F390894

General Info

Members Datasets Scaffolds Average Seq Length
292 182 290 148

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10233618|Ga0114129_102336182
Length 159
Sequence MSPRATYLPEGLPRPVPEPDGLSAPYWEGTQRGELRVQRCRACRAWQWGPEWICHACLSFDLGWETVEGRGTIYSWERVWHPVHPALKNAGPYLVVLVELPHAGNIRMLGNLVGDPQQDVRIGAAVTAVFEPHAAAVGHGGPTAKDPQALFTLVHWRTA

Samples

Sample ID Description Type Environment
1 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.68
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 1.71
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100016588 3300005331 Bacteria 6321
2 Ga0070680_100015181 3300005336 Bacteria 6033
3 Ga0070680_100037709 3300005336 Bacteria 3906
4 Ga0070680_100428597 3300005336 Bacteria 1128
5 Ga0068868_100972928 3300005338 Bacteria 775
6 Ga0070691_10219522 3300005341 Bacteria 1007
7 Ga0070692_10046729 3300005345 Bacteria 2238
8 Ga0070668_100002450 3300005347 Bacteria 13662
9 Ga0070669_100031491 3300005353 Bacteria 3831
10 Ga0070669_100895733 3300005353 Bacteria 758
11 Ga0070709_10002731 3300005434 Bacteria 9544
12 Ga0070709_10993472 3300005434 Unclassified 667
13 Ga0070714_100444463 3300005435 Bacteria 1231
14 Ga0070713_100076673 3300005436 Bacteria 2840
15 Ga0070701_10002676 3300005438 Bacteria 6910
16 Ga0070701_10241933 3300005438 Bacteria 1086
17 Ga0070711_101735822 3300005439 Unclassified 547
18 Ga0070700_100037383 3300005441 Bacteria 2952
19 Ga0070700_100518028 3300005441 Bacteria 921
20 Ga0070694_100075606 3300005444 Bacteria 2330
21 Ga0070694_100121543 3300005444 Bacteria 1874
22 Ga0070694_100631613 3300005444 Bacteria 865
23 Ga0070708_100015215 3300005445 Bacteria 6346
24 Ga0070708_101340244 3300005445 Bacteria 668
25 Ga0070678_101612136 3300005456 Bacteria 609
26 Ga0070706_100046726 3300005467 Bacteria 3996
27 Ga0070706_100383950 3300005467 Bacteria 1308
28 Ga0070707_100057261 3300005468 Bacteria 3738
29 Ga0070707_100299265 3300005468 Bacteria 1563
30 Ga0070698_100613603 3300005471 Bacteria 1028
31 Ga0070698_100622980 3300005471 Bacteria 1020
32 Ga0070699_100048453 3300005518 Bacteria 3678
33 Ga0070699_100206356 3300005518 Bacteria 1748
34 Ga0070699_100277216 3300005518 Bacteria 1502
35 Ga0070699_100317962 3300005518 Bacteria 1399
36 Ga0070679_100304844 3300005530 Bacteria 1543
37 Ga0070697_100245577 3300005536 Bacteria 1530
38 Ga0070697_100591910 3300005536 Bacteria 974
39 Ga0068853_101455878 3300005539 Bacteria 663
40 Ga0070695_100061218 3300005545 Bacteria 2442
41 Ga0070695_100093110 3300005545 Bacteria 2016
42 Ga0070695_100330912 3300005545 Bacteria 1135
43 Ga0070696_100189821 3300005546 Bacteria 1529
44 Ga0070696_100275209 3300005546 Bacteria 1281
45 Ga0070696_100289997 3300005546 Bacteria 1250
46 Ga0070693_100190140 3300005547 Bacteria 1327
47 Ga0070693_100483457 3300005547 Bacteria 875
48 Ga0070704_100133300 3300005549 Bacteria 1929
49 Ga0070704_100171546 3300005549 Bacteria 1726
50 Ga0070704_100200256 3300005549 Bacteria 1611
51 Ga0068856_100360419 3300005614 Bacteria 1473
52 Ga0068859_100002393 3300005617 Bacteria 19096
53 Ga0068859_100379929 3300005617 Bacteria 1508
54 Ga0068859_102424137 3300005617 Bacteria 578
55 Ga0068864_100724640 3300005618 Bacteria 973
56 Ga0068861_101920819 3300005719 Unclassified 589
57 Ga0068863_100688180 3300005841 Bacteria 1016
58 Ga0068863_102247568 3300005841 Bacteria 555
59 Ga0068858_100004782 3300005842 Bacteria 13262
60 Ga0068858_101120814 3300005842 Bacteria 773
61 Ga0068858_101614782 3300005842 Bacteria 640
62 Ga0068860_100009660 3300005843 Bacteria 9582
63 Ga0068860_100016303 3300005843 Bacteria 7245
64 Ga0068862_100004842 3300005844 Bacteria 11337
65 Ga0068862_100480474 3300005844 Bacteria 1176
66 Ga0068862_101375490 3300005844 Bacteria 709
67 Ga0081455_10142715 3300005937 Bacteria 1857
68 Ga0081540_1001427 3300005983 Bacteria 20668
69 Ga0070717_10147062 3300006028 Bacteria 2036
70 Ga0075432_10009475 3300006058 Bacteria 3316
71 Ga0070715_10174369 3300006163 Bacteria 1073
72 Ga0070716_100024890 3300006173 Bacteria 3188
73 Ga0075369_10106725 3300006186 Bacteria 1260
74 Ga0075428_100000409 3300006844 Bacteria 42695
75 Ga0075428_100141015 3300006844 Bacteria 2621
76 Ga0075428_100770701 3300006844 Bacteria 1023
77 Ga0075430_100002238 3300006846 Bacteria 16031
78 Ga0075430_100026944 3300006846 Bacteria 4887
79 Ga0075431_100005898 3300006847 Bacteria 12117
80 Ga0075431_100007730 3300006847 Bacteria 10710
81 Ga0075431_100020004 3300006847 Bacteria 6835
82 Ga0075431_100022135 3300006847 Bacteria 6500
83 Ga0075431_100236989 3300006847 Bacteria 1857
84 Ga0075431_100347007 3300006847 Bacteria 1493
85 Ga0075431_100824921 3300006847 Bacteria 900
86 Ga0075433_10020327 3300006852 Bacteria 5549
