Bacteria 4284
151 Ga0207676_10089640 3300026095 Bacteria 2521
152 Ga0207675_100016813 3300026118 Bacteria 6834
153 Ga0207675_100123371 3300026118 Bacteria 2452
154 Ga0207698_10033706 3300026142 Bacteria 3724
155 Ga0207698_10071916 3300026142 Bacteria 2747
156 Ga0207698_10190680 3300026142 Bacteria 1825
157 Ga0268266_10521350 3300028379 Bacteria 1136
158 Ga0268265_10008704 3300028380 Bacteria 6862
159 Ga0268264_10000951 3300028381 Bacteria 29911
160 Ga0307509_10018838 3300031507 Bacteria 7898
161 Ga0307408_100037531 3300031548 Bacteria 3414
162 Ga0307405_10029883 3300031731 Bacteria 3189
163 Ga0307405_10048080 3300031731 Bacteria 2629
164 Ga0307410_10055034 3300031852 Bacteria 2700
165 Ga0307410_10066327 3300031852 Bacteria 2486
166 Ga0307406_10231121 3300031901 Bacteria 1381
167 Ga0307407_10190748 3300031903 Bacteria 1366
168 Ga0307407_10367522 3300031903 Bacteria 1023
169 Ga0307412_10027299 3300031911 Bacteria 3558
170 Ga0307412_10079559 3300031911 Bacteria 2262
171 Ga0307409_100079009 3300031995 Bacteria 2649
172 Ga0307409_100160794 3300031995 Bacteria 1964
173 Ga0307416_100050889 3300032002 Bacteria 3305
174 Ga0307414_10042221 3300032004 Bacteria 3097
175 Ga0307415_100000821 3300032126 Bacteria 14198
176 Ga0307415_100034477 3300032126 Bacteria 3296
177 Ga0307415_100135304 3300032126 Bacteria 1873
178 Ga0373943_0016860 3300035170 Bacteria 3338
179 Ga0373955_0138620 3300035172 Bacteria 1425
180 Ga0373924_0077473 3300035410 Bacteria 1410
181 Ga0373933_0231428 3300035724 Bacteria 1187
182 Ga0373925_0076419 3300037068 Bacteria 2539
183 Ga0395900_0030291 3300037418 Bacteria 5555
184 Ga0395901_0107366 3300038443 Bacteria 2930
185 Ga0436363_0119989 3300039450 Bacteria 2371
186 Ga0466964_0031673 3300044706 Bacteria 2099
187 Ga0466957_0056695 3300044842 Bacteria 2396
188 Ga0466967_0023499 3300045976 Bacteria 5052
189 Ga0495629_0110232 3300046459 Bacteria 1919
190 Ga0495629_0169628 3300046459 Bacteria 1515
191 Ga0495580_0019938 3300046472 Bacteria 4971
192 Ga0495580_0177157 3300046472 Bacteria 1473
193 Ga0495639_0003831 3300046475 Bacteria 6458
194 Ga0495628_0190873 3300046516 Bacteria 1547
195 Ga0495630_0245892 3300046517 Bacteria 1367
196 Ga0495665_0006873 3300046531 Bacteria 6140
197 Ga0495586_0063865 3300046535 Bacteria 2006
198 Ga0495587_0182979 3300046536 Bacteria 1188
199 Ga0495598_0008475 3300046537 Bacteria 2397
200 Ga0495645_0210454 3300046543 Bacteria 1313
201 Ga0495667_0193888 3300046559 Bacteria 1301
202 Ga0495647_0019340 3300046681 Bacteria 2434
203 Ga0495647_0131620 3300046681 Bacteria 1060
204 Ga0495658_0001293 3300046683 Bacteria 13116
205 Ga0495658_0129515 3300046683 Bacteria 1534
206 Ga0495613_0274010 3300046689 Bacteria 1173
207 Ga0495684_0065755 3300047471 Bacteria 2757
208 Ga0495684_0205464 3300047471 Bacteria 1450
209 Ga0495684_0257523 3300047471 Bacteria 1267
210 Ga0495602_0308791 3300048088 Bacteria 1155
211 Ga0496104_0000005 3300048907 Bacteria 620360
212 Ga0496104_0000206 3300048907 Bacteria 52627
213 Ga0496104_0060596 3300048907 Bacteria 3585
214 Ga0496105_0000018 3300048908 Bacteria 197208
215 Ga0496105_0152374 3300048908 Bacteria 1900
216 Ga0496105_0231772 3300048908 Bacteria 1500
217 Ga0496108_0418139 3300048911 Bacteria 1171
218 Ga0496108_0497370 3300048911 Bacteria 1065
219 Ga0496108_0589111 3300048911 Bacteria 969
220 Ga0496110_0197554 3300048913 Bacteria 1827
221 Ga0496112_0019681 3300048915 Bacteria 6378
222 Ga0496113_0070162 3300048916 Bacteria 2663
223 Ga0496114_0015985 3300048917 Bacteria 6039
224 Ga0496115_0087770 3300048918 Bacteria 2538
