F390880

General Info

Members Datasets Scaffolds Average Seq Length
292 178 584 505

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10070282|Ga0105240_100702824
Length 552
Sequence MKLNTGSGMKPNSFRPIPELRSASAGWFPQADSGAGQHNGRQPPPLKGRISLPARRLSVRKIKEVLRLKFDVGLGLRQIARSCSIGLGTAHEYLQRAEAAKITWPLGPEWDDDRLEAALFGGPPRSRPTALPMPDFADLHRQRQRHPHVTQQLLWEEYRQANPDGYQYSRFCELYQRWRRKQDVVLRQEHKAGEKLFVDWAGTTIPIHDPRGGPVQQAHLFVAVLGASSYTYAEATSDEQLGSWIGAHVRAFEFYKGVPKLVVPDNTKTGVTKACRYDPDLNPTYQEMAMHYGVGVVPARPYKPRDKAKVESGVQLAERWIIAALRNRKFFSIEELNQAIRELRDRINQRPFRKREGSRATQFVAVDKPALSPLPAERFDLSEWSRARVNIDYHIAFDTNYYSVPYNLVQELVEVRSTPTTVEIFHKSQRVASHRRAHGXXXAVTISEHRPRSHQAHLEWTPSRMVHWAQTIGPHTARLFERILADKPHPEMGYRSCLGIIRLADQYSPARVEAAAERALLSGACRYQSVKSILKNSLDVIPDNIRGAEYFE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 2511231008 Pseudomonas sp. GM21 Isolate Nodule
176 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
177 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
178 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.34
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.4
Rhizoplane 0
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 33.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10070282 3300009093 Bacteria 4331
2 Ga0070690_100030530 3300005330 Bacteria 3350
3 Ga0070690_100051406 3300005330 Unclassified 2631
4 Ga0068869_100020597 3300005334 Unclassified 4524
5 Ga0070666_10006441 3300005335 Bacteria 7217
6 Ga0070666_10039223 3300005335 Unclassified 3156
7 Ga0070682_100120170 3300005337 Bacteria 1762
8 Ga0070689_100050984 3300005340 Unclassified 3197
9 Ga0070687_100007698 3300005343 Unclassified 4513
10 Ga0070687_100012640 3300005343 Unclassified 3735
11 Ga0070687_100057881 3300005343 Bacteria 2034
12 Ga0070671_100010991 3300005355 Bacteria 7265
13 Ga0070688_100032473 3300005365 Unclassified 3148
14 Ga0070667_100037024 3300005367 Unclassified 4090
15 Ga0070667_100063139 3300005367 Bacteria 3138
16 Ga0070667_100123272 3300005367 Bacteria 2256
17 Ga0070709_10021659 3300005434 Bacteria 3746
18 Ga0070713_100032664 3300005436 Unclassified 4160
19 Ga0070713_100085306 3300005436 Bacteria 2705
20 Ga0070713_100135191 3300005436 Bacteria 2178
21 Ga0070710_10027866 3300005437 Unclassified 3017
22 Ga0070701_10061466 3300005438 Bacteria 1981
23 Ga0070708_100011634 3300005445 Bacteria 7163
24 Ga0070708_100118221 3300005445 Bacteria 2442
25 Ga0070708_100128917 3300005445 Bacteria 2340
26 Ga0070681_10121958 3300005458 Bacteria 2540
27 Ga0070681_10187086 3300005458 Bacteria 1991
28 Ga0070685_10050457 3300005466 Unclassified 2404
29 Ga0070706_100073169 3300005467 Bacteria 3171
30 Ga0070707_100051132 3300005468 Bacteria 3961
31 Ga0070707_100074673 3300005468 Bacteria 3269
32 Ga0070707_100084877 3300005468 Unclassified 3060
33 Ga0070707_100115103 3300005468 Bacteria 2610
34 Ga0070707_100159582 3300005468 Bacteria 2197
35 Ga0070698_100054395 3300005471 Bacteria 4063
36 Ga0070699_100036707 3300005518 Unclassified 4239
37 Ga0070699_100059060 3300005518 Bacteria 3323
38 Ga0070699_100065202 3300005518 Bacteria 3160
39 Ga0070699_100079633 3300005518 Bacteria 2854
40 Ga0070684_100065656 3300005535 Bacteria 3185