87 Ga0075433_10341842 3300006852 Bacteria 1323
88 Ga0075434_100018406 3300006871 Bacteria 6749
89 Ga0075434_100048766 3300006871 Bacteria 4202
90 Ga0075434_100051690 3300006871 Bacteria 4083
91 Ga0075434_100306650 3300006871 Bacteria 1608
92 Ga0075429_100000116 3300006880 Bacteria 45959
93 Ga0075429_100479536 3300006880 Bacteria 1090
94 Ga0097620_100002393 3300006931 Bacteria 19096
95 Ga0097620_100126675 3300006931 Bacteria 2623
96 Ga0097620_100379928 3300006931 Bacteria 1508
97 Ga0097620_102422827 3300006931 Bacteria 578
98 Ga0075435_100013639 3300007076 Bacteria 6054
99 Ga0075435_100483334 3300007076 Bacteria 1070
100 Ga0075435_100951060 3300007076 Bacteria 750
101 Ga0099794_10098579 3300007265 Bacteria 1457
102 Ga0105250_10333966 3300009092 Bacteria 661
103 Ga0111539_10000139 3300009094 Bacteria 82909
104 Ga0111539_10004617 3300009094 Bacteria 17982
105 Ga0111539_10715320 3300009094 Unclassified 1166
106 Ga0111539_10855761 3300009094 Bacteria 1058
107 Ga0114129_10008653 3300009147 Bacteria 14511
108 Ga0114129_10098929 3300009147 Bacteria 4037
109 Ga0114129_10233618 3300009147 Bacteria 2475
110 Ga0114129_10312235 3300009147 Bacteria 2092
111 Ga0114129_10422852 3300009147 Bacteria 1752
112 Ga0105243_10681781 3300009148 Bacteria 999
113 Ga0105242_10012067 3300009176 Bacteria 6649
114 Ga0105242_10324000 3300009176 Bacteria 1414
115 Ga0105248_10005530 3300009177 Bacteria 13879
116 Ga0105249_10108673 3300009553 Bacteria 2619
117 Ga0105249_10477199 3300009553 Bacteria 1289
118 Ga0099796_10339764 3300010159 Bacteria 645
119 Ga0157378_10058495 3300013297 Bacteria 3438
120 Ga0157378_10176240 3300013297 Unclassified 2008
121 Ga0163162_10164939 3300013306 Bacteria 2339
122 Ga0163162_10837371 3300013306 Bacteria 1036
123 Ga0157375_10289860 3300013308 Bacteria 1800
124 Ga0157380_11375748 3300014326 Bacteria 755
125 Ga0224712_10195339 3300022467 Unclassified 918
126 Ga0207692_10029438 3300025898 Bacteria 2610
127 Ga0207699_10472832 3300025906 Bacteria 902
128 Ga0207643_10024876 3300025908 Bacteria 3305
129 Ga0207671_11045380 3300025914 Bacteria 643
130 Ga0207663_10513075 3300025916 Bacteria 933
131 Ga0207663_10581288 3300025916 Bacteria 878
132 Ga0207660_10026293 3300025917 Bacteria 3962
133 Ga0207660_10028190 3300025917 Bacteria 3839
134 Ga0207652_10241933 3300025921 Bacteria 1627
135 Ga0207646_10070191 3300025922 Bacteria 3129
136 Ga0207646_10423050 3300025922 Bacteria 1202
137 Ga0207681_10008502 3300025923 Bacteria 6272
138 Ga0207650_10074468 3300025925 Bacteria 2559
139 Ga0207700_10040344 3300025928 Bacteria 3406
140 Ga0207664_10634196 3300025929 Bacteria 960
141 Ga0207706_10025095 3300025933 Bacteria 5344
142 Ga0207686_10078551 3300025934 Bacteria 2146
143 Ga0207686_10221392 3300025934 Bacteria 1367
144 Ga0207665_10154987 3300025939 Bacteria 1643
145 Ga0207711_10003936 3300025941 Bacteria 12776
146 Ga0207711_10963307 3300025941 Bacteria 792
147 Ga0207703_10119265 3300026035 Bacteria 2263
148 Ga0207708_10068209 3300026075 Bacteria 2722
149 Ga0207702_10499255 3300026078 Bacteria 1186
150 Ga0207641_11088024 3300026088 Bacteria 798
151 Ga0207648_10062440 3300026089 Bacteria 3248
152 Ga0207648_10062534 3300026089 Bacteria 3245
153 Ga0207648_10836375 3300026089 Bacteria 858
154 Ga0207674_10618453 3300026116 Bacteria 1046
155 Ga0207675_100231465 3300026118 Bacteria 1783
156 Ga0207428_10000121 3300027907 Bacteria 106184
157 Ga0207428_10000239 3300027907 Bacteria 75249
158 Ga0207428_10341981 3300027907 Bacteria 1102
159 Ga0268265_10376746 3300028380 Bacteria 1304
160 Ga0268265_10966901 3300028380 Bacteria 840
161 Ga0268264_10030890 3300028381 Bacteria 4392
162 Ga0268264_10036758 3300028381 Bacteria 4035
163 Ga0307516_10000095 3300031730 Bacteria 99115
164 Ga0307410_10380234 3300031852 Unclassified 1136
165 Ga0307412_10471201 3300031911 Unclassified 1039
166 Ga0307409_100946145 3300031995 Bacteria 877
167 Ga0307510_10174231 3300033180 Bacteria 1725
168 Ga0373930_0040490 3300034816 Bacteria 991
169 Ga0373950_0027300 3300034818 Bacteria 1041
170 Ga0373934_0289053 3300035086 Bacteria 679
171 Ga0373940_0010878 3300035088 Bacteria 2150
172 Ga0373940_0022991 3300035088 Bacteria 1606
173 Ga0373940_0055043 3300035088 Bacteria 1126
174 Ga0373949_0019366 3300035090 Bacteria 1550
175 Ga0373932_0111906 3300035112 Bacteria 901
176 Ga0373932_0142675 3300035112 Bacteria 816
177 Ga0373931_0756021 3300035691 Unclassified 645
178 Ga0373935_0279903 3300035692 Bacteria 1174
179 Ga0373933_0581748 3300035724 Bacteria 735
180 Ga0373947_0029492 3300035725 Bacteria 3220
181 Ga0373937_0046950 3300036401 Bacteria 3950
182 Ga0265778_036577 3300036457 Unclassified 647
183 Ga0436362_0738004 3300039453 Bacteria 1163