225 Ga0496115_0133921 3300048918 Bacteria 2043
226 Ga0501031_0017276 3300049568 Bacteria 4688
227 Ga0501031_0178892 3300049568 Bacteria 1386
228 Ga0501032_0185091 3300049569 Bacteria 1362
229 Ga0501033_0015218 3300049570 Bacteria 5837
230 Ga0501034_0022766 3300049571 Bacteria 6382
231 Ga0501034_0032374 3300049571 Bacteria 5311
232 Ga0501036_0197368 3300049572 Bacteria 1693
233 Ga0501037_0016589 3300049573 Bacteria 5420
234 Ga0501037_0090016 3300049573 Bacteria 2220
235 Ga0501038_0009497 3300049574 Bacteria 8925
236 Ga0501038_0162554 3300049574 Bacteria 1813
237 Ga0501039_0015876 3300049575 Bacteria 5766
238 Ga0501039_0279169 3300049575 Bacteria 1313
239 Ga0501040_0112523 3300049576 Bacteria 1904
240 Ga0501042_0012473 3300049578 Bacteria 5759
241 Ga0501043_0014338 3300049579 Bacteria 6203
242 Ga0501043_0235346 3300049579 Bacteria 1413
243 Ga0501043_0297376 3300049579 Bacteria 1234
244 Ga0501046_0037553 3300049580 Bacteria 3891
245 Ga0501046_0189564 3300049580 Bacteria 1534
246 Ga0501047_0030661 3300049581 Bacteria 5183
247 Ga0501047_0106419 3300049581 Bacteria 2685
248 Ga0501047_0143583 3300049581 Bacteria 2265
249 Ga0501048_0079815 3300049582 Bacteria 2309
250 Ga0501067_0088471 3300049583 Bacteria 1719
251 Ga0501067_0098019 3300049583 Bacteria 1628
252 Ga0501067_0119250 3300049583 Bacteria 1467
253 Ga0501070_0065774 3300049586 Bacteria 3002
254 Ga0501071_0187893 3300049587 Bacteria 1549
255 Ga0501072_0036962 3300049588 Bacteria 3830
256 Ga0501073_0004951 3300049589 Bacteria 9996
257 Ga0501073_0009289 3300049589 Bacteria 7253
258 Ga0501075_0060435 3300049591 Bacteria 2855
259 Ga0501075_0287548 3300049591 Bacteria 1253
260 Ga0501076_0498837 3300049592 Bacteria 1003
261 Ga0501077_0110172 3300049593 Bacteria 1744
262 Ga0501079_0157441 3300049741 Bacteria 1771
263 Ga0501079_0351843 3300049741 Bacteria 1154
264 Ga0501080_0012761 3300049742 Bacteria 7707
265 Ga0501080_0033198 3300049742 Bacteria 4817
266 Ga0501081_0124509 3300049743 Bacteria 1838
267 Ga0501083_0027166 3300049744 Bacteria 3950
268 Ga0501083_0082508 3300049744 Bacteria 2130
269 Ga0501263_005632 3300049760 Bacteria 1420
270 Ga0501035_0313077 3300049822 Bacteria 1320
271 Ga0501044_0013031 3300049823 Bacteria 8998
272 Ga0501045_0069264 3300049824 Bacteria 2593
273 Ga0501045_0125141 3300049824 Bacteria 1909
274 nmdc:mga03683_8333_c1 3300050489 Bacteria 3640
275 nmdc:mga03n38_61848_c1 3300050490 Bacteria 1706
276 nmdc:mga00v17_6535_c1 3300050491 Bacteria 6190
277 nmdc:mga0k408_145943_c1 3300050493 Bacteria 1409
278 nmdc:mga0k408_24218_c1 3300050493 Bacteria 3430
279 nmdc:mga06z11_140665_c1 3300050494 Bacteria 1364
280 nmdc:mga0sz30_116428_c1 3300050516 Bacteria 1173
281 Ga0495595_0192748 3300053084 Bacteria 1013
282 Ga0495619_0076218 3300053085 Bacteria 2251
283 Ga0500643_000006 3300053087 Bacteria 479605
284 Ga0501084_0256221 3300054114 Bacteria 1477
285 Ga0501084_0273394 3300054114 Bacteria 1426
286 Ga0501084_0286554 3300054114 Bacteria 1391
287 Ga0501084_0317441 3300054114 Bacteria 1316
288 Ga0501082_0012903 3300060353 Bacteria 7182
289 Ga0501082_0214898 3300060353 Bacteria 1673
290 Ga0501082_0259370 3300060353 Bacteria 1512
291 Ga0530510_0023814 3300061734 Bacteria 4365
292 Ga0530510_0214706 3300061734 Bacteria 1429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049760 Ga0501263_005632 Ga0501263_005632_57_824 254
2 3300050493 nmdc:mga0k408_145943_c1 nmdc:mga0k408_145943_c1_36_821 261
3 3300047471 Ga0495684_0065755 Ga0495684_0065755_659_1447 262
4 3300009551 Ga0105238_10224644 Ga0105238_102246443 264