41 Ga0070697_100055290 3300005536 Unclassified 3227
42 Ga0070697_100070774 3300005536 Bacteria 2860
43 Ga0070672_100050340 3300005543 Unclassified 3243
44 Ga0070686_100022598 3300005544 Bacteria 3748
45 Ga0070686_100036448 3300005544 Bacteria 3046
46 Ga0068855_100157772 3300005563 Bacteria 2577
47 Ga0068857_100146267 3300005577 Bacteria 2138
48 Ga0068856_100068905 3300005614 Bacteria 3497
49 Ga0068856_100076077 3300005614 Bacteria 3325
50 Ga0070702_100072712 3300005615 Unclassified 2035
51 Ga0068859_100003701 3300005617 Bacteria 15587
52 Ga0068863_100002922 3300005841 Bacteria 16925
53 Ga0068858_100073011 3300005842 Unclassified 3184
54 Ga0068858_100087341 3300005842 Bacteria 2900
55 Ga0068862_100075847 3300005844 Bacteria 2909
56 Ga0081455_10076553 3300005937 Bacteria 2755
57 Ga0081540_1011405 3300005983 Bacteria 5940
58 Ga0081540_1018758 3300005983 Unclassified 4230
59 Ga0070717_10022012 3300006028 Bacteria 5030
60 Ga0070715_10030201 3300006163 Viruses 2189
61 Ga0070716_100048309 3300006173 Bacteria 2405
62 Ga0070716_100058366 3300006173 Bacteria 2220
63 Ga0097621_100029502 3300006237 Unclassified 4333
64 Ga0097621_100136778 3300006237 Bacteria 2090
65 Ga0068871_100047426 3300006358 Unclassified 3465
66 Ga0068871_100069123 3300006358 Bacteria 2900
67 Ga0068871_100092140 3300006358 Bacteria 2527
68 Ga0075436_100056071 3300006914 Bacteria 2722
69 Ga0097620_100003702 3300006931 Bacteria 15587
70 Ga0099794_10022406 3300007265 Unclassified 2880
71 Ga0105240_10078567 3300009093 Unclassified 4063
72 Ga0105240_10120203 3300009093 Bacteria 3164
73 Ga0105240_10190927 3300009093 Bacteria 2409
74 Ga0111539_10110645 3300009094 Bacteria 3223
75 Ga0105245_10079799 3300009098 Unclassified 2989
76 Ga0105247_10030265 3300009101 Unclassified 3281
77 Ga0114129_10120105 3300009147 Unclassified 3619
78 Ga0105242_10048212 3300009176 Unclassified 3462
79 Ga0105248_10139519 3300009177 Unclassified 2734
80 Ga0105237_10023326 3300009545 Bacteria 6341
81 Ga0105237_10102730 3300009545 Bacteria 2850
82 Ga0105238_10048709 3300009551 Bacteria 4269
83 Ga0105238_10061936 3300009551 Unclassified 3743
84 Ga0105238_10092948 3300009551 Bacteria 3004
85 Ga0105238_10112498 3300009551 Bacteria 2702
86 Ga0105249_10063247 3300009553 Unclassified 3399
87 Ga0105239_10087614 3300010375 Bacteria 3432
88 Ga0105239_10094276 3300010375 Archaea 3306
89 Ga0105239_10097943 3300010375 Unclassified 3241
90 Ga0157369_10068464 3300013105 Bacteria 3814
91 Ga0157374_10041565 3300013296 Unclassified 4238
92 Ga0157374_10063430 3300013296 Viruses 3465
93 Ga0157374_10084317 3300013296 Bacteria 3020
94 Ga0157378_10077777 3300013297 Unclassified 2991
95 Ga0157378_10157647 3300013297 Bacteria 2120
96 Ga0163162_10061450 3300013306 Unclassified 3794
97 Ga0163162_10070480 3300013306 Unclassified 3547
98 Ga0163162_10075733 3300013306 Unclassified 3426
99 Ga0157372_10010106 3300013307 Bacteria 10025
100 Ga0163163_10081297 3300014325 Unclassified 3242
101 Ga0163163_10090881 3300014325 Unclassified 3067
102 Ga0157377_10004727 3300014745 Bacteria 6306
103 Ga0157376_10037627 3300014969 Unclassified 3930
104 Ga0163161_10038153 3300017792 Unclassified 3445
105 Ga0213873_10003680 3300021358 Bacteria 2788
