F390406

General Info

Members Datasets Scaffolds Average Seq Length
291 210 583 162

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1007565|Ga0265319_10075653
Length 181
Sequence MDRAIRFALRGGVRLTRGMSTTIRPAQPGDVALILDFIRGLAAYEKLSHEVEADEAKLTRTLFPATGHAPAAHCVLADCAGVPAGFAIYFFNYSTFLARPGLYLEDLFVKPEFRGRGLGKALLLHLARLANERGCGRMEWSVLDWNQPAIDFYESLGARRMREWQICRLAGPALAQYAKSV

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0.34
Rhizoplane 1.72
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 7.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1007565 3300028563 Bacteria 4865
2 JGI24751J29686_10002224 3300002459 Bacteria 3930
3 rootL2_10031817 3300003322 Bacteria 10462
4 rootH1_10037357 3300003316 Bacteria 2175
5 rootH1_10037357 3300003323 Bacteria 1596
6 Ga0070683_100260434 3300005329 Bacteria 1650
7 Ga0070683_100473883 3300005329 Bacteria 1195
8 Ga0070690_100115982 3300005330 Bacteria 1792
9 Ga0070670_100757314 3300005331 Unclassified 875
10 Ga0070677_10019134 3300005333 Bacteria 2476
11 Ga0068869_100002365 3300005334 Bacteria 11352
12 Ga0070666_10428346 3300005335 Bacteria 954
13 Ga0070680_100470224 3300005336 Bacteria 1074
14 Ga0068868_100539808 3300005338 Bacteria 1026
15 Ga0070660_100047195 3300005339 Bacteria 3304
16 Ga0070689_100542754 3300005340 Bacteria 1001
17 Ga0070689_101756370 3300005340 Bacteria 565
18 Ga0070687_100056537 3300005343 Bacteria 2053
19 Ga0070669_100511859 3300005353 Bacteria 997
20 Ga0070669_100612822 3300005353 Bacteria 913
21 Ga0070675_100008692 3300005354 Bacteria 7887
22 Ga0070671_100019459 3300005355 Bacteria 5526
23 Ga0070671_100892764 3300005355 Bacteria 776
24 Ga0070674_100074290 3300005356 Bacteria 2412
25 Ga0070673_100003162 3300005364 Bacteria 10203
26 Ga0070673_100007893 3300005364 Bacteria 7053
27 Ga0070673_100617734 3300005364 Bacteria 990
28 Ga0070659_100050756 3300005366 Bacteria 3261
29 Ga0070709_10758388 3300005434 Bacteria 759
30 Ga0070701_10042503 3300005438 Bacteria 2320
31 Ga0070711_100310414 3300005439 Bacteria 1257
32 Ga0070700_100018777 3300005441 Bacteria 3980
33 Ga0070694_100252227 3300005444 Bacteria 1335
34 Ga0070678_100015273 3300005456 Bacteria 4876
35 Ga0070678_100303858 3300005456 Bacteria 1357
36 Ga0070681_10031135 3300005458 Bacteria 5355
37 Ga0070681_10098045 3300005458 Bacteria 2877
38 Ga0068867_100001511 3300005459 Bacteria 16121
39 Ga0068867_100403551 3300005459 Bacteria 1153
40 Ga0070707_100109558 3300005468 Bacteria 2678
41 Ga0070679_100064884 3300005530 Bacteria 3640
42 Ga0070679_101100383 3300005530 Unclassified 739
43 Ga0070684_100008128 3300005535 Bacteria 8189
44 Ga0070672_100228485 3300005543 Bacteria 1563
45 Ga0070672_100292689 3300005543 Bacteria 1379
46 Ga0070686_100012596 3300005544 Bacteria 4821
47 Ga0070695_100023022 3300005545 Bacteria 3825
48 Ga0070693_100021618 3300005547 Bacteria 3409
