F390552

General Info

Members Datasets Scaffolds Average Seq Length
291 132 582 138

Family's Representative Sequence

Representative Sequence 3300047445|Ga0495677_0002047|Ga0495677_0002047_4625_5104
Length 159
Sequence VAAPPNKIFNEANKQFMSEQKPVRTQVHVMRQTIRWGDMDVLGHVNNTVYFRYMETARIAFLEEAAGKFDNQGEGPVIVTAYCNFIKQLKYPGDIEVRTFVSAPGRSSFEVTHEIRLVDENGQAELVHAEGGAKVVWVDFAAEKSRPLPEHLRALLPSA

Samples

Sample ID Description Type Environment
1 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
4 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
5 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
6 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
7 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
8 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
12 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
13 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
14 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
15 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
16 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
17 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
18 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
19 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
20 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
21 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
22 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
23 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
24 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
25 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
26 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
27 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
28 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
29 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
30 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
31 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
32 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
33 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
34 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
35 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
36 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
37 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
38 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
39 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
40 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
41 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
42 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
43 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
44 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
45 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
46 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
47 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
48 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
49 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
50 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
51 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
52 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
53 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
54 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
55 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
56 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
57 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
58 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
59 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
60 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
61 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
62 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
63 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
64 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
67 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
68 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
69 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
70 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
71 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
72 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
73 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
74 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
75 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
93 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
99 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
112 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
129 2643221556 Massilia sp. Root1485 Isolate Unclassified
130 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
131 2643221684 Massilia sp. Root133 Isolate Unclassified
132 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.13
Metatranscriptomes 5.5
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.47
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495677_0002047 3300047445 Bacteria 8040
2 Ga0070671_101717390 3300005355 Bacteria 557
3 Ga0105239_10274200 3300010375 Bacteria 1898
4 Ga0157372_10629107 3300013307 Bacteria 1250
5 Ga0163161_10111571 3300017792 Bacteria 2045
6 Ga0213872_10098835 3300021361 Bacteria 1302
7 Ga0213872_10336739 3300021361 Bacteria 621
8 Ga0207650_10271453 3300025925 Bacteria 1378
9 Ga0207644_11665059 3300025931 Bacteria 535
10 Ga0207679_10840937 3300025945 Bacteria 838
11 Ga0209970_1001668 3300027614 Bacteria 3865
12 Ga0265338_10002526 3300028800 Bacteria 27189
13 Ga0307408_100000048 3300031548 Bacteria 165579
14 Ga0307406_10007807 3300031901 Bacteria 5950
15 Ga0395899_0001751 3300037312 Bacteria 18046
16 Ga0395899_0004262 3300037312 Bacteria 11193
17 Ga0395899_0294694 3300037312 Bacteria 1100
18 Ga0395900_0006268 3300037418 Bacteria 12412
19 Ga0395900_0057630 3300037418 Bacteria 3999
20 Ga0395900_0293622 3300037418 Bacteria 1613
21 Ga0395898_0895232 3300037466 Bacteria 826
22 Ga0395905_0012379 3300037471 Bacteria 8213
23 Ga0395901_0004044 3300038443 Bacteria 14769
24 Ga0395901_0012876 3300038443 Bacteria 8482
25 Ga0395901_0129403 3300038443 Bacteria 2653
26 Ga0395901_1095276 3300038443 Unclassified 767
27 Ga0436361_0377173 3300039447 Bacteria 1410
28 Ga0436361_0515000 3300039447 Bacteria 5149
29 Ga0466969_0095089 3300044656 Bacteria 1408
30 Ga0466969_0273115 3300044656 Bacteria 766
31 Ga0466972_0000118 3300044658 Bacteria 66725
32 Ga0466965_0472310 3300044683 Bacteria 701
33 Ga0466966_0004595 3300044684 Bacteria 9094
34 Ga0466961_0713057 3300044693 Bacteria 601
35 Ga0466964_0170729 3300044706 Bacteria 1024
36 Ga0466970_0011347 3300044765 Bacteria 4542
37 Ga0466957_0039945 3300044842 Bacteria 2832
38 Ga0466959_0019473 3300045049 Bacteria 4991
39 Ga0495590_0333877 3300046457 Bacteria 574
40 Ga0495629_0001542 3300046459 Bacteria 18094
41 Ga0495629_0066895 3300046459 Bacteria 2508
42 Ga0495629_0784679 3300046459 Bacteria 629
43 Ga0495653_0015840 3300046463 Bacteria 6145
44 Ga0495653_0055637 3300046463 Bacteria 3018
45 Ga0495650_0002279 3300046471 Bacteria 15953
46 Ga0495580_0018351 3300046472 Bacteria 5210
47 Ga0495580_0126163 3300046472 Bacteria 1776
48 Ga0495582_0023450 3300046473 Bacteria 3375
49 Ga0495605_0018003 3300046474 Bacteria 3795
