F390503

General Info

Members Datasets Scaffolds Average Seq Length
291 163 582 188

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0025141|Ga0451576_0025141_4210_4848
Length 212
Sequence MPFDAADVRNAVAKAMTNVIQLNCDHGVTDPDLDRLCAGDSVELTGRVISFRDATAARLTRALQAGEPIPVSLHHQILYAVGPSPPKPGQIIGSAGPTTTARMARFLPTLFAAGVRAVIGKGELHGDDMTAFVTCGAVYLAAIGGLGALLAKQICSANVMGYDDLGPEALYALEINAFPVVVIIDRQGRNFHEMSRARWKSLPRRSGERYGG

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
112 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
113 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
114 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
115 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0.34
Rhizoplane 0
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 27.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0025141 3300045051 Bacteria 6420
2 Ga0055532_1000335 3300003758 Bacteria 25726
3 Ga0065715_10529606 3300005293 Unclassified 757
4 Ga0068868_100203546 3300005338 Bacteria 1651
5 Ga0070689_100058884 3300005340 Bacteria 2984
6 Ga0070691_10108014 3300005341 Unclassified 1389
7 Ga0070687_100368322 3300005343 Unclassified 932
8 Ga0070669_100152752 3300005353 Bacteria 1788
9 Ga0070675_100024208 3300005354 Bacteria 4862
10 Ga0070675_100102711 3300005354 Bacteria 2409
11 Ga0070675_100430177 3300005354 Unclassified 1181
12 Ga0070673_100043760 3300005364 Unclassified 3462
13 Ga0070673_100074718 3300005364 Bacteria 2732
14 Ga0070673_100122033 3300005364 Bacteria 2175
15 Ga0070688_100012214 3300005365 Bacteria 4806
16 Ga0070659_100168097 3300005366 Bacteria 1795
17 Ga0070667_100570558 3300005367 Bacteria 1041
18 Ga0070701_10073425 3300005438 Unclassified 1834
19 Ga0070705_100008138 3300005440 Bacteria 5186
20 Ga0070705_100033932 3300005440 Bacteria 2849
21 Ga0070700_100185880 3300005441 Bacteria 1449
22 Ga0070694_100000734 3300005444 Bacteria 18310
23 Ga0070694_100001223 3300005444 Bacteria 14829
24 Ga0070694_100013797 3300005444 Bacteria 5051
25 Ga0070694_100016935 3300005444 Bacteria 4596
26 Ga0070708_100109331 3300005445 Unclassified 2540
27 Ga0070708_100169363 3300005445 Bacteria 2038
28 Ga0070662_100046004 3300005457 Unclassified 3134
29 Ga0070662_100493480 3300005457 Bacteria 1021
30 Ga0070681_10132772 3300005458 Bacteria 2421
31 Ga0068867_100003655 3300005459 Bacteria 10823
32 Ga0070685_10077972 3300005466 Bacteria 1980
33 Ga0070706_100300800 3300005467 Bacteria 1497
34 Ga0070707_100041033 3300005468 Bacteria 4429
35 Ga0070707_100110036 3300005468 Bacteria 2671
36 Ga0070707_100256441 3300005468 Bacteria 1702
37 Ga0070698_100014372 3300005471 Bacteria 8363
38 Ga0070698_100168330 3300005471 Unclassified 2133
39 Ga0070698_100308344 3300005471 Unclassified 1514
40 Ga0070699_100000912 3300005518 Bacteria 27543
41 Ga0070699_100051561 3300005518 Bacteria 3562
42 Ga0070699_100125450 3300005518 Bacteria 2260
43 Ga0070699_100154221 3300005518 Bacteria 2032
44 Ga0070697_100105551 3300005536 Bacteria 2343