49 Ga0068855_100337998 3300005563 Bacteria 1661
50 Ga0068855_102023764 3300005563 Bacteria 581
51 Ga0068857_100526534 3300005577 Bacteria 1111
52 Ga0068857_100700415 3300005577 Bacteria 962
53 Ga0068856_100925278 3300005614 Bacteria 891
54 Ga0070702_100095334 3300005615 Bacteria 1813
55 Ga0068859_101430916 3300005617 Bacteria 763
56 Ga0068864_100648441 3300005618 Bacteria 1028
57 Ga0068866_10021132 3300005718 Bacteria 2994
58 Ga0068863_100173118 3300005841 Bacteria 2071
59 Ga0068863_100786844 3300005841 Unclassified 948
60 Ga0068858_100020005 3300005842 Bacteria 6261
61 Ga0068858_100233122 3300005842 Bacteria 1745
62 Ga0068860_100095734 3300005843 Bacteria 2830
63 Ga0068860_100215976 3300005843 Bacteria 1861
64 Ga0070715_10094543 3300006163 Unclassified 1382
65 Ga0097621_101222923 3300006237 Bacteria 708
66 Ga0068871_100857947 3300006358 Bacteria 840
67 Ga0075428_100134082 3300006844 Bacteria 2693
68 Ga0075428_100904231 3300006844 Bacteria 936
69 Ga0075433_10324895 3300006852 Bacteria 1361
70 Ga0075434_100016557 3300006871 Bacteria 7089
71 Ga0068865_100144500 3300006881 Bacteria 1797
72 Ga0097620_101430789 3300006931 Bacteria 763
73 Ga0105240_10136986 3300009093 Bacteria 2931
74 Ga0105245_10811967 3300009098 Bacteria 974
75 Ga0105245_10981161 3300009098 Bacteria 889
76 Ga0105242_10004870 3300009176 Bacteria 10393
77 Ga0105248_11130484 3300009177 Bacteria 885
78 Ga0105238_10297327 3300009551 Bacteria 1598
79 Ga0105238_10678517 3300009551 Bacteria 1042
80 Ga0105239_11054346 3300010375 Bacteria 935
81 Ga0105246_10199477 3300011119 Bacteria 1554
82 Ga0105246_10558064 3300011119 Bacteria 983
83 Ga0157369_10244048 3300013105 Bacteria 1876
84 Ga0157378_10316207 3300013297 Unclassified 1516
85 Ga0157378_10761298 3300013297 Bacteria 992
86 Ga0163162_10716330 3300013306 Bacteria 1121
87 Ga0163163_10013011 3300014325 Bacteria 7600
88 Ga0163163_10035212 3300014325 Bacteria 4855
89 Ga0163163_10185477 3300014325 Bacteria 2128
90 Ga0157380_10059116 3300014326 Bacteria 3058
91 Ga0157377_10025724 3300014745 Bacteria 3142
92 Ga0157379_10459871 3300014968 Bacteria 1176
93 Ga0157379_10623908 3300014968 Bacteria 1008
94 Ga0157376_10238741 3300014969 Bacteria 1692
95 Ga0209233_1010830 3300025261 Bacteria 2710
96 Ga0207682_10020853 3300025893 Bacteria 2575
97 Ga0207642_10076400 3300025899 Bacteria 1612
98 Ga0207680_10450352 3300025903 Bacteria 914
99 Ga0207685_10076229 3300025905 Unclassified 1374
100 Ga0207643_10123540 3300025908 Bacteria 1535
101 Ga0207705_10057308 3300025909 Bacteria 2810
102 Ga0207707_10220058 3300025912 Bacteria 1653
103 Ga0207695_10149619 3300025913 Bacteria 2275
104 Ga0207663_10290025 3300025916 Bacteria 1219
105 Ga0207663_10795928 3300025916 Bacteria 753
106 Ga0207660_10219694 3300025917 Bacteria 1491
107 Ga0207657_10458695 3300025919 Bacteria 1000
108 Ga0207649_10284650 3300025920 Bacteria 1203