50 Ga0495605_0027049 3300046474 Bacteria 2975
51 Ga0495605_0032953 3300046474 Bacteria 2634
52 Ga0495605_0330110 3300046474 Bacteria 642
53 Ga0495605_0490837 3300046474 Bacteria 503
54 Ga0495584_0012540 3300046491 Bacteria 4327
55 Ga0495584_0227738 3300046491 Bacteria 947
56 Ga0495584_0246338 3300046491 Bacteria 908
57 Ga0495584_0294692 3300046491 Bacteria 824
58 Ga0495585_0013975 3300046492 Bacteria 4688
59 Ga0495585_0031922 3300046492 Bacteria 2987
60 Ga0495594_0045491 3300046499 Bacteria 2409
61 Ga0495594_0199473 3300046499 Bacteria 1140
62 Ga0495594_0242840 3300046499 Bacteria 1026
63 Ga0495596_0002140 3300046500 Bacteria 10794
64 Ga0495596_0004831 3300046500 Bacteria 6476
65 Ga0495596_0363501 3300046500 Bacteria 564
66 Ga0495607_0000552 3300046501 Bacteria 36630
67 Ga0495607_0005228 3300046501 Bacteria 9340
68 Ga0495607_0293934 3300046501 Bacteria 767
69 Ga0495607_0477669 3300046501 Bacteria 556
70 Ga0495583_0000060 3300046506 Bacteria 199091
71 Ga0495583_0000127 3300046506 Bacteria 127780
72 Ga0495583_0095471 3300046506 Bacteria 1275
73 Ga0495583_0207055 3300046506 Bacteria 795
74 Ga0495606_0018981 3300046507 Bacteria 5137
75 Ga0495616_0010946 3300046513 Bacteria 5221
76 Ga0495616_0022113 3300046513 Bacteria 3436
77 Ga0495616_0087206 3300046513 Bacteria 1483
78 Ga0495616_0266378 3300046513 Bacteria 731
79 Ga0495616_0365092 3300046513 Bacteria 599
80 Ga0495630_0047893 3300046517 Bacteria 3199
81 Ga0495630_0301266 3300046517 Bacteria 1225
82 Ga0495631_0000794 3300046518 Bacteria 20159
83 Ga0495631_0018624 3300046518 Bacteria 3266
84 Ga0495631_0023432 3300046518 Bacteria 2860
85 Ga0495631_0084205 3300046518 Bacteria 1370
86 Ga0495632_0005151 3300046519 Bacteria 8724
87 Ga0495632_0065265 3300046519 Bacteria 1758
88 Ga0495632_0405310 3300046519 Bacteria 595
89 Ga0495637_0001439 3300046520 Bacteria 14028
90 Ga0495643_0000411 3300046522 Bacteria 56229
91 Ga0495643_0006464 3300046522 Bacteria 7721
92 Ga0495643_0023561 3300046522 Bacteria 3499
93 Ga0495643_0066807 3300046522 Bacteria 1895
94 Ga0495644_0013106 3300046523 Bacteria 3185
95 Ga0495648_0038249 3300046524 Bacteria 3071
96 Ga0495648_0092561 3300046524 Bacteria 1688
97 Ga0495663_0008799 3300046525 Bacteria 2800
98 Ga0495663_0016782 3300046525 Bacteria 2071
99 Ga0495663_0032772 3300046525 Bacteria 1548
100 Ga0495666_0002367 3300046526 Bacteria 9401
101 Ga0495666_0002872 3300046526 Bacteria 8631
102 Ga0495666_0062657 3300046526 Bacteria 1776
103 Ga0495666_0084597 3300046526 Bacteria 1498
104 Ga0495666_0169330 3300046526 Bacteria 1011
105 Ga0495642_0002999 3300046528 Bacteria 6728
106 Ga0495642_0009867 3300046528 Bacteria 3658
107 Ga0495642_0012178 3300046528 Bacteria 3314
108 Ga0495642_0055991 3300046528 Bacteria 1628
109 Ga0495642_0104133 3300046528 Bacteria 1210
110 Ga0495642_0111182 3300046528 Bacteria 1171
111 Ga0495642_0294765 3300046528 Bacteria 710
112 Ga0495652_0034735 3300046529 Bacteria 4393
113 Ga0495652_1039819 3300046529 Bacteria 534
114 Ga0495654_0093498 3300046530 Bacteria 1392
115 Ga0495665_0020571 3300046531 Bacteria 3543
116 Ga0495665_0042095 3300046531 Bacteria 2431
117 Ga0495665_0082847 3300046531 Bacteria 1686
118 Ga0495665_0275520 3300046531 Bacteria 863
119 Ga0495640_0568014 3300046533 Bacteria 687
120 Ga0495586_0084050 3300046535 Bacteria 1752
121 Ga0495586_0578462 3300046535 Bacteria 649
122 Ga0495587_0015727 3300046536 Bacteria 4718
123 Ga0495587_0116205 3300046536 Bacteria 1534
124 Ga0495587_0672566 3300046536 Bacteria 568
125 Ga0495609_0004041 3300046538 Bacteria 8181