45 Ga0070697_100438120 3300005536 Bacteria 1137
46 Ga0070686_100184239 3300005544 Unclassified 1486
47 Ga0070686_100719634 3300005544 Bacteria 798
48 Ga0070695_100004284 3300005545 Bacteria 8347
49 Ga0070695_100010903 3300005545 Bacteria 5431
50 Ga0070695_100623939 3300005545 Unclassified 849
51 Ga0070696_100008858 3300005546 Bacteria 6730
52 Ga0070696_100011724 3300005546 Bacteria 5874
53 Ga0070696_100073904 3300005546 Bacteria 2403
54 Ga0070693_100444173 3300005547 Unclassified 909
55 Ga0070704_100003478 3300005549 Bacteria 9042
56 Ga0070704_100035596 3300005549 Bacteria 3385
57 Ga0070704_100107132 3300005549 Bacteria 2119
58 Ga0070704_100218556 3300005549 Unclassified 1548
59 Ga0068857_100037232 3300005577 Bacteria 4309
60 Ga0068857_100207246 3300005577 Bacteria 1788
61 Ga0068854_100222800 3300005578 Bacteria 1493
62 Ga0068859_100000969 3300005617 Bacteria 29391
63 Ga0068859_100102759 3300005617 Bacteria 2916
64 Ga0068859_100225867 3300005617 Bacteria 1960
65 Ga0068864_100027623 3300005618 Bacteria 4794
66 Ga0068864_100030459 3300005618 Bacteria 4574
67 Ga0068864_100412173 3300005618 Bacteria 1286
68 Ga0068861_100934767 3300005719 Unclassified 823
69 Ga0068870_10002012 3300005840 Bacteria 8402
70 Ga0068870_10107988 3300005840 Bacteria 1584
71 Ga0068858_100007327 3300005842 Bacteria 10678
72 Ga0068860_100130034 3300005843 Bacteria 2415
73 Ga0068862_100000603 3300005844 Bacteria 37377
74 Ga0068862_100242865 3300005844 Unclassified 1638
75 Ga0081455_10161162 3300005937 Bacteria 1719
76 Ga0097621_100177318 3300006237 Unclassified 1840
77 Ga0097621_100419611 3300006237 Bacteria 1201
78 Ga0068871_100147021 3300006358 Unclassified 2007
79 Ga0068871_100184948 3300006358 Bacteria 1792
80 Ga0068871_100233687 3300006358 Bacteria 1596
81 Ga0075428_100017144 3300006844 Bacteria 8001
82 Ga0075428_100017826 3300006844 Bacteria 7846
83 Ga0075428_100045784 3300006844 Bacteria 4807
84 Ga0075428_100077387 3300006844 Unclassified 3631
85 Ga0075428_101471764 3300006844 Unclassified 714
86 Ga0075430_100010836 3300006846 Bacteria 7723
87 Ga0075430_100077812 3300006846 Bacteria 2780
88 Ga0075430_100094016 3300006846 Unclassified 2506
89 Ga0075430_100224108 3300006846 Bacteria 1560
90 Ga0075430_100798732 3300006846 Bacteria 778
91 Ga0075431_100010900 3300006847 Bacteria 9144
92 Ga0075431_100170806 3300006847 Bacteria 2234
93 Ga0075431_100176598 3300006847 Unclassified 2193
94 Ga0075431_100699227 3300006847 Bacteria 991
95 Ga0075431_100974508 3300006847 Bacteria 815
96 Ga0075433_10000445 3300006852 Bacteria 26756
97 Ga0075433_10044841 3300006852 Bacteria 3842
98 Ga0075433_10070927 3300006852 Bacteria 3063
99 Ga0075433_10165175 3300006852 Bacteria 1970
100 Ga0075433_10243782 3300006852 Unclassified 1595
101 Ga0075434_100000579 3300006871 Bacteria 28227
102 Ga0075434_100001436 3300006871 Bacteria 20006
103 Ga0075434_100038232 3300006871 Bacteria 4753
104 Ga0075434_100067337 3300006871 Bacteria 3567
105 Ga0075434_100173295 3300006871 Bacteria 2177
