F390258

General Info

Members Datasets Scaffolds Average Seq Length
291 211 279 295

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10005063|Ga0081538_1000506310
Length 316
Sequence MLDHYRRVQQGSGHGSERGRAAQMKMHDGEVDIDAELVRRLVAGQFPDLAGLPIREVRPTGTVNAIYRLGDHRCARLPRVQWWADDLDKEWYWLPKLAPHLSLRVPELVGRGHPAGSYPFHWAIYGWIDGQPYADELVGDERQAARDLARFVVELRRIDPAGAPAGGRQPLRELDAVTREAIESARGLIDGDAAIAAWERALEAPAWEGTPVWIHSDLLRPNLLVRDGRLCAIIDFGGVGVGDPATDVIAAWSVFGRAGREVFRAALDVDDGTWERARGLALHQAALIIPYYAETNPAFAAPAKCTVEEILADLHA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
5 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
6 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
7 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
8 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
9 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
10 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
11 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
119 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 5.15
Rhizosphere 91.41
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003089 3300003203 Bacteria 7830
2 Ga0070683_100205595 3300005329 Bacteria 1870
3 Ga0070683_100364584 3300005329 Bacteria 1376
4 Ga0068869_100150532 3300005334 Bacteria 1804
5 Ga0070682_100351239 3300005337 Bacteria 1099
6 Ga0068868_100006099 3300005338 Bacteria 8515
7 Ga0068868_100070962 3300005338 Bacteria 2778
8 Ga0070660_100315776 3300005339 Bacteria 1283
9 Ga0070691_10042889 3300005341 Bacteria 2142
10 Ga0070668_100022603 3300005347 Bacteria 4755
11 Ga0070671_100234578 3300005355 Bacteria 1557
12 Ga0070659_100270183 3300005366 Bacteria 1412
13 Ga0070713_100267998 3300005436 Bacteria 1563
14 Ga0070710_10118886 3300005437 Bacteria 1597
15 Ga0070700_100099729 3300005441 Bacteria 1911
16 Ga0070708_100088929 3300005445 Bacteria 2809
17 Ga0070678_100014163 3300005456 Bacteria 5022
18 Ga0070662_100046508 3300005457 Bacteria 3118
19 Ga0068867_100025252 3300005459 Bacteria 4263
20 Ga0068867_100033604 3300005459 Bacteria 3715
21 Ga0070685_10099012 3300005466 Bacteria 1777
22 Ga0070698_100008543 3300005471 Bacteria 11051
23 Ga0070698_100526262 3300005471 Unclassified 1121
24 Ga0070697_100061207 3300005536 Bacteria 3070
25 Ga0070686_100087131 3300005544 Bacteria 2081
26 Ga0070696_100085608 3300005546 Bacteria 2237
27 Ga0070704_100021499 3300005549 Bacteria 4184
28 Ga0068854_100080787 3300005578 Bacteria 2400
29 Ga0068854_100166474 3300005578 Bacteria 1712
30 Ga0070702_100088329 3300005615 Bacteria 1874
31 Ga0070702_100172635 3300005615 Bacteria 1408
32 Ga0070702_100356570 3300005615 Bacteria 1032
33 Ga0068852_100379263 3300005616 Bacteria 1387
34 Ga0068859_100159327 3300005617 Bacteria 2336
35 Ga0068864_100143827 3300005618 Bacteria 2153
36 Ga0068864_100326910 3300005618 Bacteria 1441
37 Ga0068861_100015491 3300005719 Bacteria 5374
38 Ga0068861_100043172 3300005719 Bacteria 3382
39 Ga0068862_100096493 3300005844 Bacteria 2581
40 Ga0081538_10005063 3300005981 Bacteria 11980
41 Ga0081538_10016792 3300005981 Bacteria 5591
42 Ga0081539_10000911 3300005985 Bacteria 55934
43 Ga0081539_10046646 3300005985 Bacteria 2481
44 Ga0070717_10131230 3300006028 Bacteria 2155
45 Ga0070715_10137277 3300006163 Bacteria 1183
46 Ga0070712_100180308 3300006175 Bacteria 1645
47 Ga0097621_100054522 3300006237 Bacteria 3261
