F390458

General Info

Members Datasets Scaffolds Average Seq Length
291 179 582 175

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0354124|Ga0373937_0354124_758_1345
Length 195
Sequence LNEQSKESIKGKGITTRRYEMNDNPYGNLPKVPSFEVTSTDVQNGEKMPLPQVSGIFGAGGEDLSPQLSWRGFPEATKSFVVTVYDPDAPTASGFWHWTVVDLPANITALPRGAGDASGSGLPKGAFQLRNDGGMARYIGAAPPSGHGKHRYYIVVHAVDVASLGLDKNATPAFLGFNLFSHTLGRGMIVPWYES

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
160 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
161 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
162 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
163 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
164 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
165 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
166 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
167 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
168 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
169 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
170 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
171 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
172 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
173 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
174 2922554459 Rhodococcus sp. 66b Isolate Unclassified
175 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
176 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
177 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
178 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
179 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.41
Metatranscriptomes 1.37
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 3.09
Rhizosphere 82.47
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0354124 3300036401 Bacteria 1391
2 Ga0070658_10273721 3300005327 Bacteria 1436
3 Ga0070658_10361926 3300005327 Bacteria 1242
4 Ga0070676_10096825 3300005328 Bacteria 1817
5 Ga0070683_100028365 3300005329 Bacteria 5058
6 Ga0070670_100078861 3300005331 Bacteria 2829
7 Ga0070670_100122420 3300005331 Bacteria 2244
8 Ga0068869_100022513 3300005334 Bacteria 4344
9 Ga0068869_100771484 3300005334 Bacteria 825
10 Ga0070682_100012367 3300005337 Bacteria 4893
11 Ga0068868_100005915 3300005338 Bacteria 8631
12 Ga0070660_100018227 3300005339 Bacteria 5126
13 Ga0070689_100071500 3300005340 Bacteria 2710
14 Ga0070661_100199664 3300005344 Bacteria 1528
15 Ga0070692_10363471 3300005345 Bacteria 903
16 Ga0070668_100019906 3300005347 Bacteria 5057
17 Ga0070668_100571589 3300005347 Bacteria 986
18 Ga0070675_100311112 3300005354 Bacteria 1390
19 Ga0070674_100044897 3300005356 Bacteria 3017
20 Ga0070673_100505276 3300005364 Bacteria 1094
21 Ga0070688_100193040 3300005365 Bacteria 1420
22 Ga0070659_100251532 3300005366 Bacteria 1465
23 Ga0070714_100006731 3300005435 Bacteria 8905
24 Ga0070713_100136211 3300005436 Bacteria 2170
25 Ga0070711_100038252 3300005439 Bacteria 3225
26 Ga0070708_100005652 3300005445 Bacteria 9912
27 Ga0070663_100050095 3300005455 Bacteria 2968
28 Ga0070663_100633648 3300005455 Bacteria 902
29 Ga0070678_100059375 3300005456 Bacteria 2811
30 Ga0070678_100079747 3300005456 Bacteria 2477
31 Ga0070678_100564599 3300005456 Bacteria 1012
32 Ga0070685_10058845 3300005466 Bacteria 2241
33 Ga0070706_100000139 3300005467 Bacteria 91602