106 Ga0075434_100731626 3300006871 Archaea 1006
107 Ga0075429_100124036 3300006880 Bacteria 2258
108 Ga0068865_100561431 3300006881 Bacteria 960
109 Ga0097620_100000969 3300006931 Bacteria 29391
110 Ga0097620_100102760 3300006931 Bacteria 2916
111 Ga0097620_100225874 3300006931 Bacteria 1960
112 Ga0079104_1000050 3300006946 Bacteria 173000
113 Ga0075435_100013525 3300007076 Bacteria 6074
114 Ga0075435_100076849 3300007076 Unclassified 2737
115 Ga0075435_100143025 3300007076 Unclassified 2008
116 Ga0075435_100148402 3300007076 Unclassified 1970
117 Ga0075435_100217567 3300007076 Bacteria 1622
118 Ga0111539_10004829 3300009094 Bacteria 17568
119 Ga0111539_10009260 3300009094 Bacteria 12445
120 Ga0111539_10023323 3300009094 Bacteria 7603
121 Ga0111539_10057454 3300009094 Unclassified 4621
122 Ga0111539_10236748 3300009094 Unclassified 2125
123 Ga0111539_10447535 3300009094 Bacteria 1504
124 Ga0105245_10875476 3300009098 Unclassified 939
125 Ga0114129_10004046 3300009147 Bacteria 20706
126 Ga0114129_10008065 3300009147 Bacteria 15007
127 Ga0114129_10033841 3300009147 Bacteria 7219
128 Ga0114129_10039575 3300009147 Bacteria 6647
129 Ga0114129_10057498 3300009147 Bacteria 5442
130 Ga0114129_10069693 3300009147 Unclassified 4902
131 Ga0114129_10343445 3300009147 Unclassified 1979
132 Ga0105243_10067131 3300009148 Unclassified 2887
133 Ga0105243_10235516 3300009148 Unclassified 1626
134 Ga0105242_10325045 3300009176 Unclassified 1412
135 Ga0105249_10017654 3300009553 Bacteria 6337
136 Ga0157378_10253920 3300013297 Unclassified 1684
137 Ga0163162_10236334 3300013306 Unclassified 1958
138 Ga0157375_10008416 3300013308 Bacteria 9035
139 Ga0157375_10108829 3300013308 Unclassified 2867
140 Ga0157375_10696577 3300013308 Bacteria 1170
141 Ga0163163_11592775 3300014325 Bacteria 714
142 Ga0157376_10408627 3300014969 Bacteria 1314
143 Ga0157376_10769509 3300014969 Unclassified 973
144 Ga0209147_100155 3300025229 Bacteria 93839
145 Ga0207697_10026146 3300025315 Unclassified 2387
146 Ga0207653_10078313 3300025885 Unclassified 1140
147 Ga0207682_10121482 3300025893 Bacteria 1159
148 Ga0207688_10099169 3300025901 Bacteria 1680
149 Ga0207645_10019480 3300025907 Unclassified 4447
150 Ga0207643_10003460 3300025908 Bacteria 8498
151 Ga0207643_10052376 3300025908 Bacteria 2318
152 Ga0207643_10091186 3300025908 Bacteria 1777
153 Ga0207684_10545753 3300025910 Unclassified 992
154 Ga0207707_10047726 3300025912 Unclassified 3729
155 Ga0207662_10043316 3300025918 Unclassified 2655
156 Ga0207646_10026707 3300025922 Bacteria 5267
157 Ga0207646_10200188 3300025922 Bacteria 1804
158 Ga0207681_10002902 3300025923 Bacteria 10837
159 Ga0207681_10151333 3300025923 Bacteria 1739
160 Ga0207650_10071152 3300025925 Bacteria 2616
161 Ga0207659_10001772 3300025926 Bacteria 12765
162 Ga0207659_10017092 3300025926 Bacteria 4733
163 Ga0207659_10060150 3300025926 Bacteria 2733
164 Ga0207644_10045018 3300025931 Bacteria 3138
165 Ga0207706_10018920 3300025933 Bacteria 6193
