F390300

General Info

Members Datasets Scaffolds Average Seq Length
291 137 284 636

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10096386|Ga0105240_100963862
Length 697
Sequence MGCRNSKCPYQNDNSIHKVFNGTNLSHVFLFYKYFSSIYFMQSHLKKLSFAGALITLGIIFGDIGTSPLYVFQTLLVEGRQVNEALVLGSISCIFWTLTLQTTFKYIFITLQADNHGEGGIFSLYALVRRYGKWLAIPAIIGAGTLLADGIITPPISVTSAIEGLSDVPALASSFVPGSKLILGIVIGIMLLLFFFQQFGTKVVGSAFGPVMLLWFLMIGVLGAIQFVHNPGIIRALNPYYGIHLLAVHPRAIYLLGAVFLCTTGAEALYSDLGHCGRKNIQVSWIFVKIALIFSYLGQGAWVLMQPAGTNFAGVNPFYQIVPYPHLFMIPCVALATLATIIASQALISGSFTLISEAVSMNFWPRITIKYPSNIRGQIYIPSINWILCFGCIAVSLYFQTSEAMTAAYGFSITIAMLMTTILMYYFMRYVKHWPVWLVTIILCLFITVEFSFFVANAIKLLKRLFFVAFEGGLIFTMYIWFKARKINNRFLHFVDLKDQVPLLSALSADTSISKYSTHLIYLTKANNARQIEEKILYSIMSRKPKRADVYWFVHIETTNEPYTMEYSVDQIEPGKIIRIEFRLGFRIQPRVNVLYRKVIEDMVARNEIDIHSHYESLNKFKINADFRFVIMEKFLSYNNSFSVKEGFILNSYFAIKKLAQSEAKAFGLDTSETYVEKIPLVVKPVGNIILKRVAAV