184 Ga0439441_010859 3300042001 Bacteria 1536
185 Ga0439441_027529 3300042001 Bacteria 1085
186 Ga0439455_0015384 3300042012 Bacteria 1758
187 Ga0439464_0128127 3300042439 Bacteria 785
188 Ga0451577_0000840 3300042876 Bacteria 45907
189 Ga0451577_0353534 3300042876 Bacteria 1333
190 Ga0451577_0393779 3300042876 Bacteria 1257
191 Ga0453683_0029010 3300044673 Bacteria 3501
192 Ga0453684_0015075 3300044712 Bacteria 12265
193 Ga0453684_0491990 3300044712 Bacteria 1359
194 Ga0466957_0705399 3300044842 Bacteria 712
195 Ga0451576_0005029 3300045051 Bacteria 16788
196 Ga0451576_0597796 3300045051 Bacteria 1159
197 Ga0451576_1994691 3300045051 Bacteria 598
198 Ga0466967_2226303 3300045976 Bacteria 544
199 Ga0495592_0026569 3300046454 Bacteria 4388
200 Ga0495653_0092516 3300046463 Bacteria 2208
201 Ga0495580_0013484 3300046472 Bacteria 6235
202 Ga0495664_0004091 3300046477 Bacteria 7959
203 Ga0495584_0114352 3300046491 Bacteria 1366
204 Ga0495608_0025270 3300046511 Bacteria 4054
205 Ga0495618_0026526 3300046514 Bacteria 3604
206 Ga0495628_0048527 3300046516 Bacteria 3365
207 Ga0495642_0070024 3300046528 Bacteria 1466
208 Ga0495640_0080453 3300046533 Bacteria 2167
209 Ga0495587_0004922 3300046536 Bacteria 8754
210 Ga0495645_0001878 3300046543 Bacteria 14299
211 Ga0495633_0513139 3300046558 Unclassified 540
212 Ga0495667_0007707 3300046559 Bacteria 7297
213 Ga0495635_0040385 3300046663 Bacteria 3224
214 Ga0495657_0102846 3300046675 Bacteria 1818
215 Ga0495623_0030994 3300046679 Bacteria 3440
216 Ga0495646_0057025 3300046680 Bacteria 2340
217 Ga0495669_0244371 3300046684 Bacteria 862
218 Ga0495670_0128738 3300046691 Bacteria 1319
219 Ga0495670_0647518 3300046691 Unclassified 576
220 Ga0495600_0048379 3300046809 Bacteria 2774
221 Ga0495604_0016772 3300047317 Bacteria 5860
222 Ga0495674_0065523 3300047319 Bacteria 3155
223 Ga0495680_0387315 3300047322 Bacteria 967
224 Ga0495675_0005170 3300047444 Bacteria 7942
225 Ga0495684_0087280 3300047471 Bacteria 2364
226 Ga0495602_0004556 3300048088 Bacteria 14461
227 Ga0496102_0048337 3300048905 Bacteria 3868
228 Ga0496103_0049248 3300048906 Bacteria 2605
229 Ga0496107_0653268 3300048910 Unclassified 775
230 Ga0496112_0364433 3300048915 Bacteria 1387
231 Ga0496115_0990659 3300048918 Unclassified 643
232 Ga0496126_0059223 3300048929 Bacteria 3449
233 Ga0501033_0974751 3300049570 Bacteria 567
234 Ga0501039_0357219 3300049575 Bacteria 1148
235 Ga0501040_0253701 3300049576 Unclassified 1255
236 Ga0501041_1142926 3300049577 Unclassified 502
237 Ga0501043_0537210 3300049579 Bacteria 870
238 Ga0501046_0434091 3300049580 Bacteria 946
239 Ga0501046_0568891 3300049580 Unclassified 806
240 Ga0501046_0738816 3300049580 Bacteria 692
241 Ga0501048_0347112 3300049582 Bacteria 1058
242 Ga0501068_0398858 3300049584 Bacteria 887
243 Ga0501071_0216207 3300049587 Bacteria 1442
244 Ga0501071_0429349 3300049587 Bacteria 1010
245 Ga0501072_0008919 3300049588 Bacteria 7622
246 Ga0501074_0633225 3300049590 Unclassified 756
247 Ga0501075_0135027 3300049591 Bacteria 1879
248 Ga0501075_0534484 3300049591 Bacteria 895
249 Ga0501077_0165939 3300049593 Bacteria 1403
250 Ga0501079_0728661 3300049741 Bacteria 780
251 Ga0501080_0437827 3300049742 Bacteria 1173
252 Ga0501044_0755508 3300049823 Bacteria 854
253 Ga0501045_0030243 3300049824 Bacteria 3919
254 Ga0501045_0063796 3300049824 Bacteria 2704
255 Ga0501045_0260483 3300049824 Bacteria 1291
256 Ga0501045_0270214 3300049824 Bacteria 1266
257 nmdc:mga05p37_1838258_c1 3300050507 Unclassified 582
258 nmdc:mga05p37_207109_c1 3300050507 Bacteria 2372
259 nmdc:mga05p37_587695_c1 3300050507 Bacteria 1260
260 nmdc:mga05p37_767326_c1 3300050507 Unclassified 1060
261 nmdc:mga05p37_99463_c1 3300050507 Bacteria 3582
262 nmdc:mga09592_1014880_c1 3300050508 Bacteria 693
263 nmdc:mga09592_117892_c1 3300050508 Bacteria 2278
264 nmdc:mga09592_265_c1 3300050508 Bacteria 38165
265 nmdc:mga09592_58840_c1 3300050508 Bacteria 3249
266 nmdc:mga0qj67_161444_c1 3300050509 Bacteria 1819
267 nmdc:mga0qj67_82113_c1 3300050509 Bacteria 2585
268 nmdc:mga06r32_268_c1 3300050510 Bacteria 43133
269 nmdc:mga06r32_31418_c1 3300050510 Bacteria 4988
270 nmdc:mga06r32_375195_c1 3300050510 Bacteria 1405
271 nmdc:mga06r32_482242_c1 3300050510 Bacteria 1218
272 nmdc:mga06r32_99605_c1 3300050510 Bacteria 2851
273 nmdc:mga08y16_215892_c1 3300050511 Bacteria 1986
274 nmdc:mga08y16_2897_c1 3300050511 Bacteria 17642
275 nmdc:mga08y16_38294_c1 3300050511 Bacteria 5036
276 nmdc:mga0n895_12407_c1 3300050512 Bacteria 7644
277 nmdc:mga0n895_259167_c1 3300050512 Bacteria 1765
278 nmdc:mga0n895_53512_c1 3300050512 Bacteria 3966
279 nmdc:mga0a205_1100700_c1 3300050515 Bacteria 642