166 Ga0207706_10082533 3300025933 Bacteria 2825
167 Ga0207706_10596393 3300025933 Unclassified 949
168 Ga0207706_10697645 3300025933 Archaea 867
169 Ga0207709_10077825 3300025935 Unclassified 2127
170 Ga0207709_10661943 3300025935 Bacteria 832
171 Ga0207670_10039200 3300025936 Bacteria 3101
172 Ga0207689_10046830 3300025942 Bacteria 3572
173 Ga0207651_10092721 3300025960 Unclassified 2216
174 Ga0207651_10250699 3300025960 Unclassified 1448
175 Ga0207712_10003929 3300025961 Bacteria 9393
176 Ga0207668_10716854 3300025972 Unclassified 880
177 Ga0207658_10082670 3300025986 Bacteria 2467
178 Ga0207677_10377314 3300026023 Bacteria 1196
179 Ga0207703_10007003 3300026035 Bacteria 8971
180 Ga0207708_10021795 3300026075 Bacteria 4834
181 Ga0207708_10055774 3300026075 Bacteria 3013
182 Ga0207708_10261865 3300026075 Bacteria 1396
183 Ga0207648_10005118 3300026089 Bacteria 13285
184 Ga0207676_10014618 3300026095 Bacteria 5653
185 Ga0207676_10614711 3300026095 Bacteria 1045
186 Ga0207674_10019767 3300026116 Bacteria 7288
187 Ga0207674_10044070 3300026116 Bacteria 4598
188 Ga0207675_100008364 3300026118 Bacteria 9751
189 Ga0207675_100037444 3300026118 Bacteria 4525
190 Ga0207683_10027158 3300026121 Bacteria 4946
191 Ga0207428_10000592 3300027907 Bacteria 42773
192 Ga0207428_10003760 3300027907 Bacteria 14571
193 Ga0268265_10000485 3300028380 Bacteria 41537
194 Ga0268264_10014737 3300028381 Bacteria 6423
195 Ga0316576_10443901 3300031727 Bacteria 959
196 Ga0316578_10595643 3300031728 Unclassified 648
197 Ga0316577_10276705 3300031733 Bacteria 950
198 Ga0307416_101243046 3300032002 Bacteria 850
199 Ga0307414_10136443 3300032004 Bacteria 1914
200 Ga0373949_0008199 3300035090 Bacteria 2289
201 Ga0373955_0056370 3300035172 Bacteria 2156
202 Ga0316574_0092971 3300035398 Bacteria 1925
203 Ga0373935_0204156 3300035692 Bacteria 1367
204 Ga0373947_0341052 3300035725 Bacteria 1004
205 Ga0316584_0087300 3300036712 Bacteria 2335
206 Ga0400484_16706 3300038725 Bacteria 1076
207 Ga0451855_0680335 3300041511 Bacteria 857
208 Ga0450896_003254 3300042133 Bacteria 2150
209 Ga0450910_073420 3300042147 Bacteria 591
210 Ga0450916_007387 3300042530 Unclassified 1318
211 Ga0451577_1071406 3300042876 Unclassified 722
212 Ga0453684_0499769 3300044712 Bacteria 1346
213 Ga0451576_0212995 3300045051 Bacteria 2017
214 Ga0495627_102199 3300046453 Bacteria 817
215 Ga0495603_0032738 3300046455 Bacteria 3127
216 Ga0495603_0071185 3300046455 Bacteria 2044
217 Ga0495584_0048198 3300046491 Unclassified 2148
218 Ga0495594_0010899 3300046499 Bacteria 4722
219 Ga0495594_0015489 3300046499 Bacteria 4006
220 Ga0495628_0315239 3300046516 Bacteria 1155
221 Ga0495642_0005364 3300046528 Bacteria 4918
222 Ga0495654_0034287 3300046530 Bacteria 2562
223 Ga0495665_0103894 3300046531 Bacteria 1491
224 Ga0495586_0473980 3300046535 Unclassified 722
225 Ga0495598_0009475 3300046537 Bacteria 2304
226 Ga0495598_0038733 3300046537 Unclassified 1382