5 3300025924 Ga0207694_10153714 Ga0207694_101537143 264
6 3300005355 Ga0070671_100230444 Ga0070671_1002304443 265
7 3300032126 Ga0307415_100034477 Ga0307415_1000344772 266
8 3300005333 Ga0070677_10137921 Ga0070677_101379212 267
9 3300025931 Ga0207644_10376044 Ga0207644_103760441 267
10 3300048911 Ga0496108_0497370 Ga0496108_0497370_178_987 267
11 3300005328 Ga0070676_10001400 Ga0070676_100014007 268
12 3300005330 Ga0070690_100007299 Ga0070690_1000072993 268
13 3300005331 Ga0070670_100018036 Ga0070670_1000180364 268
14 3300005334 Ga0068869_100007174 Ga0068869_1000071745 268
15 3300005335 Ga0070666_10020541 Ga0070666_100205413 268
16 3300005343 Ga0070687_100005132 Ga0070687_1000051324 268
17 3300005355 Ga0070671_100000285 Ga0070671_10000028515 268
18 3300005355 Ga0070671_100310351 Ga0070671_1003103511 268
19 3300005364 Ga0070673_100035254 Ga0070673_1000352544 268
20 3300005364 Ga0070673_100071492 Ga0070673_1000714921 268
21 3300005364 Ga0070673_100104238 Ga0070673_1001042383 268
22 3300005441 Ga0070700_100005120 Ga0070700_1000051207 268
23 3300005456 Ga0070678_100050072 Ga0070678_1000500723 268
24 3300005456 Ga0070678_100068096 Ga0070678_1000680962 268
25 3300005543 Ga0070672_100248546 Ga0070672_1002485462 268
26 3300005548 Ga0070665_100302396 Ga0070665_1003023962 268
27 3300005564 Ga0070664_100080306 Ga0070664_1000803063 268
28 3300005564 Ga0070664_100299278 Ga0070664_1002992782 268
29 3300005616 Ga0068852_100025497 Ga0068852_1000254973 268
30 3300005616 Ga0068852_100126425 Ga0068852_1001264252 268
31 3300005616 Ga0068852_100686198 Ga0068852_1006861982 268
32 3300005618 Ga0068864_100117742 Ga0068864_1001177422 268
33 3300005718 Ga0068866_10015110 Ga0068866_100151102 268
34 3300005834 Ga0068851_10018655 Ga0068851_100186552 268
35 3300005841 Ga0068863_100008780 Ga0068863_1000087805 268
36 3300005841 Ga0068863_100046661 Ga0068863_1000466613 268
37 3300005842 Ga0068858_100001019 Ga0068858_10000101912 268
38 3300005843 Ga0068860_100000932 Ga0068860_10000093221 268
39 3300005844 Ga0068862_100080649 Ga0068862_1000806492 268
40 3300006237 Ga0097621_100133049 Ga0097621_1001330492 268
41 3300006237 Ga0097621_100191884 Ga0097621_1001918842 268
42 3300006358 Ga0068871_100009304 Ga0068871_1000093044 268
43 3300009098 Ga0105245_10903349 Ga0105245_109033491 268
44 3300009177 Ga0105248_10123629 Ga0105248_101236293 268
45 3300009177 Ga0105248_10143512 Ga0105248_101435122 268
46 3300009553 Ga0105249_10035639 Ga0105249_100356394 268
47 3300013306 Ga0163162_10007006 Ga0163162_100070066 268
48 3300013308 Ga0157375_10004636 Ga0157375_100046368 268
49 3300014325 Ga0163163_10289200 Ga0163163_102892002 268
50 3300014326 Ga0157380_10002941 Ga0157380_100029415 268
51 3300014968 Ga0157379_10012854 Ga0157379_100128545 268
52 3300014968 Ga0157379_10094340 Ga0157379_100943402 268
53 3300014969 Ga0157376_10082962 Ga0157376_100829623 268
54 3300017792 Ga0163161_10007488 Ga0163161_100074885 268
55 3300025321 Ga0207656_10199664 Ga0207656_101996641 268
56 3300025903 Ga0207680_10016768 Ga0207680_100167684 268
57 3300025907 Ga0207645_10001649 Ga0207645_1000164911 268
58 3300025909 Ga0207705_10142525 Ga0207705_101425252 268
59 3300025918 Ga0207662_10009456 Ga0207662_100094564 268
60 3300025923 Ga0207681_10000549 Ga0207681_1000054919 268
61 3300025925 Ga0207650_10014959 Ga0207650_100149593 268
62 3300025926 Ga0207659_10200687 Ga0207659_102006872 268
63 3300025931 Ga0207644_10000317 Ga0207644_1000031715 268
64 3300025932 Ga0207690_10056064 Ga0207690_100560643 268