48 Ga0068871_100356687 3300006358 Bacteria 1294
49 Ga0075428_100125581 3300006844 Bacteria 2792
50 Ga0075433_10015095 3300006852 Bacteria 6326
51 Ga0075433_10056011 3300006852 Bacteria 3443
52 Ga0075434_100121440 3300006871 Bacteria 2628
53 Ga0075434_100442272 3300006871 Bacteria 1321
54 Ga0068865_100032261 3300006881 Bacteria 3497
55 Ga0068865_100087836 3300006881 Bacteria 2248
56 Ga0068865_100112922 3300006881 Bacteria 2007
57 Ga0075436_100028672 3300006914 Bacteria 3829
58 Ga0097620_100159318 3300006931 Bacteria 2336
59 Ga0075435_100093160 3300007076 Bacteria 2489
60 Ga0105245_10070054 3300009098 Bacteria 3181
61 Ga0105245_10227888 3300009098 Bacteria 1801
62 Ga0105245_10236798 3300009098 Bacteria 1768
63 Ga0105245_10245852 3300009098 Unclassified 1736
64 Ga0114129_10059451 3300009147 Bacteria 5343
65 Ga0105243_10006852 3300009148 Bacteria 8783
66 Ga0105243_10018955 3300009148 Bacteria 5216
67 Ga0105243_10480231 3300009148 Bacteria 1173
68 Ga0105242_10002117 3300009176 Bacteria 15659
69 Ga0105242_10099557 3300009176 Bacteria 2461
70 Ga0105242_10207940 3300009176 Bacteria 1742
71 Ga0105248_10036635 3300009177 Bacteria 5487
72 Ga0105238_10062325 3300009551 Bacteria 3730
73 Ga0105249_10182514 3300009553 Bacteria 2042
74 Ga0105239_10106996 3300010375 Bacteria 3098
75 Ga0105239_10286489 3300010375 Bacteria 1855
76 Ga0105246_10012778 3300011119 Bacteria 5248
77 Ga0157374_10009671 3300013296 Bacteria 8281
78 Ga0157374_10223866 3300013296 Bacteria 1847
79 Ga0157378_10061515 3300013297 Bacteria 3351
80 Ga0157378_10105130 3300013297 Bacteria 2581
81 Ga0157375_10002453 3300013308 Bacteria 16054
82 Ga0157375_10169399 3300013308 Bacteria 2331
83 Ga0163163_10063012 3300014325 Bacteria 3675
84 Ga0163163_10106821 3300014325 Bacteria 2825
85 Ga0157380_10232478 3300014326 Bacteria 1657
86 Ga0157377_10003799 3300014745 Bacteria 6860
87 Ga0157377_10005959 3300014745 Bacteria 5773
88 Ga0157379_10028221 3300014968 Bacteria 4996
89 Ga0209025_1034559 3300025294 Bacteria 2304
90 Ga0207692_10119394 3300025898 Bacteria 1474
91 Ga0207688_10013608 3300025901 Bacteria 4422
92 Ga0207685_10087170 3300025905 Bacteria 1306
93 Ga0207699_10163575 3300025906 Bacteria 1483
94 Ga0207645_10092576 3300025907 Bacteria 1944
95 Ga0207645_10099893 3300025907 Bacteria 1871
96 Ga0207645_10177079 3300025907 Bacteria 1399
97 Ga0207693_10033489 3300025915 Bacteria 4054
98 Ga0207693_10036570 3300025915 Bacteria 3871
99 Ga0207663_10032626 3300025916 Bacteria 3094
100 Ga0207657_10294386 3300025919 Bacteria 1287
101 Ga0207694_10248647 3300025924 Bacteria 1455
102 Ga0207687_10023465 3300025927 Bacteria 4112
103 Ga0207687_10251655 3300025927 Bacteria 1405
104 Ga0207687_10324603 3300025927 Bacteria 1247
105 Ga0207700_10172085 3300025928 Bacteria 1807
106 Ga0207644_10188826 3300025931 Bacteria 1619
107 Ga0207690_10037021 3300025932 Bacteria 3165
108 Ga0207706_10049403 3300025933 Bacteria 3717
109 Ga0207686_10002904 3300025934 Bacteria 9240
110 Ga0207686_10259106 3300025934 Bacteria 1274
111 Ga0207709_10103930 3300025935 Bacteria 1884
112 Ga0207704_10204381 3300025938 Bacteria 1448
113 Ga0207711_10078836 3300025941 Bacteria 2874
114 Ga0207689_10063094 3300025942 Bacteria 3048
115 Ga0207689_10220161 3300025942 Bacteria 1568
116 Ga0207712_10018929 3300025961 Bacteria 4492
117 Ga0207640_10053549 3300025981 Bacteria 2635