227 Ga0495621_0004604 3300046539 Bacteria 3896
228 Ga0495621_0013837 3300046539 Bacteria 2543
229 Ga0495621_0055787 3300046539 Unclassified 1423
230 Ga0495645_0113946 3300046543 Bacteria 1911
231 Ga0495633_0092684 3300046558 Bacteria 1404
232 Ga0495656_0002370 3300046615 Bacteria 6247
233 Ga0495659_0083470 3300046664 Bacteria 1216
234 Ga0495588_0002399 3300046674 Bacteria 8011
235 Ga0495669_0015134 3300046684 Bacteria 3301
236 Ga0495669_0046530 3300046684 Bacteria 1937
237 Ga0495670_0053796 3300046691 Bacteria 2016
238 Ga0495636_0187163 3300047318 Unclassified 941
239 Ga0495676_0110217 3300047321 Unclassified 2021
240 Ga0496122_0102613 3300048925 Bacteria 1906
241 Ga0501033_0683329 3300049570 Unclassified 699
242 Ga0501038_0787277 3300049574 Unclassified 707
243 Ga0501039_0579656 3300049575 Unclassified 880
244 Ga0501040_0493864 3300049576 Unclassified 882
245 Ga0501046_0032428 3300049580 Bacteria 4230
246 Ga0501071_0335312 3300049587 Unclassified 1150
247 Ga0501072_0422619 3300049588 Unclassified 1056
248 Ga0501073_0433138 3300049589 Unclassified 909
249 Ga0501075_0036228 3300049591 Bacteria 3682
250 Ga0501076_0574928 3300049592 Unclassified 929
251 Ga0501079_0415720 3300049741 Unclassified 1055
252 Ga0501080_1128686 3300049742 Bacteria 676
253 Ga0501081_0113893 3300049743 Unclassified 1921
254 nmdc:mga05p37_1109642_c1 3300050507 Unclassified 827
255 nmdc:mga05p37_13532_c1 3300050507 Bacteria 9781
256 nmdc:mga05p37_239774_c1 3300050507 Unclassified 2181
257 nmdc:mga05p37_5997_c1 3300050507 Bacteria 14305
258 nmdc:mga05p37_738728_c1 3300050507 Unclassified 1087
259 nmdc:mga05p37_8871_c1 3300050507 Bacteria 11878
260 nmdc:mga09592_108176_c1 3300050508 Bacteria 2385
261 nmdc:mga09592_34775_c1 3300050508 Bacteria 4214
262 nmdc:mga09592_910442_c1 3300050508 Bacteria 739
263 nmdc:mga0qj67_115448_c1 3300050509 Bacteria 2169
264 nmdc:mga0qj67_12390_c1 3300050509 Bacteria 6423
265 nmdc:mga0qj67_178690_c1 3300050509 Bacteria 1724
266 nmdc:mga0qj67_203068_c1 3300050509 Bacteria 1610
267 nmdc:mga0qj67_734707_c1 3300050509 Bacteria 784
268 nmdc:mga06r32_329189_c1 3300050510 Unclassified 1513
269 nmdc:mga06r32_742652_c1 3300050510 Bacteria 945
270 nmdc:mga06r32_86809_c1 3300050510 Bacteria 3052
271 nmdc:mga08y16_10076_c1 3300050511 Bacteria 9922
272 nmdc:mga08y16_4439_c1 3300050511 Bacteria 14664
273 nmdc:mga08y16_5242_c1 3300050511 Bacteria 13538
274 nmdc:mga08y16_96564_c1 3300050511 Bacteria 3078
275 nmdc:mga0n895_108215_c1 3300050512 Unclassified 2794
276 nmdc:mga0n895_119371_c1 3300050512 Unclassified 2658
277 nmdc:mga0n895_237230_c1 3300050512 Bacteria 1851
278 nmdc:mga0n895_574_c1 3300050512 Bacteria 25246
279 nmdc:mga0n895_681814_c1 3300050512 Archaea 1025
280 nmdc:mga0n895_7430_c1 3300050512 Bacteria 9402
281 nmdc:mga0rr50_149869_c1 3300050513 Unclassified 1884
282 nmdc:mga0rr50_33710_c1 3300050513 Bacteria 3660
283 nmdc:mga0a205_205866_c1 3300050515 Unclassified 1857
284 nmdc:mga0a205_27526_c1 3300050515 Bacteria 5429