106 Ga0213874_10004198 3300021377 Bacteria 3260
107 Ga0228598_1004624 3300024227 Unclassified 2913
108 Ga0207680_10012477 3300025903 Bacteria 4328
109 Ga0207699_10036225 3300025906 Bacteria 2811
110 Ga0207684_10012211 3300025910 Bacteria 7477
111 Ga0207707_10081604 3300025912 Bacteria 2823
112 Ga0207695_10013568 3300025913 Bacteria 9705
113 Ga0207695_10043127 3300025913 Unclassified 4811
114 Ga0207695_10086518 3300025913 Bacteria 3161
115 Ga0207695_10132713 3300025913 Bacteria 2446
116 Ga0207693_10037276 3300025915 Unclassified 3832
117 Ga0207663_10021858 3300025916 Unclassified 3649
118 Ga0207662_10017774 3300025918 Unclassified 4026
119 Ga0207646_10032483 3300025922 Unclassified 4724
120 Ga0207646_10067585 3300025922 Unclassified 3191
121 Ga0207646_10085721 3300025922 Bacteria 2817
122 Ga0207646_10085944 3300025922 Bacteria 2813
123 Ga0207694_10014933 3300025924 Bacteria 5856
124 Ga0207694_10063733 3300025924 Bacteria 2872
125 Ga0207659_10047900 3300025926 Unclassified 3025
126 Ga0207700_10081011 3300025928 Bacteria 2534
127 Ga0207700_10117930 3300025928 Bacteria 2147
128 Ga0207644_10031874 3300025931 Unclassified 3675
129 Ga0207670_10041312 3300025936 Unclassified 3032
130 Ga0207665_10057827 3300025939 Bacteria 2620
131 Ga0207665_10067743 3300025939 Bacteria 2431
132 Ga0207665_10080146 3300025939 Bacteria 2245
133 Ga0207691_10021042 3300025940 Bacteria 6164
134 Ga0207711_10066138 3300025941 Unclassified 3126
135 Ga0207689_10041085 3300025942 Unclassified 3827
136 Ga0207667_10018721 3300025949 Bacteria 7756
137 Ga0207667_10018727 3300025949 Bacteria 7755
138 Ga0207651_10034857 3300025960 Bacteria 3264
139 Ga0207712_10029038 3300025961 Unclassified 3706
140 Ga0207677_10019027 3300026023 Unclassified 4137
141 Ga0207703_10056733 3300026035 Bacteria 3191
142 Ga0207703_10060199 3300026035 Unclassified 3104
143 Ga0207708_10098620 3300026075 Unclassified 2259
144 Ga0207702_10074977 3300026078 Bacteria 2922
145 Ga0207641_10054448 3300026088 Bacteria 3394
146 Ga0207674_10114904 3300026116 Bacteria 2663
147 Ga0207683_10152788 3300026121 Unclassified 2084
148 Ga0209588_1002338 3300027671 Bacteria 5139
149 Ga0268264_10058788 3300028381 Unclassified 3220
150 Ga0265337_1014416 3300028556 Unclassified 2619
151 Ga0265334_10001403 3300028573 Bacteria 11596
152 Ga0265334_10016046 3300028573 Unclassified 3101
153 Ga0265338_10066468 3300028800 Bacteria 3120
154 Ga0265338_10067828 3300028800 Bacteria 3077
155 Ga0265338_10069940 3300028800 Bacteria 3012
156 Ga0265338_10072709 3300028800 Unclassified 2934
157 Ga0265338_10083838 3300028800 Bacteria 2664
158 Ga0265324_10012327 3300029957 Unclassified 3225
159 Ga0265324_10013625 3300029957 Bacteria 3026
160 Ga0265324_10014117 3300029957 Bacteria 2964
161 Ga0265324_10014180 3300029957 Bacteria 2955
162 Ga0265762_1001268 3300030760 Unclassified 4593
163 Ga0265332_10010951 3300031238 Bacteria 4028
164 Ga0265332_10017147 3300031238 Bacteria 3194
165 Ga0265332_10018106 3300031238 Bacteria 3105
166 Ga0265328_10014035 3300031239 Unclassified 3160
167 Ga0265325_10028153 3300031241 Unclassified 3031
168 Ga0265325_10039515 3300031241 Unclassified 2484