126 Ga0495609_0023819 3300046538 Bacteria 2811
127 Ga0495609_0059820 3300046538 Bacteria 1684
128 Ga0495609_0083943 3300046538 Bacteria 1390
129 Ga0495597_0003262 3300046542 Bacteria 9616
130 Ga0495597_0013284 3300046542 Bacteria 3950
131 Ga0495597_0034440 3300046542 Bacteria 2288
132 Ga0495597_0155809 3300046542 Bacteria 935
133 Ga0495597_0165127 3300046542 Bacteria 901
134 Ga0495622_0001393 3300046557 Bacteria 12291
135 Ga0495622_0110166 3300046557 Bacteria 1260
136 Ga0495622_0150195 3300046557 Bacteria 1054
137 Ga0495633_0004458 3300046558 Bacteria 8900
138 Ga0495633_0087073 3300046558 Bacteria 1452
139 Ga0495633_0207109 3300046558 Bacteria 899
140 Ga0495667_0384957 3300046559 Bacteria 884
141 Ga0495668_0032230 3300046616 Bacteria 2950
142 Ga0495668_0036054 3300046616 Bacteria 2772
143 Ga0495668_0053380 3300046616 Bacteria 2234
144 Ga0495634_0080271 3300046642 Bacteria 2135
145 Ga0495611_0010229 3300046648 Bacteria 3969
146 Ga0495611_0021786 3300046648 Bacteria 2769
147 Ga0495611_0062872 3300046648 Bacteria 1688
148 Ga0495625_0032895 3300046660 Bacteria 3839
149 Ga0495625_0044474 3300046660 Bacteria 3215
150 Ga0495625_0108951 3300046660 Bacteria 1895
151 Ga0495659_0164347 3300046664 Bacteria 898
152 Ga0495659_0353661 3300046664 Bacteria 628
153 Ga0495661_0003699 3300046665 Bacteria 11235
154 Ga0495661_0009884 3300046665 Bacteria 6526
155 Ga0495661_0010917 3300046665 Bacteria 6174
156 Ga0495661_0016380 3300046665 Bacteria 4915
157 Ga0495661_0046281 3300046665 Bacteria 2657
158 Ga0495661_0071977 3300046665 Bacteria 2018
159 Ga0495661_0081270 3300046665 Bacteria 1868
160 Ga0495661_0302751 3300046665 Bacteria 799
161 Ga0495661_0472573 3300046665 Bacteria 601
162 Ga0495588_0008482 3300046674 Bacteria 4720
163 Ga0495588_0072300 3300046674 Bacteria 1794
164 Ga0495588_0134549 3300046674 Bacteria 1304
165 Ga0495588_0333894 3300046674 Bacteria 797
166 Ga0495588_0337265 3300046674 Bacteria 793
167 Ga0495588_0361567 3300046674 Bacteria 762
168 Ga0495588_0584375 3300046674 Bacteria 585
169 Ga0495623_0002479 3300046679 Bacteria 12249
170 Ga0495623_0099398 3300046679 Bacteria 1774
171 Ga0495646_0246992 3300046680 Bacteria 957
172 Ga0495669_0313437 3300046684 Bacteria 757
173 Ga0495624_0046789 3300046690 Bacteria 2750
174 Ga0495670_0067523 3300046691 Bacteria 1805
175 Ga0495670_0590247 3300046691 Bacteria 605
176 Ga0495671_0050182 3300046692 Bacteria 2078
177 Ga0495649_0000049 3300046694 Bacteria 113865
178 Ga0495649_0002757 3300046694 Bacteria 12229
179 Ga0495649_0016666 3300046694 Bacteria 4164
180 Ga0495649_0021457 3300046694 Bacteria 3618
181 Ga0495649_0355180 3300046694 Bacteria 740
182 Ga0495589_0005107 3300046794 Bacteria 6944
183 Ga0495589_0030859 3300046794 Bacteria 2699
184 Ga0495589_0060495 3300046794 Bacteria 1860
185 Ga0495589_0067876 3300046794 Bacteria 1745
186 Ga0495589_0270424 3300046794 Bacteria 791
187 Ga0495600_0010196 3300046809 Bacteria 5824
188 Ga0495600_0055729 3300046809 Bacteria 2582
189 Ga0495660_0011432 3300046810 Bacteria 5151
190 Ga0495660_0135754 3300046810 Bacteria 1229
191 Ga0495581_0008248 3300047315 Bacteria 6038
192 Ga0495581_0008626 3300047315 Bacteria 5904
193 Ga0495581_0052951 3300047315 Bacteria 2344
194 Ga0495581_0747939 3300047315 Bacteria 562
195 Ga0495604_0016155 3300047317 Bacteria 5964
196 Ga0495604_0165789 3300047317 Bacteria 1558
197 Ga0495636_0034028 3300047318 Bacteria 2096
198 Ga0495636_0163982 3300047318 Bacteria 1002
199 Ga0495636_0374989 3300047318 Bacteria 674
200 Ga0495674_0021280 3300047319 Bacteria 6000
201 Ga0495674_0654840 3300047319 Bacteria 828