109 Ga0207652_10048309 3300025921 Bacteria 3637
110 Ga0207681_10071970 3300025923 Bacteria 2413
111 Ga0207694_10268320 3300025924 Bacteria 1399
112 Ga0207694_10370950 3300025924 Bacteria 1187
113 Ga0207694_10866614 3300025924 Bacteria 763
114 Ga0207659_10023157 3300025926 Bacteria 4142
115 Ga0207659_10338872 3300025926 Bacteria 1245
116 Ga0207700_10733025 3300025928 Unclassified 883
117 Ga0207644_10033269 3300025931 Bacteria 3601
118 Ga0207690_10095499 3300025932 Bacteria 2112
119 Ga0207706_10202309 3300025933 Bacteria 1742
120 Ga0207686_10146298 3300025934 Bacteria 1639
121 Ga0207709_10019551 3300025935 Bacteria 3811
122 Ga0207670_10211731 3300025936 Bacteria 1479
123 Ga0207670_10695673 3300025936 Bacteria 841
124 Ga0207669_10013580 3300025937 Bacteria 4051
125 Ga0207665_10013467 3300025939 Bacteria 5378
126 Ga0207691_10409199 3300025940 Bacteria 1156
127 Ga0207691_10507205 3300025940 Bacteria 1024
128 Ga0207711_10758144 3300025941 Bacteria 905
129 Ga0207711_10785278 3300025941 Unclassified 887
130 Ga0207689_10004252 3300025942 Bacteria 13021
131 Ga0207689_10260311 3300025942 Bacteria 1435
132 Ga0207661_10002220 3300025944 Bacteria 13401
133 Ga0207661_10584439 3300025944 Bacteria 1024
134 Ga0207651_10076069 3300025960 Bacteria 2398
135 Ga0207640_10042385 3300025981 Bacteria 2902
136 Ga0207677_10054974 3300026023 Bacteria 2720
137 Ga0207677_10662438 3300026023 Bacteria 922
138 Ga0207703_10024883 3300026035 Bacteria 4711
139 Ga0207703_10105023 3300026035 Bacteria 2401
140 Ga0207708_10020770 3300026075 Bacteria 4953
141 Ga0207702_10332114 3300026078 Bacteria 1450
142 Ga0207641_10753582 3300026088 Bacteria 961
143 Ga0207641_10773148 3300026088 Unclassified 949
144 Ga0207641_11014096 3300026088 Bacteria 827
145 Ga0207648_10000463 3300026089 Bacteria 45186
146 Ga0207676_10057934 3300026095 Bacteria 3053
147 Ga0207674_10097885 3300026116 Bacteria 2917
148 Ga0207675_100079412 3300026118 Bacteria 3075
149 Ga0207675_100974679 3300026118 Bacteria 866
150 Ga0207683_10008732 3300026121 Bacteria 8652
151 Ga0207683_10407721 3300026121 Bacteria 1251
152 Ga0207698_11713382 3300026142 Bacteria 644
153 Ga0268264_10075360 3300028381 Bacteria 2869
154 Ga0268264_10174097 3300028381 Bacteria 1949
155 Ga0265319_1004480 3300028563 Bacteria 6909
156 Ga0265319_1033522 3300028563 Bacteria 1773
157 Ga0265318_10009305 3300028577 Bacteria 4326
158 Ga0265318_10022816 3300028577 Unclassified 2499
159 Ga0265318_10205180 3300028577 Bacteria 720
160 Ga0265323_10000416 3300028653 Bacteria 24443
161 Ga0265336_10004625 3300028666 Bacteria 5166
162 Ga0265336_10047915 3300028666 Bacteria 1296
163 Ga0307515_10490272 3300028794 Unclassified 840
164 Ga0265338_10096356 3300028800 Unclassified 2427
165 Ga0265324_10005070 3300029957 Bacteria 5766
166 Ga0265324_10190884 3300029957 Bacteria 696
167 Ga0265324_10197557 3300029957 Bacteria 683