118 Ga0207678_10171154 3300026067 Bacteria 1854
119 Ga0207708_10031750 3300026075 Bacteria 4010
120 Ga0207648_10012282 3300026089 Bacteria 8018
121 Ga0207648_10070292 3300026089 Bacteria 3052
122 Ga0207648_10231601 3300026089 Bacteria 1643
123 Ga0207675_100003383 3300026118 Bacteria 15588
124 Ga0207675_100222516 3300026118 Bacteria 1819
125 Ga0207683_10176257 3300026121 Bacteria 1938
126 Ga0207698_10046271 3300026142 Bacteria 3284
127 Ga0265336_10007710 3300028666 Bacteria 3818
128 Ga0265338_10008734 3300028800 Bacteria 12248
129 Ga0307511_10006397 3300030521 Bacteria 11871
130 Ga0307508_10223179 3300031616 Bacteria 1484
131 Ga0316578_10272097 3300031728 Unclassified 1015
132 Ga0307415_100244562 3300032126 Bacteria 1454
133 Ga0307507_10019950 3300033179 Bacteria 7525
134 Ga0373938_0031624 3300034957 Bacteria 1136
135 Ga0373926_0009544 3300035083 Bacteria 3242
136 Ga0373944_0003790 3300035089 Bacteria 3912
137 Ga0373936_0006903 3300035113 Bacteria 4273
138 Ga0373945_0003063 3300035116 Bacteria 5256
139 Ga0373945_0043385 3300035116 Bacteria 1632
140 Ga0373943_0004990 3300035170 Bacteria 5987
141 Ga0373943_0051025 3300035170 Bacteria 2035
142 Ga0373946_0007353 3300035171 Bacteria 4023
143 Ga0373955_0017380 3300035172 Bacteria 3560
144 Ga0373924_0005078 3300035410 Bacteria 4636
145 Ga0395900_0421125 3300037418 Bacteria 1296
146 Ga0395900_0486305 3300037418 Unclassified 1186
147 Ga0439448_0101960 3300042005 Bacteria 976
148 Ga0439455_0045277 3300042012 Bacteria 1137
149 Ga0439463_018849 3300042016 Bacteria 1718
150 Ga0466966_0007519 3300044684 Bacteria 7217
151 Ga0466961_0021235 3300044693 Bacteria 4180
152 Ga0466971_0056644 3300044719 Bacteria 1768
153 Ga0466959_0006046 3300045049 Bacteria 8351
154 Ga0495617_025239 3300046452 Bacteria 2004
155 Ga0495592_0001976 3300046454 Bacteria 14475
156 Ga0495603_0028351 3300046455 Bacteria 3377
157 Ga0495603_0039953 3300046455 Bacteria 2809
158 Ga0495603_0051329 3300046455 Bacteria 2451
159 Ga0495629_0010783 3300046459 Bacteria 6647
160 Ga0495629_0104830 3300046459 Bacteria 1972
161 Ga0495629_0150621 3300046459 Bacteria 1617
162 Ga0495641_0002361 3300046461 Bacteria 14980
163 Ga0495653_0149391 3300046463 Bacteria 1634
164 Ga0495580_0078916 3300046472 Bacteria 2296
165 Ga0495580_0152466 3300046472 Bacteria 1601
166 Ga0495582_0009925 3300046473 Bacteria 5239
167 Ga0495582_0011793 3300046473 Bacteria 4815
168 Ga0495605_0108133 3300046474 Bacteria 1272
169 Ga0495639_0000733 3300046475 Bacteria 15007
170 Ga0495662_0016944 3300046476 Bacteria 3525
171 Ga0495662_0017160 3300046476 Bacteria 3504
172 Ga0495664_0001427 3300046477 Bacteria 12682
173 Ga0495664_0189543 3300046477 Bacteria 1247
174 Ga0495594_0007648 3300046499 Bacteria 5559
175 Ga0495594_0028133 3300046499 Bacteria 3031
176 Ga0495596_0017860 3300046500 Unclassified 2931
177 Ga0495628_0088425 3300046516 Bacteria 2401
178 Ga0495630_0002027 3300046517 Bacteria 14086
179 Ga0495630_0067880 3300046517 Bacteria 2680
180 Ga0495631_0082720 3300046518 Bacteria 1384
181 Ga0495644_0001644 3300046523 Bacteria 9092
182 Ga0495644_0040089 3300046523 Bacteria 1766
183 Ga0495663_0023069 3300046525 Unclassified 1800
184 Ga0495666_0067885 3300046526 Bacteria 1698
185 Ga0495652_0051068 3300046529 Bacteria 3533
186 Ga0495665_0004867 3300046531 Bacteria 7242
187 Ga0495640_0048872 3300046533 Bacteria 2920