65 3300025933 Ga0207706_10012035 Ga0207706_100120356 268
66 3300025935 Ga0207709_10009424 Ga0207709_100094244 268
67 3300025936 Ga0207670_10068666 Ga0207670_100686662 268
68 3300025941 Ga0207711_10011417 Ga0207711_100114174 268
69 3300025941 Ga0207711_10016161 Ga0207711_100161616 268
70 3300025942 Ga0207689_10002306 Ga0207689_100023065 268
71 3300025945 Ga0207679_10061078 Ga0207679_100610783 268
72 3300025960 Ga0207651_10005443 Ga0207651_100054436 268
73 3300025961 Ga0207712_10020366 Ga0207712_100203662 268
74 3300025986 Ga0207658_10000522 Ga0207658_100005228 268
75 3300026023 Ga0207677_10105188 Ga0207677_101051882 268
76 3300026035 Ga0207703_10000176 Ga0207703_1000017642 268
77 3300026067 Ga0207678_10020746 Ga0207678_100207465 268
78 3300026075 Ga0207708_10031213 Ga0207708_100312132 268
79 3300026088 Ga0207641_10004775 Ga0207641_100047757 268
80 3300026095 Ga0207676_10026840 Ga0207676_100268403 268
81 3300026095 Ga0207676_10089640 Ga0207676_100896403 268
82 3300026118 Ga0207675_100016813 Ga0207675_1000168133 268
83 3300026142 Ga0207698_10071916 Ga0207698_100719161 268
84 3300026142 Ga0207698_10190680 Ga0207698_101906803 268
85 3300028379 Ga0268266_10521350 Ga0268266_105213502 268
86 3300028380 Ga0268265_10008704 Ga0268265_100087042 268
87 3300028381 Ga0268264_10000951 Ga0268264_1000095115 268
88 3300031731 Ga0307405_10029883 Ga0307405_100298832 268
89 3300031901 Ga0307406_10231121 Ga0307406_102311211 268
90 3300031903 Ga0307407_10367522 Ga0307407_103675222 268
91 3300031911 Ga0307412_10027299 Ga0307412_100272992 268
92 3300031995 Ga0307409_100079009 Ga0307409_1000790091 268
93 3300032002 Ga0307416_100050889 Ga0307416_1000508894 268
94 3300032004 Ga0307414_10042221 Ga0307414_100422212 268
95 3300032126 Ga0307415_100000821 Ga0307415_1000008219 268
96 3300035170 Ga0373943_0016860 Ga0373943_0016860_819_1628 268
97 3300035172 Ga0373955_0138620 Ga0373955_0138620_349_1158 268
98 3300035724 Ga0373933_0231428 Ga0373933_0231428_311_1120 268
99 3300037068 Ga0373925_0076419 Ga0373925_0076419_874_1683 268
100 3300046459 Ga0495629_0110232 Ga0495629_0110232_201_1010 268
101 3300046472 Ga0495580_0177157 Ga0495580_0177157_223_1032 268
102 3300046516 Ga0495628_0190873 Ga0495628_0190873_291_1100 268
103 3300046517 Ga0495630_0245892 Ga0495630_0245892_255_1064 268
104 3300046536 Ga0495587_0182979 Ga0495587_0182979_43_852 268
105 3300046537 Ga0495598_0008475 Ga0495598_0008475_1388_2197 268
106 3300046543 Ga0495645_0210454 Ga0495645_0210454_77_886 268
107 3300046559 Ga0495667_0193888 Ga0495667_0193888_285_1094 268
108 3300046681 Ga0495647_0131620 Ga0495647_0131620_236_1045 268
109 3300046683 Ga0495658_0129515 Ga0495658_0129515_89_898 268
110 3300046689 Ga0495613_0274010 Ga0495613_0274010_140_949 268
111 3300047471 Ga0495684_0205464 Ga0495684_0205464_257_1066 268
112 3300048911 Ga0496108_0418139 Ga0496108_0418139_103_912 268
113 3300048911 Ga0496108_0589111 Ga0496108_0589111_87_896 268
114 3300048917 Ga0496114_0015985 Ga0496114_0015985_3293_4102 268
115 3300053084 Ga0495595_0192748 Ga0495595_0192748_172_981 268
116 3300053085 Ga0495619_0076218 Ga0495619_0076218_817_1626 268
117 3300031507 Ga0307509_10018838 Ga0307509_100188381 269
118 3300048918 Ga0496115_0087770 Ga0496115_0087770_401_1219 269
119 3300005458 Ga0070681_10322964 Ga0070681_103229641 271
120 3300005290 Ga0065712_10084010 Ga0065712_100840103 273
121 3300005295 Ga0065707_10165528 Ga0065707_101655282 273
122 3300005331 Ga0070670_100012523 Ga0070670_1000125235 273
123 3300005344 Ga0070661_100178925 Ga0070661_1001789252 273