168 Ga0265332_10193967 3300031238 Bacteria 845
169 Ga0265332_10251236 3300031238 Unclassified 731
170 Ga0265328_10052616 3300031239 Bacteria 1494
171 Ga0265328_10084924 3300031239 Bacteria 1168
172 Ga0265328_10099358 3300031239 Bacteria 1077
173 Ga0265328_10106045 3300031239 Bacteria 1043
174 Ga0265320_10010461 3300031240 Bacteria 5527
175 Ga0265320_10011454 3300031240 Bacteria 5216
176 Ga0265329_10241054 3300031242 Bacteria 601
177 Ga0265339_10032392 3300031249 Bacteria 2948
178 Ga0265339_10274894 3300031249 Bacteria 809
179 Ga0265331_10007072 3300031250 Bacteria 6544
180 Ga0265327_10000417 3300031251 Bacteria 77684
181 Ga0265327_10033333 3300031251 Unclassified 2871
182 Ga0265327_10048586 3300031251 Bacteria 2231
183 Ga0265327_10354600 3300031251 Bacteria 640
184 Ga0265316_10006304 3300031344 Bacteria 11357
185 Ga0265316_10013180 3300031344 Bacteria 7362
186 Ga0265316_10053959 3300031344 Unclassified 3147
187 Ga0265316_10466844 3300031344 Bacteria 904
188 Ga0307408_101178415 3300031548 Unclassified 714
189 Ga0265313_10003361 3300031595 Bacteria 13037
190 Ga0265314_10028871 3300031711 Bacteria 4128
191 Ga0265314_10088453 3300031711 Bacteria 2023
192 Ga0265314_10096302 3300031711 Bacteria 1914
193 Ga0265314_10355168 3300031711 Bacteria 805
194 Ga0265342_10013542 3300031712 Bacteria 5464
195 Ga0265342_10049822 3300031712 Unclassified 2504
196 Ga0265342_10054797 3300031712 Bacteria 2368
197 Ga0307406_10236323 3300031901 Bacteria 1368
198 Ga0373926_0012416 3300035083 Bacteria 2879
199 Ga0373944_0141017 3300035089 Bacteria 844
200 Ga0373923_0019644 3300035111 Bacteria 2618
201 Ga0373945_0011141 3300035116 Bacteria 2968
202 Ga0373953_0448011 3300035117 Bacteria 570
203 Ga0373954_0008905 3300035118 Bacteria 4416
204 Ga0373956_0037017 3300035119 Bacteria 2155
205 Ga0373957_0022163 3300035120 Bacteria 2261
206 Ga0373943_0006310 3300035170 Bacteria 5322
207 Ga0373946_0028575 3300035171 Bacteria 2213
208 Ga0373946_0081437 3300035171 Bacteria 1418
209 Ga0373924_0004761 3300035410 Bacteria 4763
210 Ga0373935_0059381 3300035692 Bacteria 2444
211 Ga0373935_0109848 3300035692 Bacteria 1829
212 Ga0373927_0103086 3300035695 Bacteria 1856
213 Ga0373927_0124399 3300035695 Bacteria 1683
214 Ga0373933_0032897 3300035724 Bacteria 3014
215 Ga0373947_0025743 3300035725 Bacteria 3432
216 Ga0373947_0192145 3300035725 Bacteria 1332
217 Ga0373937_0024376 3300036401 Bacteria 5456
218 Ga0373937_0305701 3300036401 Bacteria 1504
219 Ga0373925_0008127 3300037068 Bacteria 7640
220 Ga0373925_0025316 3300037068 Bacteria 4335
221 Ga0373925_0199438 3300037068 Bacteria 1591
222 Ga0395905_0050431 3300037471 Unclassified 3899
223 Ga0436365_1151521 3300039437 Bacteria 2271
224 Ga0451807_2593518 3300041486 Bacteria 816
225 Ga0439441_010213 3300042001 Bacteria 1570
226 Ga0450914_016884 3300042118 Bacteria 778