169 Ga0265329_10019818 3300031242 Bacteria 2278
170 Ga0265340_10023517 3300031247 Bacteria 3141
171 Ga0265339_10027194 3300031249 Unclassified 3267
172 Ga0265339_10027718 3300031249 Bacteria 3227
173 Ga0265339_10031192 3300031249 Bacteria 3013
174 Ga0265331_10023849 3300031250 Bacteria 3101
175 Ga0265316_10034189 3300031344 Bacteria 4131
176 Ga0265316_10048139 3300031344 Bacteria 3368
177 Ga0265316_10064825 3300031344 Bacteria 2829
178 Ga0265316_10072490 3300031344 Bacteria 2653
179 Ga0265316_10120527 3300031344 Unclassified 1981
180 Ga0307513_10141946 3300031456 Bacteria 2327
181 Ga0265313_10035477 3300031595 Bacteria 2512
182 Ga0265314_10020464 3300031711 Bacteria 5107
183 Ga0265314_10045222 3300031711 Bacteria 3114
184 Ga0265314_10045243 3300031711 Bacteria 3114
185 Ga0265314_10120534 3300031711 Bacteria 1652
186 Ga0265342_10039072 3300031712 Bacteria 2885
187 Ga0265342_10073820 3300031712 Bacteria 1983
188 Ga0373934_0007618 3300035086 Unclassified 4020
189 Ga0373944_0006439 3300035089 Bacteria 3119
190 Ga0373923_0005993 3300035111 Unclassified 4166
191 Ga0373923_0018667 3300035111 Bacteria 2673
192 Ga0373936_0035720 3300035113 Bacteria 1979
193 Ga0373945_0030596 3300035116 Bacteria 1898
194 Ga0373954_0006966 3300035118 Unclassified 4935
195 Ga0373956_0019800 3300035119 Unclassified 2856
196 Ga0373956_0078156 3300035119 Bacteria 1515
197 Ga0373957_0007789 3300035120 Unclassified 3441
198 Ga0373943_0040402 3300035170 Bacteria 2252
199 Ga0373943_0047082 3300035170 Unclassified 2107
200 Ga0373955_0008791 3300035172 Unclassified 4705
201 Ga0373955_0023998 3300035172 Unclassified 3113
202 Ga0373935_0024340 3300035692 Unclassified 3726
203 Ga0373935_0038205 3300035692 Bacteria 3005
204 Ga0373935_0042723 3300035692 Bacteria 2851
205 Ga0373935_0052260 3300035692 Bacteria 2597
206 Ga0373935_0067382 3300035692 Unclassified 2301
207 Ga0373927_0015789 3300035695 Plasmid 4982
208 Ga0373933_0007355 3300035724 Bacteria 6009
209 Ga0373933_0010177 3300035724 Bacteria 5151
210 Ga0373933_0053974 3300035724 Bacteria 2407
211 Ga0373947_0030327 3300035725 Unclassified 3177
212 Ga0373947_0037501 3300035725 Bacteria 2877
213 Ga0373947_0061472 3300035725 Unclassified 2283
214 Ga0373947_0067651 3300035725 Unclassified 2183
215 Ga0373937_0037642 3300036401 Unclassified 4408
216 Ga0373937_0037838 3300036401 Unclassified 4397
217 Ga0373937_0050664 3300036401 Bacteria 3803
218 Ga0373937_0050700 3300036401 Bacteria 3802
219 Ga0373937_0075326 3300036401 Bacteria 3115
220 Ga0373937_0081318 3300036401 Bacteria 2997
221 Ga0373925_0068321 3300037068 Unclassified 2682
222 Ga0395905_0247159 3300037471 Bacteria 1667
223 Ga0436365_1399960 3300039437 Unclassified 2338
224 Ga0436360_0426457 3300039438 Bacteria 4021
225 Ga0436361_1182287 3300039447 Bacteria 1723
226 Ga0453684_0000695 3300044712 Bacteria 119602
227 Ga0453684_0097491 3300044712 Bacteria 3608
228 Ga0453684_0125130 3300044712 Bacteria 3095
229 Ga0466959_0063773 3300045049 Bacteria 2675
230 Ga0451576_0087863 3300045051 Bacteria 3233
231 Ga0451576_0143726 3300045051 Unclassified 2487
232 Ga0451576_0217844 3300045051 Bacteria 1993
233 Ga0495592_0020204 3300046454 Bacteria 5066