34 Ga0070707_100001715 3300005468 Bacteria 21129
35 Ga0070707_100565088 3300005468 Bacteria 1099
36 Ga0068853_100386470 3300005539 Bacteria 1308
37 Ga0070672_100631220 3300005543 Bacteria 935
38 Ga0070686_100683955 3300005544 Bacteria 817
39 Ga0070693_100322173 3300005547 Bacteria 1049
40 Ga0070665_100051517 3300005548 Bacteria 4128
41 Ga0070665_100765471 3300005548 Bacteria 978
42 Ga0068855_100010910 3300005563 Bacteria 10968
43 Ga0068855_101554058 3300005563 Bacteria 678
44 Ga0068857_100012659 3300005577 Bacteria 7349
45 Ga0068856_100000037 3300005614 Bacteria 120033
46 Ga0068856_100125825 3300005614 Bacteria 2566
47 Ga0068856_101279730 3300005614 Bacteria 749
48 Ga0070702_100055361 3300005615 Bacteria 2287
49 Ga0068852_100024335 3300005616 Bacteria 4892
50 Ga0068852_100795696 3300005616 Bacteria 959
51 Ga0068859_100038042 3300005617 Bacteria 4829
52 Ga0068864_100630525 3300005618 Bacteria 1042
53 Ga0068861_100010692 3300005719 Bacteria 6376
54 Ga0068870_10417983 3300005840 Bacteria 877
55 Ga0068858_100111183 3300005842 Bacteria 2559
56 Ga0070717_10000167 3300006028 Bacteria 49627
57 Ga0075363_100124578 3300006048 Bacteria 1442
58 Ga0075364_10030604 3300006051 Bacteria 3456
59 Ga0075364_10171708 3300006051 Bacteria 1466
60 Ga0075370_10451578 3300006353 Bacteria 773
61 Ga0075429_100846172 3300006880 Bacteria 801
62 Ga0097620_100038040 3300006931 Bacteria 4829
63 Ga0105240_10312514 3300009093 Bacteria 1794
64 Ga0105240_10557191 3300009093 Bacteria 1267
65 Ga0111539_10074052 3300009094 Bacteria 4013
66 Ga0105245_10086972 3300009098 Bacteria 2868
67 Ga0105245_10300521 3300009098 Bacteria 1575
68 Ga0105247_10153525 3300009101 Bacteria 1519
69 Ga0105243_10299603 3300009148 Bacteria 1456
70 Ga0105241_10847688 3300009174 Bacteria 845
71 Ga0105237_10272009 3300009545 Bacteria 1697
72 Ga0105238_10428131 3300009551 Bacteria 1319
73 Ga0105238_10554556 3300009551 Bacteria 1154
74 Ga0105249_11065904 3300009553 Bacteria 878
75 Ga0105239_10008970 3300010375 Bacteria 11318
76 Ga0105239_10233296 3300010375 Bacteria 2065
77 Ga0105239_10552786 3300010375 Bacteria 1311
78 Ga0105246_10079776 3300011119 Bacteria 2328
79 Ga0105246_10195984 3300011119 Bacteria 1567
80 Ga0157371_10552450 3300013102 Bacteria 854
81 Ga0157369_10594299 3300013105 Bacteria 1143
82 Ga0163162_10726642 3300013306 Bacteria 1113
83 Ga0157375_10117639 3300013308 Bacteria 2763
84 Ga0157375_10247835 3300013308 Bacteria 1942
85 Ga0163163_10340942 3300014325 Bacteria 1554
86 Ga0157377_10158333 3300014745 Bacteria 1406
87 Ga0157377_10160761 3300014745 Bacteria 1396
88 Ga0157379_10117926 3300014968 Bacteria 2388
89 Ga0157379_10184755 3300014968 Bacteria 1883
90 Ga0157376_10521209 3300014969 Bacteria 1171
91 Ga0206350_11264007 3300020080 Bacteria 615
92 Ga0206354_11212919 3300020081 Bacteria 1095
93 Ga0213874_10008322 3300021377 Bacteria 2526
94 Ga0213876_10100031 3300021384 Bacteria 1537
95 Ga0213876_10104083 3300021384 Bacteria 1505
96 Ga0213876_10187753 3300021384 Bacteria 1099
97 Ga0213875_10000092 3300021388 Bacteria 104416
98 Ga0213875_10062502 3300021388 Bacteria 1741
99 Ga0224712_10165045 3300022467 Bacteria 990
100 Ga0224712_10551692 3300022467 Bacteria 560
101 Ga0207656_10057760 3300025321 Bacteria 1693
102 Ga0207688_10002478 3300025901 Bacteria 9930
103 Ga0207688_10018250 3300025901 Bacteria 3819