227 Ga0451577_0284047 3300042876 Bacteria 1499
228 Ga0451577_0512444 3300042876 Bacteria 1089
229 Ga0451577_0572943 3300042876 Bacteria 1025
230 Ga0466966_0034557 3300044684 Bacteria 3268
231 Ga0466961_0025129 3300044693 Unclassified 3833
232 Ga0466963_0071267 3300044694 Bacteria 2339
233 Ga0453684_0014028 3300044712 Bacteria 12896
234 Ga0466968_0069245 3300044735 Unclassified 1533
235 Ga0466957_0122208 3300044842 Bacteria 1661
236 Ga0451576_0045801 3300045051 Bacteria 4605
237 Ga0451576_0509391 3300045051 Bacteria 1264
238 Ga0451576_0916177 3300045051 Unclassified 919
239 Ga0495580_0014157 3300046472 Bacteria 6060
240 Ga0495582_0010213 3300046473 Bacteria 5171
241 Ga0495639_0012054 3300046475 Bacteria 3727
242 Ga0495664_0045546 3300046477 Bacteria 2601
243 Ga0495594_0198990 3300046499 Bacteria 1142
244 Ga0495608_0114167 3300046511 Bacteria 1735
245 Ga0495618_0020165 3300046514 Bacteria 4104
246 Ga0495628_0027207 3300046516 Bacteria 4656
247 Ga0495666_0070281 3300046526 Bacteria 1665
248 Ga0495652_0203897 3300046529 Bacteria 1499
249 Ga0495665_0032194 3300046531 Bacteria 2804
250 Ga0495640_0488263 3300046533 Bacteria 750
251 Ga0495635_0166189 3300046663 Bacteria 1501
252 Ga0495646_0030846 3300046680 Bacteria 3345
253 Ga0495658_0092947 3300046683 Bacteria 1789
254 Ga0495613_0072027 3300046689 Bacteria 2519
255 Ga0495624_0013481 3300046690 Bacteria 5572
256 Ga0495581_0022831 3300047315 Bacteria 3624
257 Ga0495581_0200048 3300047315 Bacteria 1169
258 Ga0495636_0389646 3300047318 Bacteria 662
259 Ga0495674_0079882 3300047319 Bacteria 2807
260 Ga0495676_0339990 3300047321 Bacteria 1005
261 Ga0495684_0353489 3300047471 Bacteria 1042
262 Ga0495686_0152121 3300047472 Bacteria 1358
263 Ga0495614_0446365 3300048089 Bacteria 612
264 Ga0496104_0111899 3300048907 Unclassified 2618
265 Ga0496105_0654338 3300048908 Unclassified 810
266 Ga0496112_0051008 3300048915 Bacteria 4058
267 Ga0496113_0324784 3300048916 Bacteria 1234
268 Ga0496126_0007204 3300048929 Bacteria 12234
269 Ga0496126_0026387 3300048929 Bacteria 5570
270 Ga0496126_0034270 3300048929 Bacteria 4769
271 Ga0496126_0255325 3300048929 Bacteria 1459
272 Ga0501034_0008090 3300049571 Bacteria 11154
273 Ga0501040_0473295 3300049576 Bacteria 902
274 Ga0501046_0021243 3300049580 Bacteria 5359
275 Ga0501047_0016298 3300049581 Bacteria 7089
276 Ga0501047_0187121 3300049581 Bacteria 1935
277 Ga0501071_0161649 3300049587 Bacteria 1674
278 Ga0501072_0556222 3300049588 Bacteria 906
279 Ga0501075_1027414 3300049591 Bacteria 626
280 Ga0501076_0124171 3300049592 Bacteria 2091
281 Ga0501243_000848 3300049675 Bacteria 4257
282 Ga0501243_016512 3300049675 Bacteria 1192
283 Ga0501083_0054295 3300049744 Bacteria 2689
284 Ga0501035_0005869 3300049822 Bacteria 11572
285 Ga0501044_0079703 3300049823 Bacteria 3318
286 nmdc:mga0a205_1137822_c1 3300050515 Bacteria 628