188 Ga0495640_0053593 3300046533 Bacteria 2765
189 Ga0495586_0017466 3300046535 Bacteria 3813
190 Ga0495586_0039439 3300046535 Bacteria 2539
191 Ga0495587_0041300 3300046536 Bacteria 2752
192 Ga0495598_0000052 3300046537 Bacteria 18353
193 Ga0495645_0042457 3300046543 Bacteria 3315
194 Ga0495645_0042596 3300046543 Bacteria 3310
195 Ga0495622_0007268 3300046557 Bacteria 5139
196 Ga0495622_0031828 3300046557 Bacteria 2464
197 Ga0495633_0030902 3300046558 Unclassified 2600
198 Ga0495667_0052735 3300046559 Bacteria 2679
199 Ga0495656_0001246 3300046615 Bacteria 8288
200 Ga0495656_0059750 3300046615 Bacteria 1660
201 Ga0495634_0000830 3300046642 Bacteria 29781
202 Ga0495634_0039572 3300046642 Bacteria 3210
203 Ga0495611_0071044 3300046648 Bacteria 1591
204 Ga0495611_0079116 3300046648 Bacteria 1510
205 Ga0495611_0102795 3300046648 Bacteria 1328
206 Ga0495635_0013998 3300046663 Bacteria 5612
207 Ga0495635_0028412 3300046663 Bacteria 3887
208 Ga0495659_0016713 3300046664 Unclassified 2423
209 Ga0495661_0066502 3300046665 Unclassified 2121
210 Ga0495588_0005724 3300046674 Bacteria 5546
211 Ga0495657_0026392 3300046675 Bacteria 4113
212 Ga0495657_0052306 3300046675 Bacteria 2738
213 Ga0495599_0171911 3300046678 Bacteria 1337
214 Ga0495623_0236150 3300046679 Bacteria 1034
215 Ga0495646_0001039 3300046680 Bacteria 16059
216 Ga0495658_0011019 3300046683 Bacteria 4535
217 Ga0495658_0038449 3300046683 Bacteria 2650
218 Ga0495669_0030752 3300046684 Unclassified 2357
219 Ga0495613_0001710 3300046689 Bacteria 16714
220 Ga0495613_0027057 3300046689 Bacteria 4268
221 Ga0495613_0179225 3300046689 Bacteria 1501
222 Ga0495624_0108518 3300046690 Bacteria 1707
223 Ga0495624_0198550 3300046690 Bacteria 1219
224 Ga0495670_0002207 3300046691 Bacteria 9629
225 Ga0495600_0009296 3300046809 Bacteria 6068
226 Ga0495581_0002019 3300047315 Bacteria 11410
227 Ga0495581_0011785 3300047315 Bacteria 5063
228 Ga0495581_0027925 3300047315 Bacteria 3272
229 Ga0495604_0006812 3300047317 Bacteria 9054
230 Ga0495636_0058165 3300047318 Bacteria 1629
231 Ga0495674_0023854 3300047319 Bacteria 5630
232 Ga0495674_0142154 3300047319 Bacteria 2017
233 Ga0495676_0019000 3300047321 Bacteria 6052
234 Ga0495676_0022666 3300047321 Bacteria 5459
235 Ga0495676_0049389 3300047321 Bacteria 3383
236 Ga0495680_0043241 3300047322 Bacteria 3568
237 Ga0495687_017865 3300047443 Bacteria 3521
238 Ga0495675_0038020 3300047444 Bacteria 3065
239 Ga0495685_041348 3300047447 Bacteria 1576
240 Ga0495684_0072810 3300047471 Bacteria 2611
241 Ga0495684_0097421 3300047471 Bacteria 2225
242 Ga0495593_0014261 3300047673 Bacteria 4519
243 Ga0495593_0016695 3300047673 Bacteria 4136
244 Ga0495602_0005106 3300048088 Bacteria 13753
245 Ga0495614_0014852 3300048089 Bacteria 3403
246 Ga0495614_0015595 3300048089 Bacteria 3312
247 Ga0495614_0053236 3300048089 Bacteria 1735
248 Ga0496100_0024397 3300048903 Bacteria 3688
249 Ga0496102_0007042 3300048905 Bacteria 9599
250 Ga0496103_0026897 3300048906 Bacteria 3482
251 Ga0496105_0262291 3300048908 Bacteria 1397
252 Ga0496106_0003478 3300048909 Bacteria 11730
253 Ga0496106_0049741 3300048909 Bacteria 3158
254 Ga0496107_0039431 3300048910 Bacteria 3388
255 Ga0496108_0005128 3300048911 Bacteria 10587
256 Ga0496109_0016706 3300048912 Bacteria 6420
257 Ga0496110_0079244 3300048913 Bacteria 2924