234 Ga0495592_0032865 3300046454 Bacteria 3913
235 Ga0495592_0065557 3300046454 Bacteria 2658
236 Ga0495651_0006533 3300046462 Bacteria 8907
237 Ga0495653_0078405 3300046463 Bacteria 2450
238 Ga0495653_0108371 3300046463 Bacteria 2000
239 Ga0495580_0029830 3300046472 Unclassified 3956
240 Ga0495580_0039853 3300046472 Bacteria 3360
241 Ga0495662_0021700 3300046476 Bacteria 3102
242 Ga0495662_0049128 3300046476 Unclassified 2037
243 Ga0495664_0002916 3300046477 Bacteria 9230
244 Ga0495594_0028713 3300046499 Bacteria 3003
245 Ga0495608_0041087 3300046511 Bacteria 3097
246 Ga0495618_0040603 3300046514 Bacteria 2929
247 Ga0495628_0008103 3300046516 Bacteria 9038
248 Ga0495630_0022573 3300046517 Unclassified 4648
249 Ga0495642_0013523 3300046528 Bacteria 3158
250 Ga0495652_0020681 3300046529 Bacteria 5851
251 Ga0495665_0015864 3300046531 Unclassified 4058
252 Ga0495640_0132591 3300046533 Unclassified 1611
253 Ga0495587_0027821 3300046536 Bacteria 3442
254 Ga0495587_0040353 3300046536 Bacteria 2790
255 Ga0495587_0103743 3300046536 Bacteria 1637
256 Ga0495645_0001354 3300046543 Bacteria 16571
257 Ga0495645_0093977 3300046543 Archaea 2139
258 Ga0495667_0045591 3300046559 Bacteria 2902
259 Ga0495635_0075355 3300046663 Bacteria 2311
260 Ga0495657_0034174 3300046675 Bacteria 3533
261 Ga0495599_0030265 3300046678 Unclassified 3396
262 Ga0495623_0023902 3300046679 Bacteria 3943
263 Ga0495646_0026037 3300046680 Unclassified 3673
264 Ga0495613_0033889 3300046689 Bacteria 3793
265 Ga0495600_0042744 3300046809 Bacteria 2955
266 Ga0495600_0083611 3300046809 Unclassified 2083
267 Ga0495581_0076378 3300047315 Bacteria 1938
268 Ga0495604_0031789 3300047317 Unclassified 4186
269 Ga0495674_0008313 3300047319 Bacteria 9894
270 Ga0495674_0070944 3300047319 Bacteria 3009
271 Ga0495672_0045420 3300047320 Unclassified 2628
272 Ga0495676_0041532 3300047321 Bacteria 3784
273 Ga0495680_0055651 3300047322 Bacteria 3067
274 Ga0495680_0056479 3300047322 Bacteria 3039
275 Ga0495675_0088386 3300047444 Bacteria 1946
276 Ga0495684_0011211 3300047471 Bacteria 6928
277 Ga0495602_0011624 3300048088 Bacteria 9093
278 Ga0495602_0041193 3300048088 Unclassified 4222
279 Ga0495602_0063431 3300048088 Bacteria 3202
280 Ga0501034_0074143 3300049571 Bacteria 3412
281 Ga0501070_0048821 3300049586 Bacteria 3515
282 nmdc:mga08y16_251033_c1 3300050511 Unclassified 1828
283 nmdc:mga0rr50_64684_c1 3300050513 Bacteria 2768
284 nmdc:mga08x19_46427_c1 3300050514 Bacteria 2778
285 2511278612 2511231008 Bacteria 6624100
286 2723844222 2721755755 Bacteria 8322773
287 2723844270 2721755755 Bacteria 8322773
288 2723844353 2721755755 Bacteria 8322773
289 2723844425 2721755755 Bacteria 8322773
290 2723848093 2721755755 Bacteria 8322773
291 2906630338 2906626472 Bacteria 8826946
292 8016602193 8016595262 Bacteria 8149947
293 Ga0105240_10070282
294 Ga0070690_100030530
295 Ga0070690_100051406
296 Ga0068869_100020597
297 Ga0070666_10006441
298 Ga0070666_10039223
299 Ga0070682_100120170
300 Ga0070689_100050984
301 Ga0070687_100007698
302 Ga0070687_100012640
303 Ga0070687_100057881
304 Ga0070671_100010991
305 Ga0070688_100032473
306 Ga0070667_100037024
307 Ga0070667_100063139