287 Ga0495601_0234943 3300053077 Bacteria 1197
288 Ga0495612_0101062 3300053078 Bacteria 1228
289 Ga0500562_013482 3300053108 Bacteria 2088
290 Ga0500568_0012977 3300053139 Bacteria 3813
291 Ga0501082_0673213 3300060353 Bacteria 906
292 8056682436 8056681323 Bacteria 8472857
293 Ga0265319_1007565
294 JGI24751J29686_10002224
295 rootL2_10031817
296 rootH1_10037357
297 Ga0070683_100260434
298 Ga0070683_100473883
299 Ga0070690_100115982
300 Ga0070670_100757314
301 Ga0070677_10019134
302 Ga0068869_100002365
303 Ga0070666_10428346
304 Ga0070680_100470224
305 Ga0068868_100539808
306 Ga0070660_100047195
307 Ga0070689_100542754
308 Ga0070689_101756370
309 Ga0070687_100056537
310 Ga0070669_100511859
311 Ga0070669_100612822
312 Ga0070675_100008692
313 Ga0070671_100019459
314 Ga0070671_100892764
315 Ga0070674_100074290
316 Ga0070673_100003162
317 Ga0070673_100007893
318 Ga0070673_100617734
319 Ga0070659_100050756
320 Ga0070709_10758388
321 Ga0070701_10042503
322 Ga0070711_100310414
323 Ga0070700_100018777
324 Ga0070694_100252227
325 Ga0070678_100015273
326 Ga0070678_100303858
327 Ga0070681_10031135
328 Ga0070681_10098045
329 Ga0068867_100001511
330 Ga0068867_100403551
331 Ga0070707_100109558
332 Ga0070679_100064884
333 Ga0070679_101100383
334 Ga0070684_100008128
335 Ga0070672_100228485
336 Ga0070672_100292689
337 Ga0070686_100012596
338 Ga0070695_100023022
339 Ga0070693_100021618
340 Ga0068855_100337998
341 Ga0068855_102023764
342 Ga0068857_100526534
343 Ga0068857_100700415
344 Ga0068856_100925278
345 Ga0070702_100095334
346 Ga0068859_101430916
347 Ga0068864_100648441
348 Ga0068866_10021132
349 Ga0068863_100173118
350 Ga0068863_100786844
351 Ga0068858_100020005
352 Ga0068858_100233122
353 Ga0068860_100095734
354 Ga0068860_100215976
355 Ga0070715_10094543
356 Ga0097621_101222923
357 Ga0068871_100857947
358 Ga0075428_100134082
359 Ga0075428_100904231
360 Ga0075433_10324895
361 Ga0075434_100016557
362 Ga0068865_100144500
363 Ga0097620_101430789
364 Ga0105240_10136986
365 Ga0105245_10811967
366 Ga0105245_10981161
367 Ga0105242_10004870
368 Ga0105248_11130484
369 Ga0105238_10297327
370 Ga0105238_10678517
371 Ga0105239_11054346
372 Ga0105246_10199477
373 Ga0105246_10558064
374 Ga0157369_10244048
375 Ga0157378_10316207
376 Ga0157378_10761298
377 Ga0163162_10716330
378 Ga0163163_10013011
379 Ga0163163_10035212
380 Ga0163163_10185477
381 Ga0157380_10059116
382 Ga0157377_10025724
383 Ga0157379_10459871
384 Ga0157379_10623908
385 Ga0157376_10238741
386 Ga0209233_1010830
387 Ga0207682_10020853
388 Ga0207642_10076400
389 Ga0207680_10450352
390 Ga0207685_10076229
391 Ga0207643_10123540
392 Ga0207705_10057308
393 Ga0207707_10220058
394 Ga0207695_10149619
395 Ga0207663_10290025
396 Ga0207663_10795928
397 Ga0207660_10219694
398 Ga0207657_10458695
399 Ga0207649_10284650
400 Ga0207652_10048309