280 nmdc:mga0a205_208359_c1 3300050515 Bacteria 1844
281 nmdc:mga0a205_610263_c1 3300050515 Bacteria 944
282 nmdc:mga0a205_7983_c1 3300050515 Bacteria 9613
283 Ga0495601_0000652 3300053077 Bacteria 18500
284 Ga0495612_0013561 3300053078 Bacteria 3282
285 Ga0495619_0016886 3300053085 Bacteria 4623
286 Ga0495619_0042618 3300053085 Bacteria 2973
287 Ga0500644_0001241 3300053088 Bacteria 7038
288 Ga0500568_0009486 3300053139 Bacteria 4615
289 Ga0501084_0275891 3300054114 Bacteria 1419
290 Ga0530510_0983783 3300061734 Bacteria 645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100133300 Ga0070704_1001333002 131
2 3300009094 Ga0111539_10715320 Ga0111539_107153201 132
3 3300046691 Ga0495670_0647518 Ga0495670_0647518_30_434 132
4 3300050512 nmdc:mga0n895_12407_c1 nmdc:mga0n895_12407_c1_3511_3915 132
5 3300050515 nmdc:mga0a205_7983_c1 nmdc:mga0a205_7983_c1_4422_4826 132
6 3300049577 Ga0501041_1142926 Ga0501041_1142926_27_470 134
7 3300042001 Ga0439441_010859 Ga0439441_010859_785_1201 136
8 3300042012 Ga0439455_0015384 Ga0439455_0015384_512_928 136
9 3300042439 Ga0439464_0128127 Ga0439464_0128127_195_611 136
10 3300048915 Ga0496112_0364433 Ga0496112_0364433_138_569 138
11 3300005444 Ga0070694_100631613 Ga0070694_1006316132 139
12 3300005617 Ga0068859_102424137 Ga0068859_1024241371 139
13 3300006931 Ga0097620_102422827 Ga0097620_1024228271 139
14 3300005434 Ga0070709_10993472 Ga0070709_109934721 141
15 3300005435 Ga0070714_100444463 Ga0070714_1004444632 141
16 3300022467 Ga0224712_10195339 Ga0224712_101953392 141
17 3300025906 Ga0207699_10472832 Ga0207699_104728322 141
18 3300025929 Ga0207664_10634196 Ga0207664_106341962 141
19 3300048918 Ga0496115_0990659 Ga0496115_0990659_52_483 141
20 3300005338 Ga0068868_100972928 Ga0068868_1009729281 142
21 3300005434 Ga0070709_10002731 Ga0070709_100027318 142
22 3300005436 Ga0070713_100076673 Ga0070713_1000766733 142
23 3300005439 Ga0070711_101735822 Ga0070711_1017358221 142
24 3300005456 Ga0070678_101612136 Ga0070678_1016121362 142
25 3300005614 Ga0068856_100360419 Ga0068856_1003604192 142
26 3300005842 Ga0068858_101120814 Ga0068858_1011208142 142
27 3300005842 Ga0068858_101614782 Ga0068858_1016147822 142
28 3300006028 Ga0070717_10147062 Ga0070717_101470623 142
29 3300006163 Ga0070715_10174369 Ga0070715_101743692 142
30 3300006173 Ga0070716_100024890 Ga0070716_1000248903 142
31 3300009176 Ga0105242_10324000 Ga0105242_103240002 142
32 3300010159 Ga0099796_10339764 Ga0099796_103397641 142
33 3300013306 Ga0163162_10837371 Ga0163162_108373712 142
34 3300025898 Ga0207692_10029438 Ga0207692_100294384 142
35 3300025914 Ga0207671_11045380 Ga0207671_110453802 142
36 3300025916 Ga0207663_10513075 Ga0207663_105130751 142
37 3300025916 Ga0207663_10581288 Ga0207663_105812882 142
38 3300025928 Ga0207700_10040344 Ga0207700_100403442 142
39 3300025934 Ga0207686_10221392 Ga0207686_102213923 142
40 3300025939 Ga0207665_10154987 Ga0207665_101549872 142
41 3300025941 Ga0207711_10963307 Ga0207711_109633072 142
42 3300026035 Ga0207703_10119265 Ga0207703_101192652 142
43 3300026078 Ga0207702_10499255 Ga0207702_104992552 142
44 3300031730 Ga0307516_10000095 Ga0307516_1000009561 142
45 3300033180 Ga0307510_10174231 Ga0307510_101742312 142
46 3300035086 Ga0373934_0289053 Ga0373934_0289053_150_584 142
47 3300035692 Ga0373935_0279903 Ga0373935_0279903_394_828 142
48 3300035724 Ga0373933_0581748 Ga0373933_0581748_35_469 142
49 3300035725 Ga0373947_0029492 Ga0373947_0029492_2125_2559 142
50 3300036401 Ga0373937_0046950 Ga0373937_0046950_3099_3533 142
51 3300036457 Ga0265778_036577 Ga0265778_036577_144_578 142
52 3300045976 Ga0466967_2226303 Ga0466967_2226303_100_534 142
53 3300046454 Ga0495592_0026569 Ga0495592_0026569_3438_3872 142
54 3300046463 Ga0495653_0092516 Ga0495653_0092516_105_539 142
55 3300046477 Ga0495664_0004091 Ga0495664_0004091_6340_6774 142
56 3300046511 Ga0495608_0025270 Ga0495608_0025270_3480_3914 142
57 3300046514 Ga0495618_0026526 Ga0495618_0026526_2444_2878 142
58 3300046516 Ga0495628_0048527 Ga0495628_0048527_2651_3085 142
59 3300046533 Ga0495640_0080453 Ga0495640_0080453_1531_1965 142
60 3300046536 Ga0495587_0004922 Ga0495587_0004922_5109_5543 142
61 3300046543 Ga0495645_0001878 Ga0495645_0001878_13724_14158 142
62 3300046559 Ga0495667_0007707 Ga0495667_0007707_1748_2182 142
63 3300046663 Ga0495635_0040385 Ga0495635_0040385_288_722 142
64 3300046675 Ga0495657_0102846 Ga0495657_0102846_1306_1740 142
65 3300046679 Ga0495623_0030994 Ga0495623_0030994_606_1040 142
66 3300046680 Ga0495646_0057025 Ga0495646_0057025_1257_1691 142
67 3300046809 Ga0495600_0048379 Ga0495600_0048379_18_452 142
68 3300047317 Ga0495604_0016772 Ga0495604_0016772_246_680 142