104 Ga0207680_10557311 3300025903 Bacteria 818
105 Ga0207645_10099283 3300025907 Bacteria 1877
106 Ga0207643_10018820 3300025908 Bacteria 3782
107 Ga0207643_10291768 3300025908 Bacteria 1013
108 Ga0207684_10000193 3300025910 Bacteria 96333
109 Ga0207654_10437044 3300025911 Bacteria 915
110 Ga0207654_10451943 3300025911 Bacteria 901
111 Ga0207695_10587419 3300025913 Bacteria 995
112 Ga0207671_10184848 3300025914 Bacteria 1623
113 Ga0207671_10690617 3300025914 Bacteria 812
114 Ga0207660_10443900 3300025917 Bacteria 1049
115 Ga0207662_10361346 3300025918 Bacteria 977
116 Ga0207657_10049950 3300025919 Bacteria 3641
117 Ga0207657_10171518 3300025919 Bacteria 1757
118 Ga0207649_10281440 3300025920 Bacteria 1209
119 Ga0207646_10000821 3300025922 Bacteria 40377
120 Ga0207650_10313699 3300025925 Bacteria 1283
121 Ga0207659_10058690 3300025926 Bacteria 2763
122 Ga0207687_10009322 3300025927 Bacteria 6420
123 Ga0207687_10604648 3300025927 Bacteria 924
124 Ga0207700_10347660 3300025928 Bacteria 1290
125 Ga0207690_10280706 3300025932 Bacteria 1297
126 Ga0207669_10113915 3300025937 Bacteria 1819
127 Ga0207711_10609096 3300025941 Bacteria 1019
128 Ga0207689_10031731 3300025942 Bacteria 4396
129 Ga0207689_10096645 3300025942 Bacteria 2426
130 Ga0207667_10026079 3300025949 Bacteria 6391
131 Ga0207667_11570423 3300025949 Bacteria 627
132 Ga0207668_10060475 3300025972 Bacteria 2659
133 Ga0207668_10506911 3300025972 Bacteria 1039
134 Ga0207640_10612793 3300025981 Bacteria 923
135 Ga0207640_11316316 3300025981 Bacteria 645
136 Ga0207658_10108406 3300025986 Bacteria 2191
137 Ga0207677_10378084 3300026023 Bacteria 1195
138 Ga0207703_10190460 3300026035 Bacteria 1816
139 Ga0207678_10003159 3300026067 Bacteria 14898
140 Ga0207678_10315085 3300026067 Bacteria 1345
141 Ga0207708_10168341 3300026075 Bacteria 1734
142 Ga0207708_10750147 3300026075 Bacteria 838
143 Ga0207702_10000001 3300026078 Bacteria 895738
144 Ga0207702_10140410 3300026078 Bacteria 2185
145 Ga0207648_10853628 3300026089 Bacteria 849
146 Ga0207674_10010744 3300026116 Bacteria 10336
147 Ga0207674_10264587 3300026116 Bacteria 1667
148 Ga0207675_100027175 3300026118 Bacteria 5329
149 Ga0207683_10113103 3300026121 Bacteria 2431
150 Ga0207683_10213717 3300026121 Bacteria 1756
151 Ga0207683_10429094 3300026121 Bacteria 1218
152 Ga0207698_10267806 3300026142 Bacteria 1573
153 Ga0207428_10225269 3300027907 Bacteria 1404
154 Ga0268266_10030076 3300028379 Bacteria 4614
155 Ga0268264_10283979 3300028381 Bacteria 1552
156 Ga0268264_10743823 3300028381 Bacteria 976
157 Ga0307511_10265347 3300030521 Bacteria 809
158 Ga0307513_10012598 3300031456 Bacteria 10425
159 Ga0307513_10528022 3300031456 Bacteria 894
160 Ga0373935_1009225 3300035692 Unclassified 618
161 Ga0436364_0527355 3300037853 Bacteria 148076
162 Ga0436364_0601973 3300037853 Bacteria 29284
163 Ga0436364_0694066 3300037853 Bacteria 10760
164 Ga0436364_1160432 3300037853 Bacteria 4079
165 Ga0436365_0671899 3300039437 Bacteria 5486
166 Ga0436365_1035026 3300039437 Bacteria 2246
167 Ga0436365_1398074 3300039437 Bacteria 12911
168 Ga0436365_1432653 3300039437 Bacteria 973
169 Ga0436365_1540900 3300039437 Bacteria 2513
170 Ga0436363_0168801 3300039450 Bacteria 3340
171 Ga0436363_0416647 3300039450 Bacteria 1269
172 Ga0436363_0560093 3300039450 Bacteria 2149