401 Ga0207681_10071970
402 Ga0207694_10268320
403 Ga0207694_10370950
404 Ga0207694_10866614
405 Ga0207659_10023157
406 Ga0207659_10338872
407 Ga0207700_10733025
408 Ga0207644_10033269
409 Ga0207690_10095499
410 Ga0207706_10202309
411 Ga0207686_10146298
412 Ga0207709_10019551
413 Ga0207670_10211731
414 Ga0207670_10695673
415 Ga0207669_10013580
416 Ga0207665_10013467
417 Ga0207691_10409199
418 Ga0207691_10507205
419 Ga0207711_10758144
420 Ga0207711_10785278
421 Ga0207689_10004252
422 Ga0207689_10260311
423 Ga0207661_10002220
424 Ga0207661_10584439
425 Ga0207651_10076069
426 Ga0207640_10042385
427 Ga0207677_10054974
428 Ga0207677_10662438
429 Ga0207703_10024883
430 Ga0207703_10105023
431 Ga0207708_10020770
432 Ga0207702_10332114
433 Ga0207641_10753582
434 Ga0207641_10773148
435 Ga0207641_11014096
436 Ga0207648_10000463
437 Ga0207676_10057934
438 Ga0207674_10097885
439 Ga0207675_100079412
440 Ga0207675_100974679
441 Ga0207683_10008732
442 Ga0207683_10407721
443 Ga0207698_11713382
444 Ga0268264_10075360
445 Ga0268264_10174097
446 Ga0265319_1004480
447 Ga0265319_1033522
448 Ga0265318_10009305
449 Ga0265318_10022816
450 Ga0265318_10205180
451 Ga0265323_10000416
452 Ga0265336_10004625
453 Ga0265336_10047915
454 Ga0307515_10490272
455 Ga0265338_10096356
456 Ga0265324_10005070
457 Ga0265324_10190884
458 Ga0265324_10197557
459 Ga0265332_10193967
460 Ga0265332_10251236
461 Ga0265328_10052616
462 Ga0265328_10084924
463 Ga0265328_10099358
464 Ga0265328_10106045
465 Ga0265320_10010461
466 Ga0265320_10011454
467 Ga0265329_10241054
468 Ga0265339_10032392
469 Ga0265339_10274894
470 Ga0265331_10007072
471 Ga0265327_10000417
472 Ga0265327_10033333
473 Ga0265327_10048586
474 Ga0265327_10354600
475 Ga0265316_10006304
476 Ga0265316_10013180
477 Ga0265316_10053959
478 Ga0265316_10466844
479 Ga0307408_101178415
480 Ga0265313_10003361
481 Ga0265314_10028871
482 Ga0265314_10088453
483 Ga0265314_10096302
484 Ga0265314_10355168
485 Ga0265342_10013542
486 Ga0265342_10049822
487 Ga0265342_10054797
488 Ga0307406_10236323
489 Ga0373926_0012416
490 Ga0373944_0141017
491 Ga0373923_0019644
492 Ga0373945_0011141
493 Ga0373953_0448011
494 Ga0373954_0008905
495 Ga0373956_0037017
496 Ga0373957_0022163
497 Ga0373943_0006310
498 Ga0373946_0028575
499 Ga0373946_0081437
500 Ga0373924_0004761
501 Ga0373935_0059381
502 Ga0373935_0109848
503 Ga0373927_0103086
504 Ga0373927_0124399
505 Ga0373933_0032897
506 Ga0373947_0025743
507 Ga0373947_0192145
508 Ga0373937_0024376
509 Ga0373937_0305701
510 Ga0373925_0008127
511 Ga0373925_0025316
512 Ga0373925_0199438
513 Ga0395905_0050431
514 Ga0436365_1151521
515 Ga0451807_2593518
516 Ga0439441_010213
517 Ga0450914_016884
518 Ga0451577_0284047
519 Ga0451577_0512444
520 Ga0451577_0572943
521 Ga0466966_0034557
522 Ga0466961_0025129
523 Ga0466963_0071267
524 Ga0453684_0014028
525 Ga0466968_0069245