124 3300005548 Ga0070665_100393256 Ga0070665_1003932562 273
125 3300005719 Ga0068861_100052062 Ga0068861_1000520624 273
126 3300005983 Ga0081540_1005466 Ga0081540_10054661 273
127 3300005985 Ga0081539_10096549 Ga0081539_100965492 273
128 3300025920 Ga0207649_10056296 Ga0207649_100562962 273
129 3300025945 Ga0207679_10035122 Ga0207679_100351223 273
130 3300026118 Ga0207675_100123371 Ga0207675_1001233714 273
131 3300031548 Ga0307408_100037531 Ga0307408_1000375313 273
132 3300031731 Ga0307405_10048080 Ga0307405_100480802 273
133 3300031852 Ga0307410_10055034 Ga0307410_100550342 273
134 3300031911 Ga0307412_10079559 Ga0307412_100795592 273
135 3300032126 Ga0307415_100135304 Ga0307415_1001353042 273
136 3300048913 Ga0496110_0197554 Ga0496110_0197554_652_1479 273
137 3300049587 Ga0501071_0187893 Ga0501071_0187893_102_926 273
138 3300003659 JGI25404J52841_10045760 JGI25404J52841_100457601 274
139 3300005339 Ga0070660_100137715 Ga0070660_1001377152 274
140 3300005366 Ga0070659_100039381 Ga0070659_1000393812 274
141 3300005436 Ga0070713_100067190 Ga0070713_1000671903 274
142 3300005437 Ga0070710_10000838 Ga0070710_100008388 274
143 3300005439 Ga0070711_100100264 Ga0070711_1001002642 274
144 3300005539 Ga0068853_100029539 Ga0068853_1000295393 274
145 3300005563 Ga0068855_100762304 Ga0068855_1007623041 274
146 3300005937 Ga0081455_10123446 Ga0081455_101234462 274
147 3300005937 Ga0081455_10242145 Ga0081455_102421452 274
148 3300005983 Ga0081540_1003843 Ga0081540_10038439 274
149 3300005983 Ga0081540_1004935 Ga0081540_10049354 274
150 3300006173 Ga0070716_100016776 Ga0070716_1000167765 274
151 3300006173 Ga0070716_100289618 Ga0070716_1002896181 274
152 3300006847 Ga0075431_100100818 Ga0075431_1001008184 274
153 3300009174 Ga0105241_10324910 Ga0105241_103249101 274
154 3300009176 Ga0105242_10011327 Ga0105242_100113277 274
155 3300009545 Ga0105237_10085369 Ga0105237_100853692 274
156 3300009551 Ga0105238_10053806 Ga0105238_100538065 274
157 3300009553 Ga0105249_10135402 Ga0105249_101354022 274
158 3300010375 Ga0105239_10086262 Ga0105239_100862623 274
159 3300013105 Ga0157369_10000308 Ga0157369_1000030823 274
160 3300013306 Ga0163162_10029215 Ga0163162_100292158 274
161 3300025898 Ga0207692_10112803 Ga0207692_101128031 274
162 3300025914 Ga0207671_10156732 Ga0207671_101567322 274
163 3300025919 Ga0207657_10131612 Ga0207657_101316122 274
164 3300025924 Ga0207694_10014081 Ga0207694_100140812 274
165 3300025932 Ga0207690_10025763 Ga0207690_100257632 274
166 3300025934 Ga0207686_10004448 Ga0207686_1000444810 274
167 3300025938 Ga0207704_10091414 Ga0207704_100914142 274
168 3300025939 Ga0207665_10009090 Ga0207665_100090904 274
169 3300025961 Ga0207712_10085302 Ga0207712_100853022 274
170 3300026041 Ga0207639_10329050 Ga0207639_103290502 274
171 3300035410 Ga0373924_0077473 Ga0373924_0077473_531_1367 274
172 3300039450 Ga0436363_0119989 Ga0436363_0119989_350_1174 274
173 3300046459 Ga0495629_0169628 Ga0495629_0169628_66_902 274
174 3300046472 Ga0495580_0019938 Ga0495580_0019938_3874_4710 274
175 3300046475 Ga0495639_0003831 Ga0495639_0003831_3423_4259 274
176 3300046531 Ga0495665_0006873 Ga0495665_0006873_4683_5519 274
177 3300046535 Ga0495586_0063865 Ga0495586_0063865_512_1348 274
178 3300046681 Ga0495647_0019340 Ga0495647_0019340_1451_2287 274
179 3300046683 Ga0495658_0001293 Ga0495658_0001293_7641_8477 274
180 3300047471 Ga0495684_0257523 Ga0495684_0257523_222_1058 274
181 3300048088 Ga0495602_0308791 Ga0495602_0308791_247_1083 274