285 nmdc:mga0a205_413813_c1 3300050515 Unclassified 1211
286 nmdc:mga0a205_58744_c1 3300050515 Bacteria 3715
287 nmdc:mga0a205_813_c1 3300050515 Bacteria 25396
288 Ga0501084_0927659 3300054114 Unclassified 732
289 Ga0501082_0559630 3300060353 Bacteria 1000
290 Ga0530510_0537528 3300061734 Unclassified 887
291 8007379612 8007375930 Bacteria 4080554
292 Ga0451576_0025141
293 Ga0055532_1000335
294 Ga0065715_10529606
295 Ga0068868_100203546
296 Ga0070689_100058884
297 Ga0070691_10108014
298 Ga0070687_100368322
299 Ga0070669_100152752
300 Ga0070675_100024208
301 Ga0070675_100102711
302 Ga0070675_100430177
303 Ga0070673_100043760
304 Ga0070673_100074718
305 Ga0070673_100122033
306 Ga0070688_100012214
307 Ga0070659_100168097
308 Ga0070667_100570558
309 Ga0070701_10073425
310 Ga0070705_100008138
311 Ga0070705_100033932
312 Ga0070700_100185880
313 Ga0070694_100000734
314 Ga0070694_100001223
315 Ga0070694_100013797
316 Ga0070694_100016935
317 Ga0070708_100109331
318 Ga0070708_100169363
319 Ga0070662_100046004
320 Ga0070662_100493480
321 Ga0070681_10132772
322 Ga0068867_100003655
323 Ga0070685_10077972
324 Ga0070706_100300800
325 Ga0070707_100041033
326 Ga0070707_100110036
327 Ga0070707_100256441
328 Ga0070698_100014372
329 Ga0070698_100168330
330 Ga0070698_100308344
331 Ga0070699_100000912
332 Ga0070699_100051561
333 Ga0070699_100125450
334 Ga0070699_100154221
335 Ga0070697_100105551
336 Ga0070697_100438120
337 Ga0070686_100184239
338 Ga0070686_100719634
339 Ga0070695_100004284
340 Ga0070695_100010903
341 Ga0070695_100623939
342 Ga0070696_100008858
343 Ga0070696_100011724
344 Ga0070696_100073904
345 Ga0070693_100444173
346 Ga0070704_100003478
347 Ga0070704_100035596
348 Ga0070704_100107132
349 Ga0070704_100218556
350 Ga0068857_100037232
351 Ga0068857_100207246
352 Ga0068854_100222800
353 Ga0068859_100000969
354 Ga0068859_100102759
355 Ga0068859_100225867
356 Ga0068864_100027623
357 Ga0068864_100030459
358 Ga0068864_100412173
359 Ga0068861_100934767
360 Ga0068870_10002012
361 Ga0068870_10107988
362 Ga0068858_100007327
363 Ga0068860_100130034
364 Ga0068862_100000603
365 Ga0068862_100242865
366 Ga0081455_10161162
367 Ga0097621_100177318
368 Ga0097621_100419611
369 Ga0068871_100147021
370 Ga0068871_100184948
371 Ga0068871_100233687
372 Ga0075428_100017144
373 Ga0075428_100017826
374 Ga0075428_100045784
375 Ga0075428_100077387
376 Ga0075428_101471764
377 Ga0075430_100010836
378 Ga0075430_100077812
379 Ga0075430_100094016
380 Ga0075430_100224108
381 Ga0075430_100798732
382 Ga0075431_100010900
383 Ga0075431_100170806
384 Ga0075431_100176598
385 Ga0075431_100699227
386 Ga0075431_100974508
387 Ga0075433_10000445
388 Ga0075433_10044841
389 Ga0075433_10070927
390 Ga0075433_10165175
391 Ga0075433_10243782
392 Ga0075434_100000579
393 Ga0075434_100001436
394 Ga0075434_100038232
395 Ga0075434_100067337
396 Ga0075434_100173295
397 Ga0075434_100731626
398 Ga0075429_100124036
399 Ga0068865_100561431
400 Ga0097620_100000969
401 Ga0097620_100102760