258 Ga0496111_0070064 3300048914 Bacteria 2550
259 Ga0496111_0074926 3300048914 Bacteria 2465
260 Ga0496112_0035622 3300048915 Bacteria 4850
261 Ga0496112_0039902 3300048915 Bacteria 4589
262 Ga0496114_0020083 3300048917 Bacteria 5419
263 Ga0501034_0013594 3300049571 Bacteria 8378
264 Ga0501043_0112485 3300049579 Bacteria 2138
265 Ga0501046_0006609 3300049580 Bacteria 10242
266 Ga0501070_0096413 3300049586 Bacteria 2447
267 Ga0501035_0044372 3300049822 Bacteria 4004
268 Ga0501044_0027715 3300049823 Bacteria 5981
269 nmdc:mga05p37_6637_c1 3300050507 Bacteria 13650
270 nmdc:mga09592_502162_c1 3300050508 Bacteria 1044
271 nmdc:mga0n895_165979_c1 3300050512 Bacteria 2240
272 nmdc:mga0n895_54228_c1 3300050512 Bacteria 3943
273 nmdc:mga0a205_49477_c1 3300050515 Bacteria 4057
274 nmdc:mga0a205_72765_c1 3300050515 Bacteria 3321
275 Ga0495612_0141087 3300053078 Bacteria 1045
276 Ga0495619_0120863 3300053085 Bacteria 1796
277 Ga0500640_045520 3300053095 Bacteria 1924
278 Ga0500616_0006508 3300053153 Bacteria 7643
279 Ga0466962_0021817 3300061719 Bacteria 3075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_502162_c1 nmdc:mga09592_502162_c1_255_1013 233
2 3300037418 Ga0395900_0421125 Ga0395900_0421125_476_1240 247
3 3300046533 Ga0495640_0053593 Ga0495640_0053593_1966_2742 247
4 3300046648 Ga0495611_0071044 Ga0495611_0071044_19_783 247
5 3300053078 Ga0495612_0141087 Ga0495612_0141087_54_830 247
6 3300042005 Ga0439448_0101960 Ga0439448_0101960_190_954 249
7 3300049579 Ga0501043_0112485 Ga0501043_0112485_1331_2122 254
8 3300025906 Ga0207699_10163575 Ga0207699_101635752 269
9 3300046679 Ga0495623_0236150 Ga0495623_0236150_173_1024 272
10 3300005337 Ga0070682_100351239 Ga0070682_1003512392 273
11 3300031728 Ga0316578_10272097 Ga0316578_102720971 273
12 3300025907 Ga0207645_10092576 Ga0207645_100925762 274
13 iso_pu_bacteria 3006984091 3006985128 277
14 3300037418 Ga0395900_0486305 Ga0395900_0486305_193_1086 278
15 iso_pu_bacteria 2946053406 2946054739 278
16 3300044684 Ga0466966_0007519 Ga0466966_0007519_3513_4385 279
17 3300044693 Ga0466961_0021235 Ga0466961_0021235_2315_3187 279
18 3300044719 Ga0466971_0056644 Ga0466971_0056644_588_1460 279
19 3300045049 Ga0466959_0006046 Ga0466959_0006046_4014_4886 279
20 3300061719 Ga0466962_0021817 Ga0466962_0021817_577_1449 279
21 3300032126 Ga0307415_100244562 Ga0307415_1002445622 280
22 3300005437 Ga0070710_10118886 Ga0070710_101188863 281
23 3300025898 Ga0207692_10119394 Ga0207692_101193942 281
24 3300025915 Ga0207693_10036570 Ga0207693_100365703 281
25 3300030521 Ga0307511_10006397 Ga0307511_100063976 281
26 iso_pu_bacteria 2558860280 2559429751 281
27 3300025294 Ga0209025_1034559 Ga0209025_10345591 282
28 iso_pu_bacteria 2808606522 2809591363 283
29 3300005436 Ga0070713_100267998 Ga0070713_1002679982 284
30 3300005578 Ga0068854_100080787 Ga0068854_1000807872 284
31 3300025928 Ga0207700_10172085 Ga0207700_101720852 284
32 3300025981 Ga0207640_10053549 Ga0207640_100535492 284
33 iso_pu_bacteria 2862993130 2862995566 284
34 iso_pu_bacteria 2964326757 2964329126 284
35 3300048913 Ga0496110_0079244 Ga0496110_0079244_618_1553 285
36 3300049571 Ga0501034_0013594 Ga0501034_0013594_4740_5630 285
37 3300049580 Ga0501046_0006609 Ga0501046_0006609_7678_8568 285
38 3300049586 Ga0501070_0096413 Ga0501070_0096413_1262_2152 285