202 Ga0495672_0003536 3300047320 Bacteria 13307
203 Ga0495672_0030045 3300047320 Bacteria 3414
204 Ga0495672_0037393 3300047320 Bacteria 2971
205 Ga0495672_0185007 3300047320 Bacteria 1052
206 Ga0495676_0034163 3300047321 Bacteria 4270
207 Ga0495676_0048029 3300047321 Bacteria 3445
208 Ga0495676_0981297 3300047321 Bacteria 539
209 Ga0495680_0520134 3300047322 Bacteria 805
210 Ga0495683_0007061 3300047323 Bacteria 6094
211 Ga0495683_0007206 3300047323 Bacteria 6036
212 Ga0495683_0046017 3300047323 Bacteria 2190
213 Ga0495683_0060187 3300047323 Bacteria 1883
214 Ga0495683_0162949 3300047323 Bacteria 1030
215 Ga0495687_011487 3300047443 Bacteria 4755
216 Ga0495687_032064 3300047443 Bacteria 2404
217 Ga0495675_0070637 3300047444 Bacteria 2204
218 Ga0495675_0089324 3300047444 Bacteria 1934
219 Ga0495675_0182732 3300047444 Bacteria 1283
220 Ga0495675_0674664 3300047444 Bacteria 580
221 Ga0495677_0009752 3300047445 Bacteria 3539
222 Ga0495677_0014424 3300047445 Bacteria 2876
223 Ga0495677_0034396 3300047445 Bacteria 1849
224 Ga0495677_0087557 3300047445 Bacteria 1171
225 Ga0495677_0178097 3300047445 Bacteria 823
226 Ga0495677_0255717 3300047445 Bacteria 685
227 Ga0495679_011830 3300047446 Bacteria 3351
228 Ga0495685_011995 3300047447 Bacteria 2931
229 Ga0495685_046220 3300047447 Bacteria 1481
230 Ga0495685_190939 3300047447 Bacteria 658
231 Ga0495681_0004532 3300047470 Bacteria 9472
232 Ga0495681_0005786 3300047470 Bacteria 8215
233 Ga0495681_0034158 3300047470 Bacteria 2537
234 Ga0495681_0041840 3300047470 Bacteria 2222
235 Ga0495681_0055868 3300047470 Bacteria 1839
236 Ga0495686_0036231 3300047472 Bacteria 3167
237 Ga0495593_0021628 3300047673 Bacteria 3590
238 Ga0495593_0194217 3300047673 Bacteria 1021
239 Ga0495602_0042409 3300048088 Bacteria 4146
240 Ga0495602_0090180 3300048088 Bacteria 2547
241 Ga0495614_0186007 3300048089 Bacteria 936
242 Ga0495615_0071089 3300048090 Bacteria 938
243 Ga0495615_0072844 3300048090 Bacteria 929
244 Ga0495626_0000004 3300048091 Bacteria 356599
245 Ga0495626_0001165 3300048091 Bacteria 21902
246 Ga0495626_0001658 3300048091 Bacteria 17189
247 Ga0495626_0011894 3300048091 Bacteria 4582
248 Ga0495626_0017371 3300048091 Bacteria 3634
249 Ga0495626_0020029 3300048091 Bacteria 3338
250 Ga0495626_0024295 3300048091 Bacteria 2972
251 Ga0495626_0026507 3300048091 Bacteria 2824
252 Ga0495626_0208767 3300048091 Bacteria 798
253 Ga0496100_0044577 3300048903 Bacteria 2842
254 Ga0496102_0000113 3300048905 Bacteria 114531
255 Ga0496102_0037805 3300048905 Bacteria 4355
256 Ga0496103_0044879 3300048906 Bacteria 2725
257 Ga0496103_0073605 3300048906 Bacteria 2140
258 Ga0496107_0480293 3300048910 Bacteria 922
259 Ga0496110_0054927 3300048913 Bacteria 3503
260 Ga0496111_0030956 3300048914 Bacteria 3808
261 Ga0496113_0448127 3300048916 Bacteria 1037
262 Ga0496114_0116051 3300048917 Bacteria 2298
263 Ga0496115_0024115 3300048918 Bacteria 4726
264 Ga0496115_0148631 3300048918 Bacteria 1934
265 Ga0496115_0304375 3300048918 Bacteria 1306
266 Ga0496124_0249417 3300048927 Bacteria 1314
267 Ga0495678_000104 3300049459 Bacteria 103726
268 Ga0495678_003393 3300049459 Bacteria 9903
269 Ga0495682_0011917 3300049460 Bacteria 3342
270 Ga0501034_0136773 3300049571 Bacteria 2431
271 Ga0587077_045947 3300059493 Bacteria 895
272 Ga0587077_053389 3300059493 Bacteria 853
273 Ga0587082_081305 3300059504 Bacteria 676
274 Ga0587085_034917 3300059506 Bacteria 847
275 Ga0587088_042690 3300059508 Bacteria 860
276 Ga0587090_000609 3300059510 Bacteria 3106