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.56
Metatranscriptomes 1.03
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 0
Rhizoplane 0.69
Rhizosphere 81.44
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000971 3300001904 Bacteria 5285
2 JGI24736J21556_1001055 3300001904 Bacteria 5028
3 JGI24740J21852_10007649 3300001979 Bacteria 4376
4 JGI24737J22298_10000276 3300001990 Bacteria 16974
5 JGI24737J22298_10003332 3300001990 Bacteria 5684
6 JGI24735J21928_10000013 3300002067 Bacteria 208663
7 JGI25162J39368_1000223 3300002737 Bacteria 58437
8 JGI25162J39368_1000615 3300002737 Bacteria 25611
9 JGI25162J39368_1003274 3300002737 Bacteria 4920
10 JGI25165J46597_1000476 3300003214 Bacteria 39146
11 rootH1_10040211 3300003316 Bacteria 6020
12 rootH2_10013162 3300003320 Bacteria 43068
13 rootH2_10041415 3300003320 Bacteria 32372
14 rootH2_10043704 3300003320 Bacteria 3875
15 rootH2_10047242 3300003320 Bacteria 23681
16 rootH2_10121881 3300003320 Bacteria 6365
17 rootL2_10009520 3300003322 Bacteria 8037
18 rootL2_10062722 3300003322 Bacteria 4675
19 rootH1_10005241 3300003323 Bacteria 23232
20 rootH1_10194087 3300003323 Bacteria 4386
21 Ga0055531_10000006 3300003794 Bacteria 226600
22 Ga0070658_10000059 3300005327 Bacteria 112781
23 Ga0070676_10002643 3300005328 Bacteria 9229
24 Ga0070683_100085890 3300005329 Bacteria 2950
25 Ga0070660_100000282 3300005339 Bacteria 33859
26 Ga0070660_100011344 3300005339 Bacteria 6326
27 Ga0070660_100063914 3300005339 Bacteria 2862
28 Ga0070671_100047519 3300005355 Bacteria 3569
29 Ga0070659_100001837 3300005366 Bacteria 15247
30 Ga0070659_100012795 3300005366 Bacteria 6231
31 Ga0070663_100051798 3300005455 Bacteria 2926
32 Ga0070662_100000003 3300005457 Bacteria 239813
33 Ga0070662_100000046 3300005457 Bacteria 67592
34 Ga0070662_100000805 3300005457 Bacteria 19301
35 Ga0070679_100003601 3300005530 Bacteria 14152
36 Ga0068853_100006896 3300005539 Bacteria 9068
37 Ga0068853_100089473 3300005539 Unclassified 2704
38 Ga0070665_100000009 3300005548 Bacteria 562640
39 Ga0070665_100000212 3300005548 Bacteria 100019
40 Ga0070665_100005210 3300005548 Bacteria 13452
41 Ga0068855_100000074 3300005563 Bacteria 119759
42 Ga0068855_100000246 3300005563 Bacteria 68191
43 Ga0068855_100002770 3300005563 Bacteria 21581
44 Ga0068855_100005115 3300005563 Bacteria 15990
45 Ga0068855_100030843 3300005563 Bacteria 6409
46 Ga0068855_100128707 3300005563 Bacteria 2893
47 Ga0068855_100197966 3300005563 Bacteria 2263
48 Ga0068854_100007848 3300005578 Bacteria 6828
49 Ga0068856_100000021 3300005614 Bacteria 145017
50 Ga0068856_100003606 3300005614 Bacteria 15583
51 Ga0068856_100004713 3300005614 Bacteria 13539
52 Ga0068856_100072008 3300005614 Bacteria 3422
53 Ga0068852_100005446 3300005616 Bacteria 9101
54 Ga0068851_10000110 3300005834 Bacteria 43687
55 Ga0068858_100093389 3300005842 Bacteria 2801
56 Ga0068860_100000033 3300005843 Bacteria 245461
57 Ga0075366_10002368 3300006195 Bacteria 9655
58 Ga0075366_10006213 3300006195 Bacteria 6522
59 Ga0097621_100000480 3300006237 Bacteria 27941
60 Ga0068871_100000112 3300006358 Bacteria 49503
61 Ga0068865_100000780 3300006881 Bacteria 17900
62 Ga0105240_10000023 3300009093 Bacteria 385028
63 Ga0105240_10000281 3300009093 Bacteria 100881
64 Ga0105240_10000321 3300009093 Bacteria 90931
65 Ga0105240_10011665 3300009093 Bacteria 12213
66 Ga0105240_10012935 3300009093 Bacteria 11494
67 Ga0105240_10013049 3300009093 Bacteria 11435
68 Ga0105240_10029880 3300009093 Bacteria 7092
69 Ga0105240_10030363 3300009093 Bacteria 7024
70 Ga0105240_10040448 3300009093 Bacteria 5961
71 Ga0105240_10044104 3300009093 Bacteria 5670
72 Ga0105240_10046506 3300009093 Bacteria 5499
73 Ga0105240_10080949 3300009093 Bacteria 3992
74 Ga0105240_10096386 3300009093 Bacteria 3605
75 Ga0105241_10000529 3300009174 Bacteria 28750
76 Ga0105241_10001633 3300009174 Bacteria 17090
77 Ga0105237_10000261 3300009545 Bacteria 74745
78 Ga0105237_10000273 3300009545 Bacteria 72474
79 Ga0105237_10001048 3300009545 Bacteria 37140
80 Ga0105237_10007514 3300009545 Bacteria 11918
81 Ga0105237_10014595 3300009545 Bacteria 8208
82 Ga0105237_10019455 3300009545 Bacteria 7011
83 Ga0105237_10048123 3300009545 Bacteria 4286
84 Ga0105238_10059569 3300009551 Bacteria 3824
85 Ga0105239_10000007 3300010375 Bacteria 385297
86 Ga0105239_10000016 3300010375 Bacteria 293142
87 Ga0105239_10000038 3300010375 Bacteria 205230
88 Ga0105239_10000069 3300010375 Bacteria 144493
89 Ga0105239_10000345 3300010375 Bacteria 67861
90 Ga0105239_10000813 3300010375 Bacteria 44289
91 Ga0105239_10001028 3300010375 Bacteria 38962
92 Ga0105239_10022169 3300010375 Bacteria 7000
93 Ga0105239_10026262 3300010375 Bacteria 6410
94 Ga0157373_10000303 3300013100 Bacteria 39933
95 Ga0157373_10000480 3300013100 Bacteria 31713
96 Ga0157373_10049663 3300013100 Unclassified 2989
97 Ga0157371_10000480 3300013102 Bacteria 48687
98 Ga0157371_10001025 3300013102 Bacteria 30579
99 Ga0157371_10003659 3300013102 Bacteria 13830
100 Ga0157370_10024231 3300013104 Bacteria 6013
101 Ga0157370_10029243 3300013104 Bacteria 5412
102 Ga0157369_10001563 3300013105 Bacteria 28031
103 Ga0157369_10001894 3300013105 Bacteria 25222
104 Ga0157374_10000414 3300013296 Bacteria 38746