39 3300049822 Ga0501035_0044372 Ga0501035_0044372_2155_3045 285
40 3300049823 Ga0501044_0027715 Ga0501044_0027715_1195_2085 285
41 3300005329 Ga0070683_100364584 Ga0070683_1003645841 286
42 3300005334 Ga0068869_100150532 Ga0068869_1001505322 286
43 3300005338 Ga0068868_100006099 Ga0068868_1000060998 286
44 3300005338 Ga0068868_100070962 Ga0068868_1000709625 286
45 3300005339 Ga0070660_100315776 Ga0070660_1003157762 286
46 3300005341 Ga0070691_10042889 Ga0070691_100428893 286
47 3300005347 Ga0070668_100022603 Ga0070668_1000226037 286
48 3300005355 Ga0070671_100234578 Ga0070671_1002345782 286
49 3300005366 Ga0070659_100270183 Ga0070659_1002701833 286
50 3300005441 Ga0070700_100099729 Ga0070700_1000997292 286
51 3300005445 Ga0070708_100088929 Ga0070708_1000889293 286
52 3300005456 Ga0070678_100014163 Ga0070678_1000141632 286
53 3300005457 Ga0070662_100046508 Ga0070662_1000465082 286
54 3300005459 Ga0068867_100025252 Ga0068867_1000252525 286
55 3300005459 Ga0068867_100033604 Ga0068867_1000336043 286
56 3300005466 Ga0070685_10099012 Ga0070685_100990122 286
57 3300005471 Ga0070698_100008543 Ga0070698_1000085438 286
58 3300005471 Ga0070698_100526262 Ga0070698_1005262621 286
59 3300005536 Ga0070697_100061207 Ga0070697_1000612075 286
60 3300005544 Ga0070686_100087131 Ga0070686_1000871312 286
61 3300005546 Ga0070696_100085608 Ga0070696_1000856083 286
62 3300005549 Ga0070704_100021499 Ga0070704_1000214993 286
63 3300005578 Ga0068854_100166474 Ga0068854_1001664742 286
64 3300005615 Ga0070702_100088329 Ga0070702_1000883292 286
65 3300005615 Ga0070702_100172635 Ga0070702_1001726351 286
66 3300005615 Ga0070702_100356570 Ga0070702_1003565701 286
67 3300005616 Ga0068852_100379263 Ga0068852_1003792632 286
68 3300005617 Ga0068859_100159327 Ga0068859_1001593273 286
69 3300005618 Ga0068864_100143827 Ga0068864_1001438272 286
70 3300005618 Ga0068864_100326910 Ga0068864_1003269102 286
71 3300005719 Ga0068861_100015491 Ga0068861_1000154912 286
72 3300005719 Ga0068861_100043172 Ga0068861_1000431722 286
73 3300005844 Ga0068862_100096493 Ga0068862_1000964933 286
74 3300005981 Ga0081538_10005063 Ga0081538_1000506310 286
75 3300005981 Ga0081538_10016792 Ga0081538_100167924 286
76 3300005985 Ga0081539_10046646 Ga0081539_100466463 286
77 3300006028 Ga0070717_10131230 Ga0070717_101312302 286
78 3300006163 Ga0070715_10137277 Ga0070715_101372771 286
79 3300006175 Ga0070712_100180308 Ga0070712_1001803082 286
80 3300006237 Ga0097621_100054522 Ga0097621_1000545224 286
81 3300006358 Ga0068871_100356687 Ga0068871_1003566872 286
82 3300006844 Ga0075428_100125581 Ga0075428_1001255812 286
83 3300006852 Ga0075433_10015095 Ga0075433_100150954 286
84 3300006852 Ga0075433_10056011 Ga0075433_100560114 286
85 3300006871 Ga0075434_100121440 Ga0075434_1001214402 286
86 3300006871 Ga0075434_100442272 Ga0075434_1004422721 286
87 3300006881 Ga0068865_100032261 Ga0068865_1000322612 286
88 3300006881 Ga0068865_100087836 Ga0068865_1000878363 286
89 3300006881 Ga0068865_100112922 Ga0068865_1001129224 286
90 3300006914 Ga0075436_100028672 Ga0075436_1000286721 286
91 3300006931 Ga0097620_100159318 Ga0097620_1001593183 286
92 3300007076 Ga0075435_100093160 Ga0075435_1000931602 286
93 3300009098 Ga0105245_10070054 Ga0105245_100700542 286
94 3300009098 Ga0105245_10227888 Ga0105245_102278882 286
95 3300009098 Ga0105245_10236798 Ga0105245_102367982 286