277 Ga0587091_012637 3300059511 Bacteria 1341
278 Ga0587106_029567 3300059605 Bacteria 871
279 Ga0587101_037110 3300059623 Bacteria 788
280 Ga0587062_028813 3300059639 Bacteria 838
281 Ga0587068_049084 3300059641 Bacteria 785
282 Ga0587076_002708 3300059645 Bacteria 2021
283 Ga0587100_024002 3300059648 Bacteria 613
284 Ga0587107_070358 3300059652 Bacteria 637
285 Ga0587111_0000544 3300060346 Bacteria 3716
286 Ga0587111_0004252 3300060346 Bacteria 2115
287 Ga0466962_0314136 3300061719 Bacteria 776
288 2643799916 2643221556 Bacteria 7251154
289 2644028957 2643221603 Bacteria 6147767
290 2644474917 2643221684 Bacteria 7145183
291 2809146727 2808606418 Bacteria 6724496
292 Ga0495677_0002047
293 Ga0070671_101717390
294 Ga0105239_10274200
295 Ga0157372_10629107
296 Ga0163161_10111571
297 Ga0213872_10098835
298 Ga0213872_10336739
299 Ga0207650_10271453
300 Ga0207644_11665059
301 Ga0207679_10840937
302 Ga0209970_1001668
303 Ga0265338_10002526
304 Ga0307408_100000048
305 Ga0307406_10007807
306 Ga0395899_0001751
307 Ga0395899_0004262
308 Ga0395899_0294694
309 Ga0395900_0006268
310 Ga0395900_0057630
311 Ga0395900_0293622
312 Ga0395898_0895232
313 Ga0395905_0012379
314 Ga0395901_0004044
315 Ga0395901_0012876
316 Ga0395901_0129403
317 Ga0395901_1095276
318 Ga0436361_0377173
319 Ga0436361_0515000
320 Ga0466969_0095089
321 Ga0466969_0273115
322 Ga0466972_0000118
323 Ga0466965_0472310
324 Ga0466966_0004595
325 Ga0466961_0713057
326 Ga0466964_0170729
327 Ga0466970_0011347
328 Ga0466957_0039945
329 Ga0466959_0019473
330 Ga0495590_0333877
331 Ga0495629_0001542
332 Ga0495629_0066895
333 Ga0495629_0784679
334 Ga0495653_0015840
335 Ga0495653_0055637
336 Ga0495650_0002279
337 Ga0495580_0018351
338 Ga0495580_0126163
339 Ga0495582_0023450
340 Ga0495605_0018003
341 Ga0495605_0027049
342 Ga0495605_0032953
343 Ga0495605_0330110
344 Ga0495605_0490837
345 Ga0495584_0012540
346 Ga0495584_0227738
347 Ga0495584_0246338
348 Ga0495584_0294692
349 Ga0495585_0013975
350 Ga0495585_0031922
351 Ga0495594_0045491
352 Ga0495594_0199473
353 Ga0495594_0242840
354 Ga0495596_0002140
355 Ga0495596_0004831
356 Ga0495596_0363501
357 Ga0495607_0000552
358 Ga0495607_0005228
359 Ga0495607_0293934
360 Ga0495607_0477669
361 Ga0495583_0000060
362 Ga0495583_0000127
363 Ga0495583_0095471
364 Ga0495583_0207055
365 Ga0495606_0018981
366 Ga0495616_0010946
367 Ga0495616_0022113
368 Ga0495616_0087206
369 Ga0495616_0266378
370 Ga0495616_0365092
371 Ga0495630_0047893
372 Ga0495630_0301266
373 Ga0495631_0000794
374 Ga0495631_0018624
375 Ga0495631_0023432
376 Ga0495631_0084205
377 Ga0495632_0005151
378 Ga0495632_0065265
379 Ga0495632_0405310
380 Ga0495637_0001439
381 Ga0495643_0000411
382 Ga0495643_0006464
383 Ga0495643_0023561
384 Ga0495643_0066807
385 Ga0495644_0013106
386 Ga0495648_0038249
387 Ga0495648_0092561
388 Ga0495663_0008799
389 Ga0495663_0016782
390 Ga0495663_0032772
391 Ga0495666_0002367
392 Ga0495666_0002872
393 Ga0495666_0062657
394 Ga0495666_0084597
395 Ga0495666_0169330
396 Ga0495642_0002999
397 Ga0495642_0009867
398 Ga0495642_0012178
399 Ga0495642_0055991
400 Ga0495642_0104133
401 Ga0495642_0111182
402 Ga0495642_0294765
403 Ga0495652_0034735
404 Ga0495652_1039819
405 Ga0495654_0093498
406 Ga0495665_0020571
407 Ga0495665_0042095
408 Ga0495665_0082847
409 Ga0495665_0275520
410 Ga0495640_0568014
411 Ga0495586_0084050
412 Ga0495586_0578462
413 Ga0495587_0015727
414 Ga0495587_0116205
415 Ga0495587_0672566
416 Ga0495609_0004041
417 Ga0495609_0023819
418 Ga0495609_0059820
419 Ga0495609_0083943
420 Ga0495597_0003262
421 Ga0495597_0013284