173 Ga0436363_1551125 3300039450 Bacteria 4120
174 Ga0436362_0318026 3300039453 Bacteria 6158
175 Ga0436362_0539942 3300039453 Bacteria 1233
176 Ga0451806_690620 3300041462 Bacteria 1010
177 Ga0466965_0111651 3300044683 Bacteria 1405
178 Ga0466966_0040811 3300044684 Bacteria 2985
179 Ga0466966_0052066 3300044684 Bacteria 2602
180 Ga0466966_0211945 3300044684 Bacteria 1170
181 Ga0466966_0592838 3300044684 Bacteria 667
182 Ga0466961_0016585 3300044693 Bacteria 4736
183 Ga0466961_0030705 3300044693 Bacteria 3452
184 Ga0466961_0034766 3300044693 Bacteria 3235
185 Ga0466961_0041054 3300044693 Bacteria 2966
186 Ga0466961_0044756 3300044693 Bacteria 2832
187 Ga0466961_0088842 3300044693 Bacteria 1952
188 Ga0466961_0182503 3300044693 Bacteria 1302
189 Ga0466961_0201134 3300044693 Bacteria 1232
190 Ga0466961_0412721 3300044693 Bacteria 819
191 Ga0466963_0006633 3300044694 Bacteria 6870
192 Ga0466963_0015912 3300044694 Bacteria 4670
193 Ga0466963_0038187 3300044694 Bacteria 3139
194 Ga0466963_0041414 3300044694 Bacteria 3021
195 Ga0466963_0090221 3300044694 Bacteria 2086
196 Ga0466963_0105705 3300044694 Bacteria 1930
197 Ga0466963_0108142 3300044694 Bacteria 1907
198 Ga0466963_0133145 3300044694 Bacteria 1719
199 Ga0466963_0217232 3300044694 Bacteria 1338
200 Ga0466963_0258570 3300044694 Bacteria 1222
201 Ga0466963_0813798 3300044694 Bacteria 659
202 Ga0466964_0013945 3300044706 Bacteria 3052
203 Ga0466964_0104497 3300044706 Bacteria 1254
204 Ga0466971_0105028 3300044719 Bacteria 1300
205 Ga0466971_0216223 3300044719 Bacteria 907
206 Ga0466968_0317220 3300044735 Bacteria 752
207 Ga0466970_0283994 3300044765 Bacteria 931
208 Ga0466970_0639492 3300044765 Bacteria 618
209 Ga0466957_0225587 3300044842 Bacteria 1238
210 Ga0466957_0314071 3300044842 Bacteria 1056
211 Ga0466960_0011688 3300044901 Bacteria 3683
212 Ga0466960_0287415 3300044901 Bacteria 923
213 Ga0466960_0460290 3300044901 Bacteria 740
214 Ga0466959_0029969 3300045049 Bacteria 4030
215 Ga0466959_0056605 3300045049 Bacteria 2861
216 Ga0466959_0057534 3300045049 Bacteria 2834
217 Ga0466959_0063185 3300045049 Bacteria 2689
218 Ga0466959_0108013 3300045049 Bacteria 1988
219 Ga0466959_0150947 3300045049 Bacteria 1638
220 Ga0466959_0424202 3300045049 Bacteria 903
221 Ga0466958_0021265 3300045836 Bacteria 3789
222 Ga0466958_0042939 3300045836 Bacteria 2722
223 Ga0466958_0101017 3300045836 Bacteria 1793
224 Ga0466958_0153872 3300045836 Bacteria 1451
225 Ga0466958_0322178 3300045836 Bacteria 993
226 Ga0466958_0484426 3300045836 Bacteria 802
227 Ga0466967_0002471 3300045976 Bacteria 11524
228 Ga0466967_0003013 3300045976 Bacteria 10805
229 Ga0466967_0003815 3300045976 Bacteria 9968
230 Ga0466967_0005189 3300045976 Bacteria 8968
231 Ga0466967_0020162 3300045976 Bacteria 5380
232 Ga0466967_0031326 3300045976 Bacteria 4476
233 Ga0466967_0114777 3300045976 Bacteria 2479
234 Ga0466967_0210265 3300045976 Bacteria 1845
235 Ga0466967_0458496 3300045976 Bacteria 1246
236 Ga0466967_0766286 3300045976 Bacteria 957
237 Ga0466967_0821707 3300045976 Bacteria 923
238 Ga0466967_1538085 3300045976 Bacteria 663
239 Ga0495639_0183282 3300046475 Bacteria 1020
240 Ga0495665_0034298 3300046531 Bacteria 2713
241 Ga0495668_0003546 3300046616 Bacteria 11603
242 Ga0495588_0028704 3300046674 Bacteria 2787