96 3300009098 Ga0105245_10245852 Ga0105245_102458521 286
97 3300009147 Ga0114129_10059451 Ga0114129_100594514 286
98 3300009148 Ga0105243_10006852 Ga0105243_100068525 286
99 3300009148 Ga0105243_10018955 Ga0105243_100189552 286
100 3300009148 Ga0105243_10480231 Ga0105243_104802311 286
101 3300009176 Ga0105242_10002117 Ga0105242_100021176 286
102 3300009176 Ga0105242_10099557 Ga0105242_100995572 286
103 3300009176 Ga0105242_10207940 Ga0105242_102079402 286
104 3300009177 Ga0105248_10036635 Ga0105248_100366354 286
105 3300009551 Ga0105238_10062325 Ga0105238_100623253 286
106 3300009553 Ga0105249_10182514 Ga0105249_101825141 286
107 3300010375 Ga0105239_10106996 Ga0105239_101069963 286
108 3300010375 Ga0105239_10286489 Ga0105239_102864891 286
109 3300011119 Ga0105246_10012778 Ga0105246_100127783 286
110 3300013296 Ga0157374_10009671 Ga0157374_100096714 286
111 3300013296 Ga0157374_10223866 Ga0157374_102238663 286
112 3300013297 Ga0157378_10061515 Ga0157378_100615152 286
113 3300013297 Ga0157378_10105130 Ga0157378_101051303 286
114 3300013308 Ga0157375_10002453 Ga0157375_100024538 286
115 3300013308 Ga0157375_10169399 Ga0157375_101693992 286
116 3300014325 Ga0163163_10063012 Ga0163163_100630123 286
117 3300014325 Ga0163163_10106821 Ga0163163_101068213 286
118 3300014326 Ga0157380_10232478 Ga0157380_102324782 286
119 3300014745 Ga0157377_10003799 Ga0157377_100037992 286
120 3300014745 Ga0157377_10005959 Ga0157377_100059593 286
121 3300014968 Ga0157379_10028221 Ga0157379_100282213 286
122 3300025901 Ga0207688_10013608 Ga0207688_100136083 286
123 3300025905 Ga0207685_10087170 Ga0207685_100871702 286
124 3300025907 Ga0207645_10099893 Ga0207645_100998933 286
125 3300025907 Ga0207645_10177079 Ga0207645_101770793 286
126 3300025915 Ga0207693_10033489 Ga0207693_100334893 286
127 3300025916 Ga0207663_10032626 Ga0207663_100326262 286
128 3300025919 Ga0207657_10294386 Ga0207657_102943861 286
129 3300025924 Ga0207694_10248647 Ga0207694_102486472 286
130 3300025927 Ga0207687_10023465 Ga0207687_100234654 286
131 3300025927 Ga0207687_10251655 Ga0207687_102516551 286
132 3300025927 Ga0207687_10324603 Ga0207687_103246032 286
133 3300025931 Ga0207644_10188826 Ga0207644_101888262 286
134 3300025932 Ga0207690_10037021 Ga0207690_100370212 286
135 3300025933 Ga0207706_10049403 Ga0207706_100494032 286
136 3300025934 Ga0207686_10002904 Ga0207686_100029047 286
137 3300025934 Ga0207686_10259106 Ga0207686_102591062 286
138 3300025935 Ga0207709_10103930 Ga0207709_101039302 286
139 3300025938 Ga0207704_10204381 Ga0207704_102043812 286
140 3300025941 Ga0207711_10078836 Ga0207711_100788362 286
141 3300025942 Ga0207689_10063094 Ga0207689_100630943 286
142 3300025942 Ga0207689_10220161 Ga0207689_102201612 286
143 3300025961 Ga0207712_10018929 Ga0207712_100189293 286
144 3300026067 Ga0207678_10171154 Ga0207678_101711542 286
145 3300026075 Ga0207708_10031750 Ga0207708_100317502 286
146 3300026089 Ga0207648_10012282 Ga0207648_100122823 286
147 3300026089 Ga0207648_10070292 Ga0207648_100702922 286
148 3300026089 Ga0207648_10231601 Ga0207648_102316012 286
149 3300026118 Ga0207675_100003383 Ga0207675_1000033838 286
150 3300026118 Ga0207675_100222516 Ga0207675_1002225162 286
151 3300026121 Ga0207683_10176257 Ga0207683_101762573 286
152 3300026142 Ga0207698_10046271 Ga0207698_100462712 286