422 Ga0495597_0034440
423 Ga0495597_0155809
424 Ga0495597_0165127
425 Ga0495622_0001393
426 Ga0495622_0110166
427 Ga0495622_0150195
428 Ga0495633_0004458
429 Ga0495633_0087073
430 Ga0495633_0207109
431 Ga0495667_0384957
432 Ga0495668_0032230
433 Ga0495668_0036054
434 Ga0495668_0053380
435 Ga0495634_0080271
436 Ga0495611_0010229
437 Ga0495611_0021786
438 Ga0495611_0062872
439 Ga0495625_0032895
440 Ga0495625_0044474
441 Ga0495625_0108951
442 Ga0495659_0164347
443 Ga0495659_0353661
444 Ga0495661_0003699
445 Ga0495661_0009884
446 Ga0495661_0010917
447 Ga0495661_0016380
448 Ga0495661_0046281
449 Ga0495661_0071977
450 Ga0495661_0081270
451 Ga0495661_0302751
452 Ga0495661_0472573
453 Ga0495588_0008482
454 Ga0495588_0072300
455 Ga0495588_0134549
456 Ga0495588_0333894
457 Ga0495588_0337265
458 Ga0495588_0361567
459 Ga0495588_0584375
460 Ga0495623_0002479
461 Ga0495623_0099398
462 Ga0495646_0246992
463 Ga0495669_0313437
464 Ga0495624_0046789
465 Ga0495670_0067523
466 Ga0495670_0590247
467 Ga0495671_0050182
468 Ga0495649_0000049
469 Ga0495649_0002757
470 Ga0495649_0016666
471 Ga0495649_0021457
472 Ga0495649_0355180
473 Ga0495589_0005107
474 Ga0495589_0030859
475 Ga0495589_0060495
476 Ga0495589_0067876
477 Ga0495589_0270424
478 Ga0495600_0010196
479 Ga0495600_0055729
480 Ga0495660_0011432
481 Ga0495660_0135754
482 Ga0495581_0008248
483 Ga0495581_0008626
484 Ga0495581_0052951
485 Ga0495581_0747939
486 Ga0495604_0016155
487 Ga0495604_0165789
488 Ga0495636_0034028
489 Ga0495636_0163982
490 Ga0495636_0374989
491 Ga0495674_0021280
492 Ga0495674_0654840
493 Ga0495672_0003536
494 Ga0495672_0030045
495 Ga0495672_0037393
496 Ga0495672_0185007
497 Ga0495676_0034163
498 Ga0495676_0048029
499 Ga0495676_0981297
500 Ga0495680_0520134
501 Ga0495683_0007061
502 Ga0495683_0007206
503 Ga0495683_0046017
504 Ga0495683_0060187
505 Ga0495683_0162949
506 Ga0495687_011487
507 Ga0495687_032064
508 Ga0495675_0070637
509 Ga0495675_0089324
510 Ga0495675_0182732
511 Ga0495675_0674664
512 Ga0495677_0009752
513 Ga0495677_0014424
514 Ga0495677_0034396
515 Ga0495677_0087557
516 Ga0495677_0178097
517 Ga0495677_0255717
518 Ga0495679_011830
519 Ga0495685_011995
520 Ga0495685_046220
521 Ga0495685_190939
522 Ga0495681_0004532
523 Ga0495681_0005786
524 Ga0495681_0034158
525 Ga0495681_0041840
526 Ga0495681_0055868
527 Ga0495686_0036231
528 Ga0495593_0021628
529 Ga0495593_0194217
530 Ga0495602_0042409
531 Ga0495602_0090180
532 Ga0495614_0186007
533 Ga0495615_0071089
534 Ga0495615_0072844
535 Ga0495626_0000004
536 Ga0495626_0001165
537 Ga0495626_0001658
538 Ga0495626_0011894
539 Ga0495626_0017371
540 Ga0495626_0020029
541 Ga0495626_0024295
542 Ga0495626_0026507
543 Ga0495626_0208767
544 Ga0496100_0044577
545 Ga0496102_0000113
546 Ga0496102_0037805
547 Ga0496103_0044879
548 Ga0496103_0073605
549 Ga0496107_0480293
550 Ga0496110_0054927
551 Ga0496111_0030956
552 Ga0496113_0448127
553 Ga0496114_0116051
554 Ga0496115_0024115
555 Ga0496115_0148631
556 Ga0496115_0304375
557 Ga0496124_0249417
558 Ga0495678_000104
559 Ga0495678_003393
560 Ga0495682_0011917
561 Ga0501034_0136773
562 Ga0587077_045947
563 Ga0587077_053389
564 Ga0587082_081305
565 Ga0587085_034917
566 Ga0587088_042690
567 Ga0587090_000609
568 Ga0587091_012637
569 Ga0587106_029567
570 Ga0587101_037110
571 Ga0587062_028813
572 Ga0587068_049084
573 Ga0587076_002708
574 Ga0587100_024002
575 Ga0587107_070358
576 Ga0587111_0000544
577 Ga0587111_0004252
578 Ga0466962_0314136
579 2643799916
580 2644028957
581 2644474917
582 2809146727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