105 Ga0157374_10008625 3300013296 Bacteria 8721
106 Ga0157374_10021774 3300013296 Bacteria 5710
107 Ga0157378_10012083 3300013297 Bacteria 7562
108 Ga0157378_10015067 3300013297 Bacteria 6766
109 Ga0157378_10085737 3300013297 Bacteria 2853
110 Ga0157378_10127287 3300013297 Bacteria 2354
111 Ga0163162_10000008 3300013306 Bacteria 316194
112 Ga0163162_10013325 3300013306 Bacteria 8031
113 Ga0157372_10000070 3300013307 Bacteria 109649
114 Ga0157372_10000077 3300013307 Bacteria 102192
115 Ga0157372_10000296 3300013307 Bacteria 55447
116 Ga0157372_10000472 3300013307 Bacteria 44394
117 Ga0157372_10001355 3300013307 Bacteria 26492
118 Ga0157372_10003141 3300013307 Bacteria 17807
119 Ga0157372_10008829 3300013307 Bacteria 10705
120 Ga0157372_10105898 3300013307 Unclassified 3217
121 Ga0157375_10002636 3300013308 Bacteria 15528
122 Ga0157375_10027600 3300013308 Bacteria 5308
123 Ga0182008_10000237 3300014497 Bacteria 42829
124 Ga0157376_10005971 3300014969 Bacteria 8555
125 Ga0163161_10001618 3300017792 Bacteria 16584
126 Ga0206351_10648882 3300020077 Unclassified 2094
127 Ga0154015_1153887 3300020610 Unclassified 2093
128 Ga0224712_10025220 3300022467 Unclassified 2088
129 Ga0207427_100091 3300025231 Bacteria 133410
130 Ga0209437_100026 3300025233 Bacteria 542698
131 Ga0209437_100070 3300025233 Bacteria 306718
132 Ga0209258_100151 3300025242 Bacteria 160444
133 Ga0209646_1001549 3300025246 Bacteria 6069
134 Ga0209026_1000251 3300025250 Bacteria 67956
135 Ga0209026_1002397 3300025250 Bacteria 7071
136 Ga0209026_1003449 3300025250 Bacteria 5174
137 Ga0209148_1000264 3300025254 Bacteria 82495
138 Ga0209233_1000111 3300025261 Bacteria 260262
139 Ga0209233_1001418 3300025261 Bacteria 9453
140 Ga0209455_1001675 3300025272 Bacteria 9530
141 Ga0209257_1000071 3300025304 Bacteria 335832
142 Ga0207656_10000091 3300025321 Bacteria 33460
143 Ga0207647_10000027 3300025904 Bacteria 109872
144 Ga0207647_10000244 3300025904 Bacteria 44547
145 Ga0207647_10000368 3300025904 Bacteria 36725
146 Ga0207647_10002359 3300025904 Bacteria 14347
147 Ga0207647_10028467 3300025904 Unclassified 3627
148 Ga0207645_10000014 3300025907 Bacteria 117512
149 Ga0207705_10000195 3300025909 Bacteria 61397
150 Ga0207654_10000324 3300025911 Bacteria 28612
151 Ga0207654_10012731 3300025911 Unclassified 4317
152 Ga0207695_10000016 3300025913 Bacteria 771991
153 Ga0207695_10000197 3300025913 Bacteria 168837
154 Ga0207695_10000296 3300025913 Bacteria 123322
155 Ga0207695_10007068 3300025913 Bacteria 14395
156 Ga0207695_10007519 3300025913 Bacteria 13821
157 Ga0207695_10008461 3300025913 Bacteria 12883
158 Ga0207695_10009583 3300025913 Bacteria 11962
159 Ga0207695_10011455 3300025913 Bacteria 10739
160 Ga0207695_10032255 3300025913 Bacteria 5735
161 Ga0207695_10089198 3300025913 Bacteria 3101
162 Ga0207695_10111892 3300025913 Unclassified 2709
163 Ga0207671_10000516 3300025914 Bacteria 52391
164 Ga0207671_10003730 3300025914 Bacteria 15012
165 Ga0207671_10004372 3300025914 Bacteria 13548
166 Ga0207671_10011659 3300025914 Bacteria 7131
167 Ga0207671_10011734 3300025914 Bacteria 7099
168 Ga0207671_10012371 3300025914 Bacteria 6865
169 Ga0207671_10035311 3300025914 Bacteria 3711
170 Ga0207671_10056932 3300025914 Bacteria 2897
171 Ga0207657_10000746 3300025919 Bacteria 34480
172 Ga0207657_10040176 3300025919 Bacteria 4148
173 Ga0207657_10110217 3300025919 Bacteria 2274
174 Ga0207694_10009111 3300025924 Bacteria 7490
175 Ga0207644_10027038 3300025931 Bacteria 3961
176 Ga0207690_10002357 3300025932 Bacteria 11464
177 Ga0207690_10005404 3300025932 Bacteria 7528
178 Ga0207706_10000009 3300025933 Bacteria 200607
179 Ga0207706_10000010 3300025933 Bacteria 200039
180 Ga0207706_10002242 3300025933 Bacteria 18857
181 Ga0207704_10000601 3300025938 Bacteria 15875
182 Ga0207667_10000014 3300025949 Bacteria 421261
183 Ga0207667_10000823 3300025949 Bacteria 40119
184 Ga0207667_10057869 3300025949 Bacteria 4067
185 Ga0207667_10175489 3300025949 Bacteria 2202
186 Ga0207639_10013589 3300026041 Bacteria 5704
187 Ga0207639_10076776 3300026041 Unclassified 2631
188 Ga0207678_10070776 3300026067 Bacteria 2990
189 Ga0207702_10000217 3300026078 Bacteria 67356
190 Ga0207702_10015609 3300026078 Bacteria 6287
191 Ga0207702_10040966 3300026078 Bacteria 3883
192 Ga0207702_10125081 3300026078 Bacteria 2307
193 Ga0207702_10192994 3300026078 Bacteria 1883
194 Ga0207698_10003696 3300026142 Bacteria 9255
195 Ga0207698_10011015 3300026142 Bacteria 5846
196 Ga0268266_10000014 3300028379 Bacteria 644033
197 Ga0268266_10000177 3300028379 Bacteria 114318
198 Ga0268266_10004417 3300028379 Bacteria 13474
199 Ga0268264_10000013 3300028381 Bacteria 513859
200 Ga0307517_10001416 3300028786 Bacteria 40353
201 Ga0307515_10002577 3300028794 Bacteria 39123
202 Ga0307515_10005660 3300028794 Bacteria 25234
203 Ga0265338_10014752 3300028800 Bacteria 8655
204 Ga0307511_10002442 3300030521 Bacteria 19433
205 Ga0265327_10000115 3300031251 Bacteria 173854
206 Ga0307408_100004178 3300031548 Bacteria 9842
207 Ga0307412_10002710 3300031911 Bacteria 9838
208 Ga0307507_10000023 3300033179 Bacteria 212423
209 Ga0307510_10000172 3300033180 Bacteria 54812
210 Ga0307510_10001022 3300033180 Bacteria 29641
211 Ga0395899_0000002 3300037312 Bacteria 1324310