308 Ga0070667_100123272
309 Ga0070709_10021659
310 Ga0070713_100032664
311 Ga0070713_100085306
312 Ga0070713_100135191
313 Ga0070710_10027866
314 Ga0070701_10061466
315 Ga0070708_100011634
316 Ga0070708_100118221
317 Ga0070708_100128917
318 Ga0070681_10121958
319 Ga0070681_10187086
320 Ga0070685_10050457
321 Ga0070706_100073169
322 Ga0070707_100051132
323 Ga0070707_100074673
324 Ga0070707_100084877
325 Ga0070707_100115103
326 Ga0070707_100159582
327 Ga0070698_100054395
328 Ga0070699_100036707
329 Ga0070699_100059060
330 Ga0070699_100065202
331 Ga0070699_100079633
332 Ga0070684_100065656
333 Ga0070697_100055290
334 Ga0070697_100070774
335 Ga0070672_100050340
336 Ga0070686_100022598
337 Ga0070686_100036448
338 Ga0068855_100157772
339 Ga0068857_100146267
340 Ga0068856_100068905
341 Ga0068856_100076077
342 Ga0070702_100072712
343 Ga0068859_100003701
344 Ga0068863_100002922
345 Ga0068858_100073011
346 Ga0068858_100087341
347 Ga0068862_100075847
348 Ga0081455_10076553
349 Ga0081540_1011405
350 Ga0081540_1018758
351 Ga0070717_10022012
352 Ga0070715_10030201
353 Ga0070716_100048309
354 Ga0070716_100058366
355 Ga0097621_100029502
356 Ga0097621_100136778
357 Ga0068871_100047426
358 Ga0068871_100069123
359 Ga0068871_100092140
360 Ga0075436_100056071
361 Ga0097620_100003702
362 Ga0099794_10022406
363 Ga0105240_10078567
364 Ga0105240_10120203
365 Ga0105240_10190927
366 Ga0111539_10110645
367 Ga0105245_10079799
368 Ga0105247_10030265
369 Ga0114129_10120105
370 Ga0105242_10048212
371 Ga0105248_10139519
372 Ga0105237_10023326
373 Ga0105237_10102730
374 Ga0105238_10048709
375 Ga0105238_10061936
376 Ga0105238_10092948
377 Ga0105238_10112498
378 Ga0105249_10063247
379 Ga0105239_10087614
380 Ga0105239_10094276
381 Ga0105239_10097943
382 Ga0157369_10068464
383 Ga0157374_10041565
384 Ga0157374_10063430
385 Ga0157374_10084317
386 Ga0157378_10077777
387 Ga0157378_10157647
388 Ga0163162_10061450
389 Ga0163162_10070480
390 Ga0163162_10075733
391 Ga0157372_10010106
392 Ga0163163_10081297
393 Ga0163163_10090881
394 Ga0157377_10004727
395 Ga0157376_10037627
396 Ga0163161_10038153
397 Ga0213873_10003680
398 Ga0213874_10004198
399 Ga0228598_1004624
400 Ga0207680_10012477
401 Ga0207699_10036225
402 Ga0207684_10012211
403 Ga0207707_10081604
404 Ga0207695_10013568
405 Ga0207695_10043127
406 Ga0207695_10086518
407 Ga0207695_10132713
408 Ga0207693_10037276
409 Ga0207663_10021858
410 Ga0207662_10017774
411 Ga0207646_10032483
412 Ga0207646_10067585
413 Ga0207646_10085721
414 Ga0207646_10085944
415 Ga0207694_10014933
416 Ga0207694_10063733
417 Ga0207659_10047900
418 Ga0207700_10081011
419 Ga0207700_10117930
420 Ga0207644_10031874
421 Ga0207670_10041312
422 Ga0207665_10057827
423 Ga0207665_10067743
424 Ga0207665_10080146
425 Ga0207691_10021042
426 Ga0207711_10066138
427 Ga0207689_10041085
428 Ga0207667_10018721
429 Ga0207667_10018727
430 Ga0207651_10034857
431 Ga0207712_10029038
432 Ga0207677_10019027
433 Ga0207703_10056733
434 Ga0207703_10060199
435 Ga0207708_10098620
436 Ga0207702_10074977
437 Ga0207641_10054448
438 Ga0207674_10114904
439 Ga0207683_10152788
440 Ga0209588_1002338
441 Ga0268264_10058788
442 Ga0265337_1014416
443 Ga0265334_10001403