182 3300048907 Ga0496104_0000005 Ga0496104_0000005_460440_461276 274
183 3300048908 Ga0496105_0000018 Ga0496105_0000018_155149_155985 274
184 3300049568 Ga0501031_0017276 Ga0501031_0017276_3150_3977 274
185 3300049571 Ga0501034_0022766 Ga0501034_0022766_1596_2423 274
186 3300049571 Ga0501034_0032374 Ga0501034_0032374_3730_4563 274
187 3300049572 Ga0501036_0197368 Ga0501036_0197368_126_1055 274
188 3300049573 Ga0501037_0016589 Ga0501037_0016589_4256_5083 274
189 3300049574 Ga0501038_0162554 Ga0501038_0162554_824_1651 274
190 3300049575 Ga0501039_0279169 Ga0501039_0279169_68_1000 274
191 3300049576 Ga0501040_0112523 Ga0501040_0112523_20_847 274
192 3300049578 Ga0501042_0012473 Ga0501042_0012473_3102_3929 274
193 3300049579 Ga0501043_0014338 Ga0501043_0014338_3885_4712 274
194 3300049579 Ga0501043_0297376 Ga0501043_0297376_397_1224 274
195 3300049580 Ga0501046_0037553 Ga0501046_0037553_603_1430 274
196 3300049580 Ga0501046_0189564 Ga0501046_0189564_249_1181 274
197 3300049581 Ga0501047_0030661 Ga0501047_0030661_3804_4631 274
198 3300049581 Ga0501047_0143583 Ga0501047_0143583_97_927 274
199 3300049583 Ga0501067_0119250 Ga0501067_0119250_550_1377 274
200 3300049588 Ga0501072_0036962 Ga0501072_0036962_2203_3030 274
201 3300049589 Ga0501073_0009289 Ga0501073_0009289_4955_5782 274
202 3300049591 Ga0501075_0060435 Ga0501075_0060435_1671_2498 274
203 3300049593 Ga0501077_0110172 Ga0501077_0110172_229_1158 274
204 3300049741 Ga0501079_0351843 Ga0501079_0351843_259_1086 274
205 3300049742 Ga0501080_0033198 Ga0501080_0033198_281_1108 274
206 3300049743 Ga0501081_0124509 Ga0501081_0124509_283_1215 274
207 3300049744 Ga0501083_0082508 Ga0501083_0082508_221_1054 274
208 3300049823 Ga0501044_0013031 Ga0501044_0013031_7178_8005 274
209 3300049824 Ga0501045_0069264 Ga0501045_0069264_1269_2201 274
210 3300049824 Ga0501045_0125141 Ga0501045_0125141_549_1376 274
211 3300053087 Ga0500643_000006 Ga0500643_000006_281322_282155 274
212 3300054114 Ga0501084_0256221 Ga0501084_0256221_210_1139 274
213 3300054114 Ga0501084_0286554 Ga0501084_0286554_182_1015 274
214 3300060353 Ga0501082_0012903 Ga0501082_0012903_891_1724 274
215 3300060353 Ga0501082_0214898 Ga0501082_0214898_25_852 274
216 3300061734 Ga0530510_0214706 Ga0530510_0214706_262_1194 274
217 3300003659 JGI25404J52841_10007993 JGI25404J52841_100079932 275
218 3300005467 Ga0070706_100083689 Ga0070706_1000836894 275
219 3300005468 Ga0070707_100062600 Ga0070707_1000626002 275
220 3300005535 Ga0070684_100061643 Ga0070684_1000616432 275
221 3300005536 Ga0070697_100132291 Ga0070697_1001322912 275
222 3300005539 Ga0068853_100088118 Ga0068853_1000881183 275
223 3300005563 Ga0068855_100048366 Ga0068855_1000483665 275
224 3300005563 Ga0068855_100354113 Ga0068855_1003541132 275
225 3300005614 Ga0068856_100017094 Ga0068856_10001709411 275
226 3300005616 Ga0068852_100030366 Ga0068852_1000303664 275
227 3300005983 Ga0081540_1000178 Ga0081540_100017835 275
228 3300005983 Ga0081540_1000766 Ga0081540_100076617 275
229 3300006028 Ga0070717_10020448 Ga0070717_100204486 275
230 3300006048 Ga0075363_100001498 Ga0075363_1000014986 275
231 3300006048 Ga0075363_100117766 Ga0075363_1001177661 275
232 3300006051 Ga0075364_10004134 Ga0075364_100041346 275
233 3300006163 Ga0070715_10006309 Ga0070715_100063093 275
234 3300006177 Ga0075362_10002227 Ga0075362_100022272 275
235 3300006178 Ga0075367_10082702 Ga0075367_100827022 275
236 3300006195 Ga0075366_10028952 Ga0075366_100289522 275
237 3300006353 Ga0075370_10079879 Ga0075370_100798792 275
238 3300006844 Ga0075428_100311125 Ga0075428_1003111252 275