402 Ga0097620_100225874
403 Ga0079104_1000050
404 Ga0075435_100013525
405 Ga0075435_100076849
406 Ga0075435_100143025
407 Ga0075435_100148402
408 Ga0075435_100217567
409 Ga0111539_10004829
410 Ga0111539_10009260
411 Ga0111539_10023323
412 Ga0111539_10057454
413 Ga0111539_10236748
414 Ga0111539_10447535
415 Ga0105245_10875476
416 Ga0114129_10004046
417 Ga0114129_10008065
418 Ga0114129_10033841
419 Ga0114129_10039575
420 Ga0114129_10057498
421 Ga0114129_10069693
422 Ga0114129_10343445
423 Ga0105243_10067131
424 Ga0105243_10235516
425 Ga0105242_10325045
426 Ga0105249_10017654
427 Ga0157378_10253920
428 Ga0163162_10236334
429 Ga0157375_10008416
430 Ga0157375_10108829
431 Ga0157375_10696577
432 Ga0163163_11592775
433 Ga0157376_10408627
434 Ga0157376_10769509
435 Ga0209147_100155
436 Ga0207697_10026146
437 Ga0207653_10078313
438 Ga0207682_10121482
439 Ga0207688_10099169
440 Ga0207645_10019480
441 Ga0207643_10003460
442 Ga0207643_10052376
443 Ga0207643_10091186
444 Ga0207684_10545753
445 Ga0207707_10047726
446 Ga0207662_10043316
447 Ga0207646_10026707
448 Ga0207646_10200188
449 Ga0207681_10002902
450 Ga0207681_10151333
451 Ga0207650_10071152
452 Ga0207659_10001772
453 Ga0207659_10017092
454 Ga0207659_10060150
455 Ga0207644_10045018
456 Ga0207706_10018920
457 Ga0207706_10082533
458 Ga0207706_10596393
459 Ga0207706_10697645
460 Ga0207709_10077825
461 Ga0207709_10661943
462 Ga0207670_10039200
463 Ga0207689_10046830
464 Ga0207651_10092721
465 Ga0207651_10250699
466 Ga0207712_10003929
467 Ga0207668_10716854
468 Ga0207658_10082670
469 Ga0207677_10377314
470 Ga0207703_10007003
471 Ga0207708_10021795
472 Ga0207708_10055774
473 Ga0207708_10261865
474 Ga0207648_10005118
475 Ga0207676_10014618
476 Ga0207676_10614711
477 Ga0207674_10019767
478 Ga0207674_10044070
479 Ga0207675_100008364
480 Ga0207675_100037444
481 Ga0207683_10027158
482 Ga0207428_10000592
483 Ga0207428_10003760
484 Ga0268265_10000485
485 Ga0268264_10014737
486 Ga0316576_10443901
487 Ga0316578_10595643
488 Ga0316577_10276705
489 Ga0307416_101243046
490 Ga0307414_10136443
491 Ga0373949_0008199
492 Ga0373955_0056370
493 Ga0316574_0092971
494 Ga0373935_0204156
495 Ga0373947_0341052
496 Ga0316584_0087300
497 Ga0400484_16706
498 Ga0451855_0680335
499 Ga0450896_003254
500 Ga0450910_073420
501 Ga0450916_007387
502 Ga0451577_1071406
503 Ga0453684_0499769
504 Ga0451576_0212995
505 Ga0495627_102199
506 Ga0495603_0032738
507 Ga0495603_0071185
508 Ga0495584_0048198
509 Ga0495594_0010899
510 Ga0495594_0015489
511 Ga0495628_0315239
512 Ga0495642_0005364
513 Ga0495654_0034287
514 Ga0495665_0103894
515 Ga0495586_0473980
516 Ga0495598_0009475
517 Ga0495598_0038733
518 Ga0495621_0004604
519 Ga0495621_0013837
520 Ga0495621_0055787
521 Ga0495645_0113946
522 Ga0495633_0092684
523 Ga0495656_0002370
524 Ga0495659_0083470
525 Ga0495588_0002399
526 Ga0495669_0015134
527 Ga0495669_0046530
528 Ga0495670_0053796
529 Ga0495636_0187163
530 Ga0495676_0110217
531 Ga0496122_0102613
532 Ga0501033_0683329