444 Ga0265334_10016046
445 Ga0265338_10066468
446 Ga0265338_10067828
447 Ga0265338_10069940
448 Ga0265338_10072709
449 Ga0265338_10083838
450 Ga0265324_10012327
451 Ga0265324_10013625
452 Ga0265324_10014117
453 Ga0265324_10014180
454 Ga0265762_1001268
455 Ga0265332_10010951
456 Ga0265332_10017147
457 Ga0265332_10018106
458 Ga0265328_10014035
459 Ga0265325_10028153
460 Ga0265325_10039515
461 Ga0265329_10019818
462 Ga0265340_10023517
463 Ga0265339_10027194
464 Ga0265339_10027718
465 Ga0265339_10031192
466 Ga0265331_10023849
467 Ga0265316_10034189
468 Ga0265316_10048139
469 Ga0265316_10064825
470 Ga0265316_10072490
471 Ga0265316_10120527
472 Ga0307513_10141946
473 Ga0265313_10035477
474 Ga0265314_10020464
475 Ga0265314_10045222
476 Ga0265314_10045243
477 Ga0265314_10120534
478 Ga0265342_10039072
479 Ga0265342_10073820
480 Ga0373934_0007618
481 Ga0373944_0006439
482 Ga0373923_0005993
483 Ga0373923_0018667
484 Ga0373936_0035720
485 Ga0373945_0030596
486 Ga0373954_0006966
487 Ga0373956_0019800
488 Ga0373956_0078156
489 Ga0373957_0007789
490 Ga0373943_0040402
491 Ga0373943_0047082
492 Ga0373955_0008791
493 Ga0373955_0023998
494 Ga0373935_0024340
495 Ga0373935_0038205
496 Ga0373935_0042723
497 Ga0373935_0052260
498 Ga0373935_0067382
499 Ga0373927_0015789
500 Ga0373933_0007355
501 Ga0373933_0010177
502 Ga0373933_0053974
503 Ga0373947_0030327
504 Ga0373947_0037501
505 Ga0373947_0061472
506 Ga0373947_0067651
507 Ga0373937_0037642
508 Ga0373937_0037838
509 Ga0373937_0050664
510 Ga0373937_0050700
511 Ga0373937_0075326
512 Ga0373937_0081318
513 Ga0373925_0068321
514 Ga0395905_0247159
515 Ga0436365_1399960
516 Ga0436360_0426457
517 Ga0436361_1182287
518 Ga0453684_0000695
519 Ga0453684_0097491
520 Ga0453684_0125130
521 Ga0466959_0063773
522 Ga0451576_0087863
523 Ga0451576_0143726
524 Ga0451576_0217844
525 Ga0495592_0020204
526 Ga0495592_0032865
527 Ga0495592_0065557
528 Ga0495651_0006533
529 Ga0495653_0078405
530 Ga0495653_0108371
531 Ga0495580_0029830
532 Ga0495580_0039853
533 Ga0495662_0021700
534 Ga0495662_0049128
535 Ga0495664_0002916
536 Ga0495594_0028713
537 Ga0495608_0041087
538 Ga0495618_0040603
539 Ga0495628_0008103
540 Ga0495630_0022573
541 Ga0495642_0013523
542 Ga0495652_0020681
543 Ga0495665_0015864
544 Ga0495640_0132591
545 Ga0495587_0027821
546 Ga0495587_0040353
547 Ga0495587_0103743
548 Ga0495645_0001354
549 Ga0495645_0093977
550 Ga0495667_0045591
551 Ga0495635_0075355
552 Ga0495657_0034174
553 Ga0495599_0030265
554 Ga0495623_0023902
555 Ga0495646_0026037
556 Ga0495613_0033889
557 Ga0495600_0042744
558 Ga0495600_0083611
559 Ga0495581_0076378
560 Ga0495604_0031789
561 Ga0495674_0008313
562 Ga0495674_0070944
563 Ga0495672_0045420
564 Ga0495676_0041532
565 Ga0495680_0055651
566 Ga0495680_0056479
567 Ga0495675_0088386
568 Ga0495684_0011211
569 Ga0495602_0011624
570 Ga0495602_0041193
571 Ga0495602_0063431
572 Ga0501034_0074143
573 Ga0501070_0048821
574 nmdc:mga08y16_251033_c1
575 nmdc:mga0rr50_64684_c1
576 nmdc:mga08x19_46427_c1
577 2511278612
578 2723844222
579 2723844270
580 2723844353
581 2723844425
582 2723848093
583 2906630338
584 8016602193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00665