69 3300047319 Ga0495674_0065523 Ga0495674_0065523_1017_1451 142
70 3300047322 Ga0495680_0387315 Ga0495680_0387315_394_828 142
71 3300047444 Ga0495675_0005170 Ga0495675_0005170_6353_6787 142
72 3300047471 Ga0495684_0087280 Ga0495684_0087280_1867_2301 142
73 3300048088 Ga0495602_0004556 Ga0495602_0004556_4603_5037 142
74 3300053077 Ga0495601_0000652 Ga0495601_0000652_1926_2360 142
75 3300053078 Ga0495612_0013561 Ga0495612_0013561_977_1411 142
76 3300053085 Ga0495619_0016886 Ga0495619_0016886_2474_2908 142
77 3300053085 Ga0495619_0042618 Ga0495619_0042618_17_451 142
78 3300053139 Ga0500568_0009486 Ga0500568_0009486_2024_2458 142
79 3300005353 Ga0070669_100895733 Ga0070669_1008957332 143
80 3300005844 Ga0068862_100480474 Ga0068862_1004804742 143
81 3300039453 Ga0436362_0738004 Ga0436362_0738004_707_1144 143
82 iso_pu_bacteria 2582581311 2585295660 143
83 3300006186 Ga0075369_10106725 Ga0075369_101067252 144
84 3300006844 Ga0075428_100770701 Ga0075428_1007707012 144
85 3300006847 Ga0075431_100022135 Ga0075431_1000221356 144
86 3300006847 Ga0075431_100347007 Ga0075431_1003470072 144
87 3300006871 Ga0075434_100306650 Ga0075434_1003066502 144
88 3300006880 Ga0075429_100479536 Ga0075429_1004795362 144
89 3300009147 Ga0114129_10422852 Ga0114129_104228522 144
90 3300026116 Ga0207674_10618453 Ga0207674_106184532 144
91 3300050508 nmdc:mga09592_117892_c1 nmdc:mga09592_117892_c1_205_648 144
92 3300053088 Ga0500644_0001241 Ga0500644_0001241_3341_3790 144
93 3300005336 Ga0070680_100428597 Ga0070680_1004285972 145
94 3300005341 Ga0070691_10219522 Ga0070691_102195222 145
95 3300005438 Ga0070701_10241933 Ga0070701_102419332 145
96 3300005444 Ga0070694_100075606 Ga0070694_1000756062 145
97 3300005545 Ga0070695_100061218 Ga0070695_1000612183 145
98 3300005546 Ga0070696_100189821 Ga0070696_1001898212 145
99 3300005547 Ga0070693_100190140 Ga0070693_1001901402 145
100 3300005618 Ga0068864_100724640 Ga0068864_1007246402 145
101 3300005841 Ga0068863_102247568 Ga0068863_1022475681 145
102 3300005843 Ga0068860_100016303 Ga0068860_1000163032 145
103 3300007076 Ga0075435_100951060 Ga0075435_1009510601 145
104 3300013297 Ga0157378_10058495 Ga0157378_100584952 145
105 3300026088 Ga0207641_11088024 Ga0207641_110880241 145
106 3300026089 Ga0207648_10062534 Ga0207648_100625342 145
107 3300026089 Ga0207648_10836375 Ga0207648_108363752 145
108 3300026118 Ga0207675_100231465 Ga0207675_1002314652 145
109 3300027907 Ga0207428_10341981 Ga0207428_103419812 145
110 3300028381 Ga0268264_10030890 Ga0268264_100308904 145
111 3300035088 Ga0373940_0055043 Ga0373940_0055043_609_1052 145
112 3300035112 Ga0373932_0111906 Ga0373932_0111906_91_537 145
113 3300044842 Ga0466957_0705399 Ga0466957_0705399_55_498 145
114 3300049570 Ga0501033_0974751 Ga0501033_0974751_50_493 145
115 3300049579 Ga0501043_0537210 Ga0501043_0537210_392_841 145
116 3300049823 Ga0501044_0755508 Ga0501044_0755508_373_822 145
117 3300050511 nmdc:mga08y16_215892_c1 nmdc:mga08y16_215892_c1_693_1136 145
118 3300050512 nmdc:mga0n895_259167_c1 nmdc:mga0n895_259167_c1_369_812 145
119 iso_pu_bacteria 2582581311 2585294958 145
120 3300005336 Ga0070680_100037709 Ga0070680_1000377092 146
121 3300005441 Ga0070700_100518028 Ga0070700_1005180282 146
122 3300005468 Ga0070707_100299265 Ga0070707_1002992652 146
123 3300005471 Ga0070698_100613603 Ga0070698_1006136032 146
124 3300005518 Ga0070699_100206356 Ga0070699_1002063562 146
125 3300005518 Ga0070699_100277216 Ga0070699_1002772162 146
126 3300005530 Ga0070679_100304844 Ga0070679_1003048441 146
127 3300005536 Ga0070697_100591910 Ga0070697_1005919102 146
128 3300005539 Ga0068853_101455878 Ga0068853_1014558781 146
129 3300005545 Ga0070695_100093110 Ga0070695_1000931102 146
130 3300005546 Ga0070696_100289997 Ga0070696_1002899972 146
131 3300005547 Ga0070693_100483457 Ga0070693_1004834572 146
132 3300005549 Ga0070704_100171546 Ga0070704_1001715462 146
133 3300005549 Ga0070704_100200256 Ga0070704_1002002561 146
134 3300005617 Ga0068859_100379929 Ga0068859_1003799292 146
135 3300005719 Ga0068861_101920819 Ga0068861_1019208192 146
136 3300005841 Ga0068863_100688180 Ga0068863_1006881802 146
137 3300005844 Ga0068862_101375490 Ga0068862_1013754902 146
138 3300005983 Ga0081540_1001427 Ga0081540_100142712 146
139 3300006058 Ga0075432_10009475 Ga0075432_100094752 146
140 3300006844 Ga0075428_100141015 Ga0075428_1001410152 146
141 3300006846 Ga0075430_100026944 Ga0075430_1000269443 146
142 3300006847 Ga0075431_100020004 Ga0075431_1000200043 146
143 3300006847 Ga0075431_100236989 Ga0075431_1002369892 146
144 3300006852 Ga0075433_10020327 Ga0075433_100203276 146
145 3300006871 Ga0075434_100018406 Ga0075434_1000184062 146