212 Ga0395899_0000011 3300037312 Bacteria 521331
213 Ga0395899_0000087 3300037312 Bacteria 157502
214 Ga0395899_0000681 3300037312 Bacteria 34363
215 Ga0395899_0011159 3300037312 Bacteria 6884
216 Ga0395900_0000288 3300037418 Bacteria 75715
217 Ga0395900_0000557 3300037418 Bacteria 51834
218 Ga0395900_0000658 3300037418 Bacteria 46240
219 Ga0395900_0005101 3300037418 Bacteria 13790
220 Ga0395900_0100115 3300037418 Bacteria 2977
221 Ga0395898_0053344 3300037466 Bacteria 3949
222 Ga0395898_0054813 3300037466 Bacteria 3889
223 Ga0395905_0000303 3300037471 Bacteria 71615
224 Ga0395905_0000473 3300037471 Bacteria 55504
225 Ga0395905_0001785 3300037471 Bacteria 24962
226 Ga0395905_0002719 3300037471 Bacteria 19374
227 Ga0395901_0000446 3300038443 Bacteria 48079
228 Ga0395901_0002120 3300038443 Bacteria 20321
229 Ga0395901_0022104 3300038443 Bacteria 6517
230 Ga0395901_0037458 3300038443 Bacteria 5016
231 Ga0466969_0019977 3300044656 Bacteria 3472
232 Ga0466969_0023003 3300044656 Bacteria 3214
233 Ga0453684_0005228 3300044712 Bacteria 26003
234 Ga0466959_0003166 3300045049 Bacteria 10681
235 Ga0495651_0037340 3300046462 Bacteria 3782
236 Ga0495650_0000162 3300046471 Bacteria 148927
237 Ga0495582_0031100 3300046473 Bacteria 2933
238 Ga0495585_0000153 3300046492 Bacteria 74267
239 Ga0495585_0004910 3300046492 Bacteria 8558
240 Ga0495606_0000033 3300046507 Bacteria 247739
241 Ga0495606_0004980 3300046507 Bacteria 12952
242 Ga0495606_0015092 3300046507 Bacteria 5978
243 Ga0495610_0002700 3300046512 Bacteria 14625
244 Ga0495616_0012525 3300046513 Bacteria 4813
245 Ga0495631_0006879 3300046518 Bacteria 5835
246 Ga0495648_0001909 3300046524 Bacteria 19896
247 Ga0495648_0002028 3300046524 Bacteria 19206
248 Ga0495648_0019775 3300046524 Bacteria 4719
249 Ga0495633_0000302 3300046558 Bacteria 56283
250 Ga0495633_0009120 3300046558 Bacteria 5508
251 Ga0495668_0000134 3300046616 Bacteria 112135
252 Ga0495668_0004053 3300046616 Bacteria 10657
253 Ga0495611_0000154 3300046648 Bacteria 49174
254 Ga0495625_0000131 3300046660 Bacteria 117738
255 Ga0495625_0002048 3300046660 Bacteria 22650
256 Ga0495625_0006653 3300046660 Bacteria 10252
257 Ga0495625_0091878 3300046660 Bacteria 2098
258 Ga0495661_0002413 3300046665 Bacteria 14394
259 Ga0495661_0017227 3300046665 Bacteria 4772
260 Ga0495658_0064354 3300046683 Bacteria 2113
261 Ga0495649_0000009 3300046694 Bacteria 451725
262 Ga0495649_0033147 3300046694 Bacteria 2843
263 Ga0495660_0002677 3300046810 Bacteria 11275
264 Ga0495636_0000026 3300047318 Bacteria 63897
265 Ga0495687_000056 3300047443 Bacteria 188227
266 Ga0495687_000409 3300047443 Bacteria 53157
267 Ga0495687_001183 3300047443 Bacteria 25146
268 Ga0495686_0000016 3300047472 Bacteria 443701
269 Ga0495686_0000113 3300047472 Bacteria 168307
270 Ga0495686_0000737 3300047472 Bacteria 43637
271 Ga0495686_0062168 3300047472 Bacteria 2317
272 Ga0496115_0052422 3300048918 Unclassified 3273
273 Ga0496122_0000591 3300048925 Bacteria 74549
274 Ga0496123_0003951 3300048926 Bacteria 16069
275 nmdc:mga0k408_115_c1 3300050493 Bacteria 39256
276 nmdc:mga0k408_1835_c1 3300050493 Bacteria 11401
277 Ga0500644_0000346 3300053088 Bacteria 23379
278 Ga0500583_0000672 3300053092 Bacteria 10062
279 Ga0500608_007884 3300053122 Bacteria 4434
280 Ga0500618_000006 3300053125 Bacteria 239188
281 Ga0500622_0000175 3300053156 Bacteria 69363
282 Ga0500622_0002062 3300053156 Bacteria 14972
283 Ga0500624_001013 3300053157 Bacteria 5611
284 Ga0466962_0032690 3300061719 Bacteria 2490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10110217 Ga0207657_101102172 551
2 3300026078 Ga0207702_10192994 Ga0207702_101929941 559
3 3300010375 Ga0105239_10001028 Ga0105239_1000102812 577
4 3300005834 Ga0068851_10000110 Ga0068851_1000011025 582
5 3300025321 Ga0207656_10000091 Ga0207656_1000009125 582
6 3300053122 Ga0500608_007884 Ga0500608_007884_1565_3520 582
7 3300047472 Ga0495686_0000016 Ga0495686_0000016_154703_156622 586
8 3300003322 rootL2_10062722 rootL2_100627224 588
9 3300003323 rootH1_10194087 rootH1_101940871 588
10 3300009093 Ga0105240_10000281 Ga0105240_100002818 593
11 3300025246 Ga0209646_1001549 Ga0209646_10015494 593
12 3300025913 Ga0207695_10000296 Ga0207695_1000029694 593
13 3300047318 Ga0495636_0000026 Ga0495636_0000026_32664_34619 594
14 3300026078 Ga0207702_10125081 Ga0207702_101250812 595
15 3300038443 Ga0395901_0037458 Ga0395901_0037458_35_1942 595
16 3300009093 Ga0105240_10000023 Ga0105240_10000023218 596
17 3300025250 Ga0209026_1003449 Ga0209026_10034491 596
18 3300025913 Ga0207695_10000016 Ga0207695_10000016100 596
19 3300025904 Ga0207647_10002359 Ga0207647_100023594 598
20 3300005548 Ga0070665_100005210 Ga0070665_1000052107 599
21 3300028379 Ga0268266_10004417 Ga0268266_100044174 599
22 3300044712 Ga0453684_0005228 Ga0453684_0005228_17306_19261 599
23 3300050493 nmdc:mga0k408_1835_c1 nmdc:mga0k408_1835_c1_7281_9212 599
24 3300031548 Ga0307408_100004178 Ga0307408_1000041784 600
25 3300005614 Ga0068856_100072008 Ga0068856_1000720082 601
26 3300037312 Ga0395899_0000002 Ga0395899_0000002_534377_536323 601
27 3300003320 rootH2_10013162 rootH2_1001316238 603
28 3300003794 Ga0055531_10000006 Ga0055531_1000000672 603
29 3300025304 Ga0209257_1000071 Ga0209257_1000071146 603