533 Ga0501038_0787277
534 Ga0501039_0579656
535 Ga0501040_0493864
536 Ga0501046_0032428
537 Ga0501071_0335312
538 Ga0501072_0422619
539 Ga0501073_0433138
540 Ga0501075_0036228
541 Ga0501076_0574928
542 Ga0501079_0415720
543 Ga0501080_1128686
544 Ga0501081_0113893
545 nmdc:mga05p37_1109642_c1
546 nmdc:mga05p37_13532_c1
547 nmdc:mga05p37_239774_c1
548 nmdc:mga05p37_5997_c1
549 nmdc:mga05p37_738728_c1
550 nmdc:mga05p37_8871_c1
551 nmdc:mga09592_108176_c1
552 nmdc:mga09592_34775_c1
553 nmdc:mga09592_910442_c1
554 nmdc:mga0qj67_115448_c1
555 nmdc:mga0qj67_12390_c1
556 nmdc:mga0qj67_178690_c1
557 nmdc:mga0qj67_203068_c1
558 nmdc:mga0qj67_734707_c1
559 nmdc:mga06r32_329189_c1
560 nmdc:mga06r32_742652_c1
561 nmdc:mga06r32_86809_c1
562 nmdc:mga08y16_10076_c1
563 nmdc:mga08y16_4439_c1
564 nmdc:mga08y16_5242_c1
565 nmdc:mga08y16_96564_c1
566 nmdc:mga0n895_108215_c1
567 nmdc:mga0n895_119371_c1
568 nmdc:mga0n895_237230_c1
569 nmdc:mga0n895_574_c1
570 nmdc:mga0n895_681814_c1
571 nmdc:mga0n895_7430_c1
572 nmdc:mga0rr50_149869_c1
573 nmdc:mga0rr50_33710_c1
574 nmdc:mga0a205_205866_c1
575 nmdc:mga0a205_27526_c1
576 nmdc:mga0a205_413813_c1
577 nmdc:mga0a205_58744_c1
578 nmdc:mga0a205_813_c1
579 Ga0501084_0927659
580 Ga0501082_0559630
581 Ga0530510_0537528
582 8007379612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05683

Fumerase_C

Fumarase C-terminus

3

195

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mso-assembly2.cif.gz_D crystal structure of mitochondrial fumarate hydratase from leishmania major in a complex with inhibitor thiomalate 0.8792 3 176
6upm-assembly1.cif.gz_A crystal structure of t467a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.879 2 174
6mso-assembly2.cif.gz_C crystal structure of mitochondrial fumarate hydratase from leishmania major in a complex with inhibitor thiomalate 0.8781 2 176
6uq9-assembly1.cif.gz_A crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.8768 2 176
6uq8-assembly1.cif.gz_A crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate and malonate 0.8759 2 176
ID Description Score Start End Superfamily
af_E9AH43_359_548_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8752 1 176 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8636 2 174 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8614 2 174 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.852 2 174 3.20.130.10
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8408 2 173 3.20.130.10
ID Description Score Start End GO Terms
AF-A0A354XTV9-F1-model_v4 TRZ/ATZ family protein 0.9756 85 183 GO:0016836
AF-A0A1V6EFH5-F1-model_v4 Fumarate hydratase class I, aerobic (EC 4.2.1.2) 0.9645 90 176 GO:0004333
GO:0008730
AF-A0A3B9I370-F1-model_v4 TRZ/ATZ family protein 0.9637 86 174 GO:0016836
AF-A0A7V3M4H0-F1-model_v4 TRZ/ATZ family protein 0.9633 84 181 GO:0016836
AF-A0A645GAS4-F1-model_v4 Fe-S hydro-lyase tartrate dehydratase beta-type catalytic domain-containing protein 0.9586 86 183 GO:0016836

Map