146 3300006871 Ga0075434_100051690 Ga0075434_1000516905 146
147 3300006931 Ga0097620_100379928 Ga0097620_1003799282 146
148 3300007076 Ga0075435_100013639 Ga0075435_1000136397 146
149 3300007076 Ga0075435_100483334 Ga0075435_1004833342 146
150 3300009094 Ga0111539_10004617 Ga0111539_100046172 146
151 3300009147 Ga0114129_10098929 Ga0114129_100989292 146
152 3300009147 Ga0114129_10233618 Ga0114129_102336182 146
153 3300009553 Ga0105249_10477199 Ga0105249_104771992 146
154 3300013297 Ga0157378_10176240 Ga0157378_101762402 146
155 3300013308 Ga0157375_10289860 Ga0157375_102898602 146
156 3300014326 Ga0157380_11375748 Ga0157380_113757482 146
157 3300025917 Ga0207660_10026293 Ga0207660_100262934 146
158 3300025921 Ga0207652_10241933 Ga0207652_102419332 146
159 3300025922 Ga0207646_10423050 Ga0207646_104230502 146
160 3300027907 Ga0207428_10000121 Ga0207428_1000012181 146
161 3300028380 Ga0268265_10376746 Ga0268265_103767462 146
162 3300034816 Ga0373930_0040490 Ga0373930_0040490_15_464 146
163 3300034818 Ga0373950_0027300 Ga0373950_0027300_277_726 146
164 3300035088 Ga0373940_0010878 Ga0373940_0010878_1680_2129 146
165 3300035088 Ga0373940_0022991 Ga0373940_0022991_244_693 146
166 3300035090 Ga0373949_0019366 Ga0373949_0019366_835_1284 146
167 3300035112 Ga0373932_0142675 Ga0373932_0142675_238_687 146
168 3300035691 Ga0373931_0756021 Ga0373931_0756021_37_486 146
169 3300042876 Ga0451577_0353534 Ga0451577_0353534_715_1164 146
170 3300042876 Ga0451577_0393779 Ga0451577_0393779_158_607 146
171 3300044712 Ga0453684_0491990 Ga0453684_0491990_821_1270 146
172 3300045051 Ga0451576_0597796 Ga0451576_0597796_370_819 146
173 3300045051 Ga0451576_1994691 Ga0451576_1994691_39_488 146
174 3300046472 Ga0495580_0013484 Ga0495580_0013484_616_1065 146
175 3300046491 Ga0495584_0114352 Ga0495584_0114352_595_1044 146
176 3300046528 Ga0495642_0070024 Ga0495642_0070024_504_953 146
177 3300046558 Ga0495633_0513139 Ga0495633_0513139_41_490 146
178 3300046684 Ga0495669_0244371 Ga0495669_0244371_298_744 146
179 3300046691 Ga0495670_0128738 Ga0495670_0128738_587_1036 146
180 3300048905 Ga0496102_0048337 Ga0496102_0048337_1349_1798 146
181 3300048906 Ga0496103_0049248 Ga0496103_0049248_1235_1684 146
182 3300048910 Ga0496107_0653268 Ga0496107_0653268_66_515 146
183 3300049575 Ga0501039_0357219 Ga0501039_0357219_453_902 146
184 3300049576 Ga0501040_0253701 Ga0501040_0253701_22_471 146
185 3300049580 Ga0501046_0434091 Ga0501046_0434091_86_535 146
186 3300049580 Ga0501046_0568891 Ga0501046_0568891_46_495 146
187 3300049580 Ga0501046_0738816 Ga0501046_0738816_44_493 146
188 3300049582 Ga0501048_0347112 Ga0501048_0347112_56_505 146
189 3300049584 Ga0501068_0398858 Ga0501068_0398858_129_578 146
190 3300049587 Ga0501071_0216207 Ga0501071_0216207_632_1081 146
191 3300049587 Ga0501071_0429349 Ga0501071_0429349_184_633 146
192 3300049588 Ga0501072_0008919 Ga0501072_0008919_679_1128 146
193 3300049590 Ga0501074_0633225 Ga0501074_0633225_98_547 146
194 3300049591 Ga0501075_0135027 Ga0501075_0135027_28_477 146
195 3300049591 Ga0501075_0534484 Ga0501075_0534484_51_497 146
196 3300049593 Ga0501077_0165939 Ga0501077_0165939_669_1118 146
197 3300049741 Ga0501079_0728661 Ga0501079_0728661_193_642 146
198 3300049742 Ga0501080_0437827 Ga0501080_0437827_370_819 146
199 3300049824 Ga0501045_0030243 Ga0501045_0030243_232_681 146
200 3300049824 Ga0501045_0063796 Ga0501045_0063796_1026_1475 146
201 3300049824 Ga0501045_0260483 Ga0501045_0260483_784_1233 146
202 3300049824 Ga0501045_0270214 Ga0501045_0270214_191_637 146
203 3300050507 nmdc:mga05p37_587695_c1 nmdc:mga05p37_587695_c1_250_696 146
204 3300050507 nmdc:mga05p37_99463_c1 nmdc:mga05p37_99463_c1_2407_2886 146
205 3300050509 nmdc:mga0qj67_161444_c1 nmdc:mga0qj67_161444_c1_838_1284 146
206 3300050510 nmdc:mga06r32_375195_c1 nmdc:mga06r32_375195_c1_581_1030 146
207 3300050510 nmdc:mga06r32_99605_c1 nmdc:mga06r32_99605_c1_1890_2336 146
208 3300050511 nmdc:mga08y16_2897_c1 nmdc:mga08y16_2897_c1_12560_13009 146
209 3300050515 nmdc:mga0a205_1100700_c1 nmdc:mga0a205_1100700_c1_113_562 146
210 3300050515 nmdc:mga0a205_610263_c1 nmdc:mga0a205_610263_c1_50_499 146
211 3300054114 Ga0501084_0275891 Ga0501084_0275891_941_1390 146
212 3300061734 Ga0530510_0983783 Ga0530510_0983783_154_603 146
213 3300005445 Ga0070708_100015215 Ga0070708_1000152152 147
214 3300005445 Ga0070708_101340244 Ga0070708_1013402442 147
215 3300005467 Ga0070706_100046726 Ga0070706_1000467262 147
216 3300005467 Ga0070706_100383950 Ga0070706_1003839502 147
217 3300005468 Ga0070707_100057261 Ga0070707_1000572614 147
218 3300005471 Ga0070698_100622980 Ga0070698_1006229802 147