30 3300003320 rootH2_10041415 rootH2_1004141511 604
31 3300005563 Ga0068855_100030843 Ga0068855_1000308434 604
32 3300009545 Ga0105237_10007514 Ga0105237_100075144 604
33 3300010375 Ga0105239_10000345 Ga0105239_1000034519 604
34 3300013307 Ga0157372_10008829 Ga0157372_100088299 604
35 3300025914 Ga0207671_10056932 Ga0207671_100569322 604
36 3300025919 Ga0207657_10040176 Ga0207657_100401763 604
37 3300005563 Ga0068855_100005115 Ga0068855_1000051157 605
38 3300005578 Ga0068854_100007848 Ga0068854_1000078484 605
39 3300005614 Ga0068856_100004713 Ga0068856_1000047134 605
40 3300005616 Ga0068852_100005446 Ga0068852_1000054461 605
41 3300009093 Ga0105240_10029880 Ga0105240_100298805 605
42 3300009093 Ga0105240_10040448 Ga0105240_100404484 605
43 3300009545 Ga0105237_10048123 Ga0105237_100481234 605
44 3300013104 Ga0157370_10029243 Ga0157370_100292432 605
45 3300013307 Ga0157372_10001355 Ga0157372_100013552 605
46 3300013307 Ga0157372_10003141 Ga0157372_100031419 605
47 3300025904 Ga0207647_10028467 Ga0207647_100284672 605
48 3300025913 Ga0207695_10008461 Ga0207695_100084615 605
49 3300025913 Ga0207695_10111892 Ga0207695_101118922 605
50 3300025914 Ga0207671_10035311 Ga0207671_100353113 605
51 3300025949 Ga0207667_10057869 Ga0207667_100578692 605
52 3300026142 Ga0207698_10003696 Ga0207698_100036965 605
53 3300048918 Ga0496115_0052422 Ga0496115_0052422_1279_3252 605
54 3300005539 Ga0068853_100006896 Ga0068853_1000068966 606
55 3300009093 Ga0105240_10012935 Ga0105240_100129356 606
56 3300010375 Ga0105239_10022169 Ga0105239_100221694 606
57 3300014969 Ga0157376_10005971 Ga0157376_100059716 606
58 3300026041 Ga0207639_10013589 Ga0207639_100135894 606
59 3300030521 Ga0307511_10002442 Ga0307511_1000244213 606
60 3300046471 Ga0495650_0000162 Ga0495650_0000162_141293_143254 606
61 3300046492 Ga0495585_0000153 Ga0495585_0000153_23194_25155 606
62 3300046507 Ga0495606_0000033 Ga0495606_0000033_159612_161573 606
63 3300046512 Ga0495610_0002700 Ga0495610_0002700_12462_14423 606
64 3300046513 Ga0495616_0012525 Ga0495616_0012525_1133_3094 606
65 3300046558 Ga0495633_0009120 Ga0495633_0009120_3335_5296 606
66 3300046660 Ga0495625_0000131 Ga0495625_0000131_36282_38243 606
67 3300046694 Ga0495649_0000009 Ga0495649_0000009_36282_38243 606
68 3300003322 rootL2_10009520 rootL2_100095203 607
69 3300009093 Ga0105240_10046506 Ga0105240_100465063 607
70 3300009545 Ga0105237_10000261 Ga0105237_1000026119 607
71 3300013306 Ga0163162_10013325 Ga0163162_100133256 607
72 3300025913 Ga0207695_10032255 Ga0207695_100322552 607
73 3300045049 Ga0466959_0003166 Ga0466959_0003166_7979_9955 607
74 3300046694 Ga0495649_0033147 Ga0495649_0033147_461_2437 607
75 3300047443 Ga0495687_000056 Ga0495687_000056_181386_183371 607
76 3300061719 Ga0466962_0032690 Ga0466962_0032690_171_2147 607
77 3300005329 Ga0070683_100085890 Ga0070683_1000858902 608
78 3300046648 Ga0495611_0000154 Ga0495611_0000154_14922_16919 608
79 3300053157 Ga0500624_001013 Ga0500624_001013_2595_4559 608
80 3300026078 Ga0207702_10015609 Ga0207702_100156098 609
81 3300013297 Ga0157378_10015067 Ga0157378_100150673 610
82 3300013308 Ga0157375_10027600 Ga0157375_100276003 610
83 3300028794 Ga0307515_10005660 Ga0307515_1000566012 610
84 3300033180 Ga0307510_10001022 Ga0307510_1000102211 610
85 3300053125 Ga0500618_000006 Ga0500618_000006_17164_19128 610
86 3300005843 Ga0068860_100000033 Ga0068860_1000000335 611
87 3300006195 Ga0075366_10002368 Ga0075366_100023687 611
88 3300028381 Ga0268264_10000013 Ga0268264_100000135 611
89 3300033179 Ga0307507_10000023 Ga0307507_100000239 611
90 3300046616 Ga0495668_0004053 Ga0495668_0004053_2059_4017 611
91 3300005539 Ga0068853_100089473 Ga0068853_1000894732 612
92 3300009093 Ga0105240_10011665 Ga0105240_100116656 612
93 3300009093 Ga0105240_10030363 Ga0105240_100303632 612
94 3300009551 Ga0105238_10059569 Ga0105238_100595693 612
95 3300025913 Ga0207695_10007519 Ga0207695_100075197 612
96 3300025914 Ga0207671_10011659 Ga0207671_100116594 612
97 3300025924 Ga0207694_10009111 Ga0207694_100091115 612
98 3300028794 Ga0307515_10002577 Ga0307515_1000257721 612
99 3300046492 Ga0495585_0004910 Ga0495585_0004910_3705_5672 612
100 3300046524 Ga0495648_0001909 Ga0495648_0001909_17877_19844 612
101 3300046558 Ga0495633_0000302 Ga0495633_0000302_7985_9952 612
102 3300046616 Ga0495668_0000134 Ga0495668_0000134_46709_48676 612
103 3300046660 Ga0495625_0006653 Ga0495625_0006653_3754_5721 612
104 3300046683 Ga0495658_0064354 Ga0495658_0064354_102_2069 612
105 3300013296 Ga0157374_10021774 Ga0157374_100217745 613
106 3300028786 Ga0307517_10001416 Ga0307517_1000141636 613
107 3300033180 Ga0307510_10000172 Ga0307510_1000017245 613
108 3300037312 Ga0395899_0011159 Ga0395899_0011159_1451_3388 613
109 3300037418 Ga0395900_0005101 Ga0395900_0005101_3906_5843 613
110 3300037471 Ga0395905_0002719 Ga0395905_0002719_10930_12867 613
111 3300046518 Ga0495631_0006879 Ga0495631_0006879_463_2454 613
112 3300002737 JGI25162J39368_1000615 JGI25162J39368_100061510 615
113 3300009093 Ga0105240_10044104 Ga0105240_100441043 615
114 3300009545 Ga0105237_10001048 Ga0105237_1000104839 615
115 3300010375 Ga0105239_10000007 Ga0105239_10000007167 615
116 3300025914 Ga0207671_10003730 Ga0207671_1000373011 615
117 3300046507 Ga0495606_0015092 Ga0495606_0015092_2189_4159 615