243 Ga0495581_0029448 3300047315 Bacteria 3182
244 Ga0495676_0349006 3300047321 Bacteria 989
245 Ga0496102_0643033 3300048905 Bacteria 984
246 Ga0496104_1282912 3300048907 Bacteria 636
247 Ga0496107_0399135 3300048910 Bacteria 1023
248 Ga0496108_0093391 3300048911 Bacteria 2559
249 Ga0496108_0203109 3300048911 Bacteria 1720
250 Ga0496109_0138288 3300048912 Bacteria 2277
251 Ga0496111_0679860 3300048914 Bacteria 750
252 Ga0496112_0665630 3300048915 Unclassified 970
253 Ga0496117_0319151 3300048920 Bacteria 815
254 Ga0496125_0096252 3300048928 Bacteria 2198
255 Ga0501036_0795632 3300049572 Bacteria 779
256 Ga0501043_0335066 3300049579 Bacteria 1152
257 Ga0501047_0005618 3300049581 Bacteria 11810
258 Ga0501047_0459384 3300049581 Bacteria 1102
259 Ga0501069_0031543 3300049585 Bacteria 2915
260 Ga0501070_0211500 3300049586 Bacteria 1592
261 nmdc:mga00v17_13677_c1 3300050491 Bacteria 4511
262 nmdc:mga07m45_359192_c1 3300050496 Bacteria 846
263 nmdc:mga08y16_73450_c1 3300050511 Bacteria 3564
264 Ga0495619_0398296 3300053085 Bacteria 951
265 Ga0466962_0038719 3300061719 Bacteria 2283
266 Ga0466962_0041989 3300061719 Bacteria 2188
267 Ga0466962_0077632 3300061719 Bacteria 1588
268 Ga0466962_0211007 3300061719 Bacteria 950
269 Ga0466962_0366053 3300061719 Bacteria 719
270 Ga0466962_0395149 3300061719 Bacteria 692
271 2558908074 2558860112 Bacteria 9931328
272 2566995497 2565956761 Bacteria 6601618
273 2738890373 2738541308 Bacteria 7020677
274 2739361801 2738543034 Bacteria 6084756
275 2753034910 2751185725 Bacteria 5740550
276 2753323427 2751185792 Bacteria 5739090
277 2870785559 2870782633 Bacteria 9624083
278 2904539590 2904535858 Bacteria 6308016
279 2904769713 2904765812 Bacteria 5369154
280 2904771427 2904770941 Bacteria 5580202
281 2905930407 2905926851 Bacteria 4423176
282 2908816238 2908811453 Bacteria 5478616
283 2915773955 2915768154 Bacteria 8424322
284 2919423078 2919420072 Bacteria 5390363
285 2919435686 2919432681 Bacteria 5390474
286 2922557625 2922554459 Bacteria 6683962
287 2956940129 2956939328 Bacteria 3474458
288 2966924680 2966924647 Bacteria 3268643
289 2974317615 2974315732 Bacteria 4602776
290 2984525826 2984523437 Bacteria 4508481
291 3001121549 3001119090 Bacteria 3449530
292 Ga0373937_0354124
293 Ga0070658_10273721
294 Ga0070658_10361926
295 Ga0070676_10096825
296 Ga0070683_100028365
297 Ga0070670_100078861
298 Ga0070670_100122420
299 Ga0068869_100022513
300 Ga0068869_100771484
301 Ga0070682_100012367
302 Ga0068868_100005915
303 Ga0070660_100018227
304 Ga0070689_100071500
305 Ga0070661_100199664
306 Ga0070692_10363471
307 Ga0070668_100019906
308 Ga0070668_100571589
309 Ga0070675_100311112
310 Ga0070674_100044897
311 Ga0070673_100505276
312 Ga0070688_100193040
313 Ga0070659_100251532
314 Ga0070714_100006731
315 Ga0070713_100136211
316 Ga0070711_100038252
317 Ga0070708_100005652
318 Ga0070663_100050095
319 Ga0070663_100633648
320 Ga0070678_100059375
321 Ga0070678_100079747
322 Ga0070678_100564599
323 Ga0070685_10058845
324 Ga0070706_100000139
325 Ga0070707_100001715
326 Ga0070707_100565088
327 Ga0068853_100386470
328 Ga0070672_100631220
329 Ga0070686_100683955
330 Ga0070693_100322173
331 Ga0070665_100051517
332 Ga0070665_100765471
333 Ga0068855_100010910
334 Ga0068855_101554058
335 Ga0068857_100012659
336 Ga0068856_100000037
337 Ga0068856_100125825