219 3300005518 Ga0070699_100317962 Ga0070699_1003179621 147
220 3300005937 Ga0081455_10142715 Ga0081455_101427152 147
221 3300006844 Ga0075428_100000409 Ga0075428_10000040911 147
222 3300006846 Ga0075430_100002238 Ga0075430_10000223810 147
223 3300006847 Ga0075431_100007730 Ga0075431_1000077309 147
224 3300006847 Ga0075431_100824921 Ga0075431_1008249212 147
225 3300006852 Ga0075433_10341842 Ga0075433_103418422 147
226 3300006880 Ga0075429_100000116 Ga0075429_10000011610 147
227 3300007265 Ga0099794_10098579 Ga0099794_100985792 147
228 3300009094 Ga0111539_10855761 Ga0111539_108557611 147
229 3300009147 Ga0114129_10008653 Ga0114129_100086535 147
230 3300009147 Ga0114129_10312235 Ga0114129_103122353 147
231 3300025922 Ga0207646_10070191 Ga0207646_100701912 147
232 3300050507 nmdc:mga05p37_207109_c1 nmdc:mga05p37_207109_c1_595_1047 147
233 3300050508 nmdc:mga09592_265_c1 nmdc:mga09592_265_c1_6746_7198 147
234 3300050508 nmdc:mga09592_58840_c1 nmdc:mga09592_58840_c1_1492_1944 147
235 3300050509 nmdc:mga0qj67_82113_c1 nmdc:mga0qj67_82113_c1_663_1115 147
236 3300050510 nmdc:mga06r32_31418_c1 nmdc:mga06r32_31418_c1_1599_2051 147
237 3300050510 nmdc:mga06r32_482242_c1 nmdc:mga06r32_482242_c1_606_1058 147
238 3300048929 Ga0496126_0059223 Ga0496126_0059223_2173_2625 148
239 3300050507 nmdc:mga05p37_1838258_c1 nmdc:mga05p37_1838258_c1_19_492 149
240 3300006847 Ga0075431_100005898 Ga0075431_10000589810 150
241 3300050508 nmdc:mga09592_1014880_c1 nmdc:mga09592_1014880_c1_125_583 150
242 3300050510 nmdc:mga06r32_268_c1 nmdc:mga06r32_268_c1_33218_33676 150
243 3300050515 nmdc:mga0a205_208359_c1 nmdc:mga0a205_208359_c1_234_692 150
244 3300005844 Ga0068862_100004842 Ga0068862_1000048426 151
245 3300006871 Ga0075434_100048766 Ga0075434_1000487663 151
246 3300009094 Ga0111539_10000139 Ga0111539_1000013953 151
247 3300025933 Ga0207706_10025095 Ga0207706_100250952 151
248 3300027907 Ga0207428_10000239 Ga0207428_1000023950 151
249 3300042876 Ga0451577_0000840 Ga0451577_0000840_1333_1794 151
250 3300044673 Ga0453683_0029010 Ga0453683_0029010_2192_2653 151
251 3300044712 Ga0453684_0015075 Ga0453684_0015075_6322_6783 151
252 3300045051 Ga0451576_0005029 Ga0451576_0005029_13299_13760 151
253 3300050507 nmdc:mga05p37_767326_c1 nmdc:mga05p37_767326_c1_67_528 151
254 3300050511 nmdc:mga08y16_38294_c1 nmdc:mga08y16_38294_c1_3243_3704 151
255 3300050512 nmdc:mga0n895_53512_c1 nmdc:mga0n895_53512_c1_1074_1535 151
256 3300005336 Ga0070680_100015181 Ga0070680_1000151812 152
257 3300005345 Ga0070692_10046729 Ga0070692_100467292 152
258 3300005438 Ga0070701_10002676 Ga0070701_100026763 152
259 3300005441 Ga0070700_100037383 Ga0070700_1000373831 152
260 3300005444 Ga0070694_100121543 Ga0070694_1001215432 152
261 3300005518 Ga0070699_100048453 Ga0070699_1000484533 152
262 3300005536 Ga0070697_100245577 Ga0070697_1002455772 152
263 3300005545 Ga0070695_100330912 Ga0070695_1003309122 152
264 3300005546 Ga0070696_100275209 Ga0070696_1002752092 152
265 3300006931 Ga0097620_100126675 Ga0097620_1001266752 152
266 3300009092 Ga0105250_10333966 Ga0105250_103339662 152
267 3300009148 Ga0105243_10681781 Ga0105243_106817812 152
268 3300009176 Ga0105242_10012067 Ga0105242_100120673 152
269 3300009553 Ga0105249_10108673 Ga0105249_101086732 152
270 3300025908 Ga0207643_10024876 Ga0207643_100248763 152
271 3300025917 Ga0207660_10028190 Ga0207660_100281903 152
272 3300025934 Ga0207686_10078551 Ga0207686_100785512 152
273 3300026075 Ga0207708_10068209 Ga0207708_100682094 152
274 3300026089 Ga0207648_10062440 Ga0207648_100624402 152
275 3300028380 Ga0268265_10966901 Ga0268265_109669012 152
276 3300031852 Ga0307410_10380234 Ga0307410_103802342 152
277 3300031911 Ga0307412_10471201 Ga0307412_104712012 152
278 3300031995 Ga0307409_100946145 Ga0307409_1009461452 152
279 3300042001 Ga0439441_027529 Ga0439441_027529_46_513 152
280 3300005331 Ga0070670_100016588 Ga0070670_1000165884 154
281 3300005347 Ga0070668_100002450 Ga0070668_10000245014 154
282 3300005353 Ga0070669_100031491 Ga0070669_1000314913 154
283 3300005617 Ga0068859_100002393 Ga0068859_10000239314 154
284 3300005842 Ga0068858_100004782 Ga0068858_1000047823 154
285 3300005843 Ga0068860_100009660 Ga0068860_1000096609 154
286 3300006931 Ga0097620_100002393 Ga0097620_10000239314 154
287 3300009177 Ga0105248_10005530 Ga0105248_1000553014 154
288 3300013306 Ga0163162_10164939 Ga0163162_101649392 154
289 3300025923 Ga0207681_10008502 Ga0207681_100085024 154
290 3300025925 Ga0207650_10074468 Ga0207650_100744683 154
291 3300025941 Ga0207711_10003936 Ga0207711_100039362 154
292 3300028381 Ga0268264_10036758 Ga0268264_100367582 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12172