239 3300006847 Ga0075431_100062977 Ga0075431_1000629773 275
240 3300009551 Ga0105238_10044708 Ga0105238_100447086 275
241 3300013104 Ga0157370_10004885 Ga0157370_100048854 275
242 3300013105 Ga0157369_10443290 Ga0157369_104432902 275
243 3300013296 Ga0157374_10580516 Ga0157374_105805162 275
244 3300025906 Ga0207699_10068203 Ga0207699_100682031 275
245 3300025910 Ga0207684_10033867 Ga0207684_100338675 275
246 3300025944 Ga0207661_10322256 Ga0207661_103222561 275
247 3300025949 Ga0207667_10296177 Ga0207667_102961772 275
248 3300026142 Ga0207698_10033706 Ga0207698_100337063 275
249 3300031852 Ga0307410_10066327 Ga0307410_100663272 275
250 3300031903 Ga0307407_10190748 Ga0307407_101907482 275
251 3300031995 Ga0307409_100160794 Ga0307409_1001607943 275
252 3300037418 Ga0395900_0030291 Ga0395900_0030291_4651_5478 275
253 3300038443 Ga0395901_0107366 Ga0395901_0107366_170_997 275
254 3300044706 Ga0466964_0031673 Ga0466964_0031673_1102_1929 275
255 3300044842 Ga0466957_0056695 Ga0466957_0056695_366_1193 275
256 3300045976 Ga0466967_0023499 Ga0466967_0023499_3743_4570 275
257 3300048907 Ga0496104_0000206 Ga0496104_0000206_36956_37786 275
258 3300048907 Ga0496104_0060596 Ga0496104_0060596_1358_2188 275
259 3300048908 Ga0496105_0152374 Ga0496105_0152374_743_1573 275
260 3300048908 Ga0496105_0231772 Ga0496105_0231772_460_1290 275
261 3300048915 Ga0496112_0019681 Ga0496112_0019681_4054_4884 275
262 3300048916 Ga0496113_0070162 Ga0496113_0070162_1279_2109 275
263 3300048918 Ga0496115_0133921 Ga0496115_0133921_652_1482 275
264 3300049568 Ga0501031_0178892 Ga0501031_0178892_370_1200 275
265 3300049569 Ga0501032_0185091 Ga0501032_0185091_194_1024 275
266 3300049570 Ga0501033_0015218 Ga0501033_0015218_1406_2236 275
267 3300049573 Ga0501037_0090016 Ga0501037_0090016_60_890 275
268 3300049574 Ga0501038_0009497 Ga0501038_0009497_3742_4572 275
269 3300049575 Ga0501039_0015876 Ga0501039_0015876_189_1019 275
270 3300049579 Ga0501043_0235346 Ga0501043_0235346_243_1073 275
271 3300049581 Ga0501047_0106419 Ga0501047_0106419_1485_2315 275
272 3300049582 Ga0501048_0079815 Ga0501048_0079815_932_1762 275
273 3300049583 Ga0501067_0088471 Ga0501067_0088471_93_920 275
274 3300049583 Ga0501067_0098019 Ga0501067_0098019_346_1176 275
275 3300049586 Ga0501070_0065774 Ga0501070_0065774_746_1576 275
276 3300049589 Ga0501073_0004951 Ga0501073_0004951_4338_5168 275
277 3300049591 Ga0501075_0287548 Ga0501075_0287548_183_1013 275
278 3300049592 Ga0501076_0498837 Ga0501076_0498837_42_872 275
279 3300049741 Ga0501079_0157441 Ga0501079_0157441_776_1606 275
280 3300049742 Ga0501080_0012761 Ga0501080_0012761_193_1023 275
281 3300049744 Ga0501083_0027166 Ga0501083_0027166_2971_3801 275
282 3300049822 Ga0501035_0313077 Ga0501035_0313077_417_1247 275
283 3300050489 nmdc:mga03683_8333_c1 nmdc:mga03683_8333_c1_1759_2586 275
284 3300050490 nmdc:mga03n38_61848_c1 nmdc:mga03n38_61848_c1_707_1534 275
285 3300050491 nmdc:mga00v17_6535_c1 nmdc:mga00v17_6535_c1_5182_6009 275
286 3300050493 nmdc:mga0k408_24218_c1 nmdc:mga0k408_24218_c1_825_1682 275
287 3300050494 nmdc:mga06z11_140665_c1 nmdc:mga06z11_140665_c1_340_1167 275
288 3300050516 nmdc:mga0sz30_116428_c1 nmdc:mga0sz30_116428_c1_176_1003 275
289 3300054114 Ga0501084_0273394 Ga0501084_0273394_11_841 275
290 3300054114 Ga0501084_0317441 Ga0501084_0317441_320_1150 275
291 3300060353 Ga0501082_0259370 Ga0501082_0259370_300_1130 275
292 3300061734 Ga0530510_0023814 Ga0530510_0023814_512_1342 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