118 3300046660 Ga0495625_0002048 Ga0495625_0002048_16474_18441 615
119 3300013307 Ga0157372_10105898 Ga0157372_101058983 616
120 3300047472 Ga0495686_0062168 Ga0495686_0062168_240_2195 616
121 3300001990 JGI24737J22298_10000276 JGI24737J22298_100002765 617
122 3300002067 JGI24735J21928_10000013 JGI24735J21928_10000013114 617
123 3300005327 Ga0070658_10000059 Ga0070658_10000059113 617
124 3300005530 Ga0070679_100003601 Ga0070679_10000360110 617
125 3300005563 Ga0068855_100002770 Ga0068855_10000277022 617
126 3300005563 Ga0068855_100128707 Ga0068855_1001287071 617
127 3300025250 Ga0209026_1000251 Ga0209026_100025118 617
128 3300025909 Ga0207705_10000195 Ga0207705_1000019557 617
129 3300037418 Ga0395900_0000557 Ga0395900_0000557_30997_32970 617
130 3300037466 Ga0395898_0054813 Ga0395898_0054813_1623_3596 617
131 3300037471 Ga0395905_0000303 Ga0395905_0000303_26076_28049 617
132 3300038443 Ga0395901_0000446 Ga0395901_0000446_20031_22004 617
133 3300003316 rootH1_10040211 rootH1_100402112 618
134 3300003320 rootH2_10043704 rootH2_100437044 618
135 3300010375 Ga0105239_10000016 Ga0105239_10000016148 618
136 3300013102 Ga0157371_10001025 Ga0157371_1000102514 618
137 3300013105 Ga0157369_10001894 Ga0157369_100018947 618
138 3300013307 Ga0157372_10000077 Ga0157372_1000007767 618
139 3300044656 Ga0466969_0019977 Ga0466969_0019977_1362_3335 618
140 3300046665 Ga0495661_0002413 Ga0495661_0002413_1078_3075 618
141 3300001979 JGI24740J21852_10007649 JGI24740J21852_100076493 619
142 3300005339 Ga0070660_100000282 Ga0070660_10000028228 619
143 3300005455 Ga0070663_100051798 Ga0070663_1000517982 619
144 3300010375 Ga0105239_10000038 Ga0105239_1000003841 619
145 3300010375 Ga0105239_10026262 Ga0105239_100262627 619
146 3300013105 Ga0157369_10001563 Ga0157369_100015635 619
147 3300025242 Ga0209258_100151 Ga0209258_100151102 619
148 3300025254 Ga0209148_1000264 Ga0209148_100026477 619
149 3300025914 Ga0207671_10012371 Ga0207671_100123714 619
150 3300025919 Ga0207657_10000746 Ga0207657_100007467 619
151 3300026067 Ga0207678_10070776 Ga0207678_100707762 619
152 3300044656 Ga0466969_0023003 Ga0466969_0023003_464_2440 619
153 3300046524 Ga0495648_0019775 Ga0495648_0019775_145_2145 619
154 3300053088 Ga0500644_0000346 Ga0500644_0000346_14019_15992 619
155 3300013102 Ga0157371_10003659 Ga0157371_100036599 620
156 3300013307 Ga0157372_10000070 Ga0157372_100000704 620
157 3300037312 Ga0395899_0000087 Ga0395899_0000087_152399_154375 620
158 3300002737 JGI25162J39368_1000223 JGI25162J39368_100022346 621
159 3300003320 rootH2_10047242 rootH2_1004724214 621
160 3300005548 Ga0070665_100000009 Ga0070665_100000009320 621
161 3300009545 Ga0105237_10019455 Ga0105237_100194553 621
162 3300010375 Ga0105239_10000069 Ga0105239_100000695 621
163 3300013100 Ga0157373_10000303 Ga0157373_1000030317 621
164 3300013104 Ga0157370_10024231 Ga0157370_100242316 621
165 3300013307 Ga0157372_10000472 Ga0157372_1000047235 621
166 3300013308 Ga0157375_10002636 Ga0157375_100026366 621
167 3300014497 Ga0182008_10000237 Ga0182008_100002374 621
168 3300017792 Ga0163161_10001618 Ga0163161_100016185 621
169 3300020077 Ga0206351_10648882 Ga0206351_106488821 621
170 3300020610 Ga0154015_1153887 Ga0154015_11538871 621
171 3300022467 Ga0224712_10025220 Ga0224712_100252201 621
172 3300025233 Ga0209437_100070 Ga0209437_100070282 621
173 3300025914 Ga0207671_10004372 Ga0207671_100043726 621
174 3300025914 Ga0207671_10011734 Ga0207671_100117343 621
175 3300028379 Ga0268266_10000014 Ga0268266_10000014352 621
176 3300046524 Ga0495648_0002028 Ga0495648_0002028_1580_3565 621
177 3300047443 Ga0495687_000409 Ga0495687_000409_28669_30657 621
178 3300048925 Ga0496122_0000591 Ga0496122_0000591_32808_34790 621
179 3300048926 Ga0496123_0003951 Ga0496123_0003951_10681_12663 621
180 3300053092 Ga0500583_0000672 Ga0500583_0000672_7700_9685 621
181 3300053156 Ga0500622_0002062 Ga0500622_0002062_11790_13775 621
182 3300005366 Ga0070659_100012795 Ga0070659_1000127952 622
183 3300025932 Ga0207690_10005404 Ga0207690_100054042 622
184 3300026041 Ga0207639_10076776 Ga0207639_100767761 622
185 3300046473 Ga0495582_0031100 Ga0495582_0031100_457_2436 622
186 3300046507 Ga0495606_0004980 Ga0495606_0004980_7107_9086 622
187 3300046660 Ga0495625_0091878 Ga0495625_0091878_37_2007 622
188 3300053156 Ga0500622_0000175 Ga0500622_0000175_59851_61821 622
189 3300031251 Ga0265327_10000115 Ga0265327_1000011523 623
190 iso_pu_bacteria 2818991460 2819680045 623
191 3300005339 Ga0070660_100063914 Ga0070660_1000639144 624
192 3300005457 Ga0070662_100000046 Ga0070662_10000004619 624
193 3300005614 Ga0068856_100003606 Ga0068856_10000360611 624
194 3300005842 Ga0068858_100093389 Ga0068858_1000933893 624
195 3300009174 Ga0105241_10001633 Ga0105241_1000163310 624
196 3300013100 Ga0157373_10049663 Ga0157373_100496633 624
197 3300013296 Ga0157374_10008625 Ga0157374_100086255 624
198 3300025904 Ga0207647_10000027 Ga0207647_1000002767 624
199 3300025933 Ga0207706_10000010 Ga0207706_10000010141 624
200 3300026078 Ga0207702_10040966 Ga0207702_100409662 624
201 3300047443 Ga0495687_001183 Ga0495687_001183_16997_18970 624
202 3300005563 Ga0068855_100000246 Ga0068855_10000024623 625
203 3300013297 Ga0157378_10012083 Ga0157378_100120833 625