338 Ga0068856_101279730
339 Ga0070702_100055361
340 Ga0068852_100024335
341 Ga0068852_100795696
342 Ga0068859_100038042
343 Ga0068864_100630525
344 Ga0068861_100010692
345 Ga0068870_10417983
346 Ga0068858_100111183
347 Ga0070717_10000167
348 Ga0075363_100124578
349 Ga0075364_10030604
350 Ga0075364_10171708
351 Ga0075370_10451578
352 Ga0075429_100846172
353 Ga0097620_100038040
354 Ga0105240_10312514
355 Ga0105240_10557191
356 Ga0111539_10074052
357 Ga0105245_10086972
358 Ga0105245_10300521
359 Ga0105247_10153525
360 Ga0105243_10299603
361 Ga0105241_10847688
362 Ga0105237_10272009
363 Ga0105238_10428131
364 Ga0105238_10554556
365 Ga0105249_11065904
366 Ga0105239_10008970
367 Ga0105239_10233296
368 Ga0105239_10552786
369 Ga0105246_10079776
370 Ga0105246_10195984
371 Ga0157371_10552450
372 Ga0157369_10594299
373 Ga0163162_10726642
374 Ga0157375_10117639
375 Ga0157375_10247835
376 Ga0163163_10340942
377 Ga0157377_10158333
378 Ga0157377_10160761
379 Ga0157379_10117926
380 Ga0157379_10184755
381 Ga0157376_10521209
382 Ga0206350_11264007
383 Ga0206354_11212919
384 Ga0213874_10008322
385 Ga0213876_10100031
386 Ga0213876_10104083
387 Ga0213876_10187753
388 Ga0213875_10000092
389 Ga0213875_10062502
390 Ga0224712_10165045
391 Ga0224712_10551692
392 Ga0207656_10057760
393 Ga0207688_10002478
394 Ga0207688_10018250
395 Ga0207680_10557311
396 Ga0207645_10099283
397 Ga0207643_10018820
398 Ga0207643_10291768
399 Ga0207684_10000193
400 Ga0207654_10437044
401 Ga0207654_10451943
402 Ga0207695_10587419
403 Ga0207671_10184848
404 Ga0207671_10690617
405 Ga0207660_10443900
406 Ga0207662_10361346
407 Ga0207657_10049950
408 Ga0207657_10171518
409 Ga0207649_10281440
410 Ga0207646_10000821
411 Ga0207650_10313699
412 Ga0207659_10058690
413 Ga0207687_10009322
414 Ga0207687_10604648
415 Ga0207700_10347660
416 Ga0207690_10280706
417 Ga0207669_10113915
418 Ga0207711_10609096
419 Ga0207689_10031731
420 Ga0207689_10096645
421 Ga0207667_10026079
422 Ga0207667_11570423
423 Ga0207668_10060475
424 Ga0207668_10506911
425 Ga0207640_10612793
426 Ga0207640_11316316
427 Ga0207658_10108406
428 Ga0207677_10378084
429 Ga0207703_10190460
430 Ga0207678_10003159
431 Ga0207678_10315085
432 Ga0207708_10168341
433 Ga0207708_10750147
434 Ga0207702_10000001
435 Ga0207702_10140410
436 Ga0207648_10853628
437 Ga0207674_10010744
438 Ga0207674_10264587
439 Ga0207675_100027175
440 Ga0207683_10113103
441 Ga0207683_10213717
442 Ga0207683_10429094
443 Ga0207698_10267806
444 Ga0207428_10225269
445 Ga0268266_10030076
446 Ga0268264_10283979
447 Ga0268264_10743823
448 Ga0307511_10265347
449 Ga0307513_10012598
450 Ga0307513_10528022
451 Ga0373935_1009225
452 Ga0436364_0527355
453 Ga0436364_0601973
454 Ga0436364_0694066
455 Ga0436364_1160432
456 Ga0436365_0671899
457 Ga0436365_1035026
458 Ga0436365_1398074
459 Ga0436365_1432653
460 Ga0436365_1540900
461 Ga0436363_0168801
462 Ga0436363_0416647
463 Ga0436363_0560093
464 Ga0436363_1551125
465 Ga0436362_0318026
466 Ga0436362_0539942
467 Ga0451806_690620
468 Ga0466965_0111651
469 Ga0466966_0040811
470 Ga0466966_0052066
471 Ga0466966_0211945
472 Ga0466966_0592838
473 Ga0466961_0016585
474 Ga0466961_0030705
475 Ga0466961_0034766
476 Ga0466961_0041054
477 Ga0466961_0044756
478 Ga0466961_0088842
479 Ga0466961_0182503
480 Ga0466961_0201134
481 Ga0466961_0412721