DUF35_N

Rubredoxin-like zinc ribbon domain (DUF35_N)

27

63

0.97

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

64

131

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6skf-assembly1.cif.gz_Bj cryo-em structure of t. kodakarensis 70s ribosome 0.9331 43 71
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.9187 43 70
7qep-assembly1.cif.gz_P0 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.8981 43 69
4ddx-assembly2.cif.gz_B thermotoga maritima reverse gyrase, primitive monoclinic form 0.8974 43 68
8hku-assembly1.cif.gz_L40E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8937 42 68
ID Description Score Start End Superfamily
2ayjA00 Few Secondary Structures;Irregular;ZNF265 like; 0.8249 42 70 4.10.1060.50
1ivsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8218 39 69 3.40.50.620
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.759 31 73 6.10.30.10
af_A0A1D6FEQ8_133_228_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6888 76 121 2.40.50.140
1ny4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6801 74 131 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7X7SMV4-F1-model_v4 DNA-binding protein 0.9768 28 154 GO:0003677
AF-A0A6L7YDX8-F1-model_v4 DNA-binding protein 0.9742 25 154 GO:0003677
AF-A0A849N338-F1-model_v4 DNA-binding protein 0.9741 15 154 GO:0003677
AF-A0A6L7YDX8-F1-model_v4 DNA-binding protein 0.9669 25 154 GO:0003677
AF-A0A382AE84-F1-model_v4 DUF35 domain-containing protein 0.9662 69 154

Feature Viewer

pLDDT pTM Quality
91.23 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map