rve

Integrase core domain

189

304

0.96

PF22483

Mu-transpos_C_2

Mu transposase, C-terminal domain

374

446

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vfz-assembly3.cif.gz_B crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9255 1 41
5ocq-assembly1.cif.gz_A crystal structure of the complex of the kappa-carrageenase from pseudoalteromonas carrageenovora with an oligotetrasaccharide of kappa-carrageenan 0.8907 346 369
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8724 1 41
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8481 1 41
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.8454 3 47
ID Description Score Start End Superfamily
3vfzB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9255 1 41 1.10.10.10
af_I6X5T4_111_295_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8985 124 309 3.30.420.10
af_I6X5T4_111_295_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8939 124 309 3.30.420.10
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8893 2 45 1.10.10.10
af_Q14993_44_256_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8839 346 371 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A3B0WKK1-F1-model_v4 Mobile element protein 0.9673 303 389
AF-A0A2L2WXC5-F1-model_v4 Integrase catalytic domain-containing protein 0.9611 139 315 GO:0003676
GO:0015074
AF-T1C4Q8-F1-model_v4 Transposase subunit 0.9589 158 280 GO:0015074
AF-A0A5R1MSY8-F1-model_v4 deleted 0.9443 172 313
AF-A0A5R9DSS6-F1-model_v4 Transposase 0.9435 173 391 GO:0015074

Map