482 Ga0466963_0006633
483 Ga0466963_0015912
484 Ga0466963_0038187
485 Ga0466963_0041414
486 Ga0466963_0090221
487 Ga0466963_0105705
488 Ga0466963_0108142
489 Ga0466963_0133145
490 Ga0466963_0217232
491 Ga0466963_0258570
492 Ga0466963_0813798
493 Ga0466964_0013945
494 Ga0466964_0104497
495 Ga0466971_0105028
496 Ga0466971_0216223
497 Ga0466968_0317220
498 Ga0466970_0283994
499 Ga0466970_0639492
500 Ga0466957_0225587
501 Ga0466957_0314071
502 Ga0466960_0011688
503 Ga0466960_0287415
504 Ga0466960_0460290
505 Ga0466959_0029969
506 Ga0466959_0056605
507 Ga0466959_0057534
508 Ga0466959_0063185
509 Ga0466959_0108013
510 Ga0466959_0150947
511 Ga0466959_0424202
512 Ga0466958_0021265
513 Ga0466958_0042939
514 Ga0466958_0101017
515 Ga0466958_0153872
516 Ga0466958_0322178
517 Ga0466958_0484426
518 Ga0466967_0002471
519 Ga0466967_0003013
520 Ga0466967_0003815
521 Ga0466967_0005189
522 Ga0466967_0020162
523 Ga0466967_0031326
524 Ga0466967_0114777
525 Ga0466967_0210265
526 Ga0466967_0458496
527 Ga0466967_0766286
528 Ga0466967_0821707
529 Ga0466967_1538085
530 Ga0495639_0183282
531 Ga0495665_0034298
532 Ga0495668_0003546
533 Ga0495588_0028704
534 Ga0495581_0029448
535 Ga0495676_0349006
536 Ga0496102_0643033
537 Ga0496104_1282912
538 Ga0496107_0399135
539 Ga0496108_0093391
540 Ga0496108_0203109
541 Ga0496109_0138288
542 Ga0496111_0679860
543 Ga0496112_0665630
544 Ga0496117_0319151
545 Ga0496125_0096252
546 Ga0501036_0795632
547 Ga0501043_0335066
548 Ga0501047_0005618
549 Ga0501047_0459384
550 Ga0501069_0031543
551 Ga0501070_0211500
552 nmdc:mga00v17_13677_c1
553 nmdc:mga07m45_359192_c1
554 nmdc:mga08y16_73450_c1
555 Ga0495619_0398296
556 Ga0466962_0038719
557 Ga0466962_0041989
558 Ga0466962_0077632
559 Ga0466962_0211007
560 Ga0466962_0366053
561 Ga0466962_0395149
562 2558908074
563 2566995497
564 2738890373
565 2739361801
566 2753034910
567 2753323427
568 2870785559
569 2904539590
570 2904769713
571 2904771427
572 2905930407
573 2908816238
574 2915773955
575 2919423078
576 2919435686
577 2922557625
578 2956940129
579 2966924680
580 2974317615
581 2984525826
582 3001121549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

47

193

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4beg-assembly1.cif.gz_A structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate 0.9809 4 175
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.9641 13 174
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9629 14 175
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.961 14 174
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.957 14 175
ID Description Score Start End Superfamily
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9828 4 175 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.965 16 171 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9643 13 175 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9529 13 175 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9497 4 175 3.90.280.10
ID Description Score Start End GO Terms
AF-F1YGM6-F1-model_v4 PEBP family protein 0.9936 5 175
AF-A0A4Q3BVP3-F1-model_v4 deleted 0.9916 16 175
AF-A0A542DKP0-F1-model_v4 PBP family phospholipid-binding protein 0.9895 4 175
AF-A0A543NKB5-F1-model_v4 PBP family phospholipid-binding protein 0.9889 5 175
AF-M2PLJ4-F1-model_v4 Phospholipid-binding protein 0.9883 4 177

Map