58

153

0.98

PF13649

Methyltransf_25

Methyltransferase domain

57

149

0.95

PF13847

Methyltransf_31

Methyltransferase domain

51

168

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

43

178

0.91

PF13489

Methyltransf_23

Methyltransferase domain

38

207

0.89

PF03848

TehB

Tellurite resistance protein TehB

27

152

0.85

PF08242

Methyltransf_12

Methyltransferase domain

58

151

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tma-assembly1.cif.gz_A crystal structure of trmn from thermus thermophilus 0.855 36 156
2nxe-assembly2.cif.gz_B t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine 0.8502 39 151
2zbp-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine 0.8485 39 151
3cjt-assembly7.cif.gz_M ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.8476 38 151
2zbr-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-ornithine 0.8453 38 151
ID Description Score Start End Superfamily
af_P9WLY9_5_208_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9664 23 193 3.40.50.150
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9352 10 274 3.40.50.150
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9317 35 154 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9268 36 80 3.40.50.150
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.925 10 274 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A8B5XBL4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9806 9 274 GO:0008168
GO:0032259
AF-A0A7W0GKN9-F1-model_v4 Methyltransferase domain-containing protein 0.9806 89 272 GO:0008757
GO:0032259
AF-A0A4R2CR44-F1-model_v4 Methyltransferase family protein 0.9776 6 274 GO:0008757
GO:0032259
AF-A0A4R2CR44-F1-model_v4 Methyltransferase family protein 0.967 6 274 GO:0008757
GO:0032259
AF-A0A8B5XBL4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9627 9 274 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.85 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map