204 3300025949 Ga0207667_10000823 Ga0207667_100008235 625
205 3300037418 Ga0395900_0100115 Ga0395900_0100115_51_2030 625
206 3300047472 Ga0495686_0000113 Ga0495686_0000113_163982_165982 625
207 3300002737 JGI25162J39368_1003274 JGI25162J39368_10032742 626
208 3300003214 JGI25165J46597_1000476 JGI25165J46597_100047623 626
209 3300005457 Ga0070662_100000805 Ga0070662_1000008056 626
210 3300005614 Ga0068856_100000021 Ga0068856_10000002150 626
211 3300025231 Ga0207427_100091 Ga0207427_10009122 626
212 3300025233 Ga0209437_100026 Ga0209437_100026129 626
213 3300025250 Ga0209026_1002397 Ga0209026_10023973 626
214 3300025261 Ga0209233_1000111 Ga0209233_100011123 626
215 3300025933 Ga0207706_10002242 Ga0207706_1000224211 626
216 3300026078 Ga0207702_10000217 Ga0207702_1000021730 626
217 3300028800 Ga0265338_10014752 Ga0265338_1001475210 626
218 3300037312 Ga0395899_0000011 Ga0395899_0000011_183799_185796 626
219 iso_pu_bacteria 2738541283 2738757260 627
220 3300003323 rootH1_10005241 rootH1_1000524113 628
221 3300005563 Ga0068855_100000074 Ga0068855_10000007432 628
222 3300006195 Ga0075366_10006213 Ga0075366_100062133 628
223 3300025272 Ga0209455_1001675 Ga0209455_10016752 628
224 3300025913 Ga0207695_10089198 Ga0207695_100891981 628
225 3300025949 Ga0207667_10000014 Ga0207667_1000001475 628
226 3300046462 Ga0495651_0037340 Ga0495651_0037340_992_2965 628
227 3300046665 Ga0495661_0017227 Ga0495661_0017227_2428_4401 628
228 3300050493 nmdc:mga0k408_115_c1 nmdc:mga0k408_115_c1_24398_26371 628
229 3300037471 Ga0395905_0000473 Ga0395905_0000473_40438_42450 630
230 iso_pu_bacteria 2599185184 2599480374 630
231 iso_pu_bacteria 2928078545 2928083384 630
232 iso_pu_bacteria 2928147474 2928151354 630
233 iso_pu_bacteria 2932082852 2932087270 630
234 3300037312 Ga0395899_0000681 Ga0395899_0000681_20373_22370 631
235 3300037418 Ga0395900_0000658 Ga0395900_0000658_32374_34371 631
236 3300037466 Ga0395898_0053344 Ga0395898_0053344_975_2972 631
237 3300037471 Ga0395905_0001785 Ga0395905_0001785_12364_14361 631
238 3300038443 Ga0395901_0002120 Ga0395901_0002120_7723_9720 631
239 iso_pu_bacteria 2919437846 2919438556 633
240 3300009093 Ga0105240_10000321 Ga0105240_1000032128 634
241 3300009545 Ga0105237_10000273 Ga0105237_1000027362 634
242 3300010375 Ga0105239_10000813 Ga0105239_1000081318 634
243 3300013297 Ga0157378_10127287 Ga0157378_101272871 634
244 3300025911 Ga0207654_10012731 Ga0207654_100127314 634
245 3300025913 Ga0207695_10000197 Ga0207695_1000019796 634
246 3300025914 Ga0207671_10000516 Ga0207671_1000051610 634
247 3300031911 Ga0307412_10002710 Ga0307412_100027104 634
248 3300005355 Ga0070671_100047519 Ga0070671_1000475192 635
249 3300005563 Ga0068855_100197966 Ga0068855_1001979661 635
250 3300025931 Ga0207644_10027038 Ga0207644_100270383 635
251 3300025949 Ga0207667_10175489 Ga0207667_101754891 635
252 3300046810 Ga0495660_0002677 Ga0495660_0002677_4193_6190 635
253 3300001904 JGI24736J21556_1001055 JGI24736J21556_10010552 636
254 3300001990 JGI24737J22298_10003332 JGI24737J22298_100033323 636
255 3300003320 rootH2_10121881 rootH2_101218813 636
256 3300005328 Ga0070676_10002643 Ga0070676_100026434 636
257 3300005366 Ga0070659_100001837 Ga0070659_1000018372 636
258 3300005548 Ga0070665_100000212 Ga0070665_10000021271 636
259 3300006237 Ga0097621_100000480 Ga0097621_1000004803 636
260 3300006358 Ga0068871_100000112 Ga0068871_1000001121 636
261 3300006881 Ga0068865_100000780 Ga0068865_1000007805 636
262 3300009093 Ga0105240_10013049 Ga0105240_100130493 636
263 3300009545 Ga0105237_10014595 Ga0105237_100145955 636
264 3300013100 Ga0157373_10000480 Ga0157373_1000048019 636
265 3300013102 Ga0157371_10000480 Ga0157371_100004803 636
266 3300013297 Ga0157378_10085737 Ga0157378_100857372 636
267 3300013306 Ga0163162_10000008 Ga0163162_1000000810 636
268 3300013307 Ga0157372_10000296 Ga0157372_1000029624 636
269 3300025261 Ga0209233_1001418 Ga0209233_10014182 636
270 3300025904 Ga0207647_10000368 Ga0207647_1000036811 636
271 3300025907 Ga0207645_10000014 Ga0207645_1000001426 636
272 3300025913 Ga0207695_10007068 Ga0207695_100070688 636
273 3300025932 Ga0207690_10002357 Ga0207690_100023576 636
274 3300025938 Ga0207704_10000601 Ga0207704_1000060113 636
275 3300026142 Ga0207698_10011015 Ga0207698_100110153 636
276 3300028379 Ga0268266_10000177 Ga0268266_1000017749 636
277 3300037418 Ga0395900_0000288 Ga0395900_0000288_70116_72107 636
278 3300038443 Ga0395901_0022104 Ga0395901_0022104_190_2196 636
279 3300009093 Ga0105240_10080949 Ga0105240_100809494 637
280 3300009174 Ga0105241_10000529 Ga0105241_100005294 637
281 3300013296 Ga0157374_10000414 Ga0157374_1000041435 637
282 3300025913 Ga0207695_10011455 Ga0207695_100114557 637
283 3300047472 Ga0495686_0000737 Ga0495686_0000737_28245_30257 637
284 3300009093 Ga0105240_10096386 Ga0105240_100963862 638
285 3300025913 Ga0207695_10009583 Ga0207695_100095831 638
286 3300001904 JGI24736J21556_1000971 JGI24736J21556_10009712 647
287 3300005339 Ga0070660_100011344 Ga0070660_1000113445 647
288 3300005457 Ga0070662_100000003 Ga0070662_10000000399 647
289 3300025904 Ga0207647_10000244 Ga0207647_1000024414 647
290 3300025911 Ga0207654_10000324 Ga0207654_100003244 647
291 3300025933 Ga0207706_10000009 Ga0207706_10000009107 647