526 Ga0466957_0122208
527 Ga0451576_0045801
528 Ga0451576_0509391
529 Ga0451576_0916177
530 Ga0495580_0014157
531 Ga0495582_0010213
532 Ga0495639_0012054
533 Ga0495664_0045546
534 Ga0495594_0198990
535 Ga0495608_0114167
536 Ga0495618_0020165
537 Ga0495628_0027207
538 Ga0495666_0070281
539 Ga0495652_0203897
540 Ga0495665_0032194
541 Ga0495640_0488263
542 Ga0495635_0166189
543 Ga0495646_0030846
544 Ga0495658_0092947
545 Ga0495613_0072027
546 Ga0495624_0013481
547 Ga0495581_0022831
548 Ga0495581_0200048
549 Ga0495636_0389646
550 Ga0495674_0079882
551 Ga0495676_0339990
552 Ga0495684_0353489
553 Ga0495686_0152121
554 Ga0495614_0446365
555 Ga0496104_0111899
556 Ga0496105_0654338
557 Ga0496112_0051008
558 Ga0496113_0324784
559 Ga0496126_0007204
560 Ga0496126_0026387
561 Ga0496126_0034270
562 Ga0496126_0255325
563 Ga0501034_0008090
564 Ga0501040_0473295
565 Ga0501046_0021243
566 Ga0501047_0016298
567 Ga0501047_0187121
568 Ga0501071_0161649
569 Ga0501072_0556222
570 Ga0501075_1027414
571 Ga0501076_0124171
572 Ga0501243_000848
573 Ga0501243_016512
574 Ga0501083_0054295
575 Ga0501035_0005869
576 Ga0501044_0079703
577 nmdc:mga0a205_1137822_c1
578 Ga0495601_0234943
579 Ga0495612_0101062
580 Ga0500562_013482
581 Ga0500568_0012977
582 Ga0501082_0673213
583 8056682436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

93

169

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

39

158

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

43

167

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

70

157

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9648 5 159
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9641 6 159
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9459 6 159
7zkt-assembly4.cif.gz_H moss spermine/spermidine acetyl transferase (ppssat) in complex with coa and lysine 0.9413 5 157
7zkt-assembly2.cif.gz_C moss spermine/spermidine acetyl transferase (ppssat) in complex with coa and lysine 0.9403 5 157
ID Description Score Start End Superfamily
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9803 4 161 3.40.630.30
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9651 5 162 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9641 6 159 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9459 6 159 3.40.630.30
af_Q8MRT7_5_173_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9435 4 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A498CPC3-F1-model_v4 GNAT family N-acetyltransferase 0.991 3 162 GO:0008080
AF-A0A1A6Y207-F1-model_v4 GCN5 family acetyltransferase 0.9889 5 160 GO:0008080
AF-A0A246TN62-F1-model_v4 GCN5 family acetyltransferase 0.988 5 160 GO:0008080
AF-A0A7W4B8C4-F1-model_v4 GNAT family N-acetyltransferase 0.9876 5 159 GO:0008080
AF-A0A1H7TKW4-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9865 4 165 GO:0008080

Map