42

124

0.96

PF13279

4HBT_2

Thioesterase-like superfamily

34

156

0.9

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

19

130

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
5byu-assembly1.cif.gz_D crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9482 10 116
5dio-assembly1.cif.gz_A-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9438 6 132
5dio-assembly1.cif.gz_B-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9421 9 132
5byu-assembly1.cif.gz_D crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9394 10 116
3qy3-assembly1.cif.gz_A pa2801 protein, a putative thioesterase from pseudomonas aeruginosa 0.9384 8 133
ID Description Score Start End Superfamily
af_Q4DFA9_220_330_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9577 11 45 3.10.129.10
5byuD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9482 10 116 3.10.129.10
5dioB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9421 9 132 3.10.129.10
5byuD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9394 10 116 3.10.129.10
3qy3A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9376 8 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2D0IHC4-F1-model_v4 Thioesterase 0.9859 6 135 GO:0047617
AF-A0A315C8M0-F1-model_v4 deleted 0.9835 6 135
AF-A0A7X7HLM8-F1-model_v4 Acyl-CoA thioesterase 0.9797 12 141 GO:0047617
AF-A0A1D2SEK0-F1-model_v4 Thioesterase 0.9731 6 135 GO:0047617
AF-A0A7X7HLM8-F1-model_v4 Acyl-CoA thioesterase 0.965 12 141 GO:0047617

Map