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02705

K_trans

K+ potassium transporter integral membrane domain

52

502

0.93

PF22776

K_trans_C

K+ potassium transporter C-terminal domain

517

689

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gi9-assembly1.cif.gz_C crystal structure of apct transporter bound to 7f11 monoclonal fab fragment 0.6171 16 427
6yv1-assembly1.cif.gz_A structure of human b(0,+)at1 0.6164 21 417
6yv1-assembly1.cif.gz_A structure of human b(0,+)at1 0.6076 21 417
8fht-assembly1.cif.gz_B cryo-em structure of human ncc 0.5912 27 420
4dji-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.5893 16 416
ID Description Score Start End Superfamily
af_Q69RI8_116_588_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8781 24 427 1.20.1740.10
af_Q942X8_26_493_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8736 24 420 1.20.1740.10
af_Q652J4_30_507_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8693 23 427 1.20.1740.10
af_Q5JK32_78_523_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8621 37 412 1.20.1740.10
af_Q84MS4_133_530_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8527 104 420 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A4Q3RDR5-F1-model_v4 Potassium transporter Kup 0.9188 11 269 GO:0015079
GO:0016020
AF-A8UAH5-F1-model_v4 Potassium uptake protein 0.9166 25 303 GO:0015079
GO:0016020
AF-A0A519ZI28-F1-model_v4 Potassium transporter Kup 0.9076 9 475 GO:0015079
GO:0016020
AF-A0A3C0U9R3-F1-model_v4 Potassium transporter Kup 0.9051 15 422 GO:0015079
GO:0016020
AF-A0A4Y9ICK2-F1-model_v4 deleted 0.9039 432 557

Feature Viewer

pLDDT pTM Quality
78.13 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map