153 3300028666 Ga0265336_10007710 Ga0265336_100077103 286
154 3300028800 Ga0265338_10008734 Ga0265338_100087345 286
155 3300034957 Ga0373938_0031624 Ga0373938_0031624_31_915 286
156 3300035083 Ga0373926_0009544 Ga0373926_0009544_464_1342 286
157 3300035089 Ga0373944_0003790 Ga0373944_0003790_2335_3213 286
158 3300035113 Ga0373936_0006903 Ga0373936_0006903_820_1698 286
159 3300035116 Ga0373945_0003063 Ga0373945_0003063_3776_4654 286
160 3300035116 Ga0373945_0043385 Ga0373945_0043385_315_1193 286
161 3300035170 Ga0373943_0004990 Ga0373943_0004990_3424_4302 286
162 3300035170 Ga0373943_0051025 Ga0373943_0051025_241_1119 286
163 3300035171 Ga0373946_0007353 Ga0373946_0007353_1591_2469 286
164 3300035172 Ga0373955_0017380 Ga0373955_0017380_684_1562 286
165 3300035410 Ga0373924_0005078 Ga0373924_0005078_2624_3502 286
166 3300042012 Ga0439455_0045277 Ga0439455_0045277_230_1111 286
167 3300042016 Ga0439463_018849 Ga0439463_018849_127_1008 286
168 3300046455 Ga0495603_0028351 Ga0495603_0028351_1479_2354 286
169 3300046455 Ga0495603_0051329 Ga0495603_0051329_377_1255 286
170 3300046459 Ga0495629_0010783 Ga0495629_0010783_70_948 286
171 3300046461 Ga0495641_0002361 Ga0495641_0002361_13631_14509 286
172 3300046463 Ga0495653_0149391 Ga0495653_0149391_177_1055 286
173 3300046472 Ga0495580_0078916 Ga0495580_0078916_540_1418 286
174 3300046473 Ga0495582_0009925 Ga0495582_0009925_4017_4895 286
175 3300046474 Ga0495605_0108133 Ga0495605_0108133_62_943 286
176 3300046475 Ga0495639_0000733 Ga0495639_0000733_13250_14128 286
177 3300046476 Ga0495662_0017160 Ga0495662_0017160_248_1126 286
178 3300046477 Ga0495664_0189543 Ga0495664_0189543_111_989 286
179 3300046499 Ga0495594_0007648 Ga0495594_0007648_1979_2857 286
180 3300046500 Ga0495596_0017860 Ga0495596_0017860_755_1687 286
181 3300046517 Ga0495630_0067880 Ga0495630_0067880_248_1126 286
182 3300046518 Ga0495631_0082720 Ga0495631_0082720_144_1076 286
183 3300046523 Ga0495644_0001644 Ga0495644_0001644_7219_8151 286
184 3300046523 Ga0495644_0040089 Ga0495644_0040089_549_1430 286
185 3300046525 Ga0495663_0023069 Ga0495663_0023069_759_1691 286
186 3300046526 Ga0495666_0067885 Ga0495666_0067885_472_1350 286
187 3300046531 Ga0495665_0004867 Ga0495665_0004867_3784_4662 286
188 3300046535 Ga0495586_0017466 Ga0495586_0017466_1197_2075 286
189 3300046537 Ga0495598_0000052 Ga0495598_0000052_2928_3860 286
190 3300046543 Ga0495645_0042596 Ga0495645_0042596_1118_1999 286
191 3300046558 Ga0495633_0030902 Ga0495633_0030902_379_1311 286
192 3300046559 Ga0495667_0052735 Ga0495667_0052735_289_1167 286
193 3300046615 Ga0495656_0001246 Ga0495656_0001246_3627_4559 286
194 3300046615 Ga0495656_0059750 Ga0495656_0059750_144_1025 286
195 3300046642 Ga0495634_0039572 Ga0495634_0039572_472_1350 286
196 3300046648 Ga0495611_0079116 Ga0495611_0079116_346_1227 286
197 3300046648 Ga0495611_0102795 Ga0495611_0102795_193_1125 286
198 3300046663 Ga0495635_0013998 Ga0495635_0013998_693_1571 286
199 3300046664 Ga0495659_0016713 Ga0495659_0016713_65_997 286
200 3300046665 Ga0495661_0066502 Ga0495661_0066502_404_1336 286
201 3300046674 Ga0495588_0005724 Ga0495588_0005724_1777_2655 286
202 3300046678 Ga0495599_0171911 Ga0495599_0171911_32_913 286
203 3300046683 Ga0495658_0011019 Ga0495658_0011019_824_1702 286
204 3300046684 Ga0495669_0030752 Ga0495669_0030752_424_1356 286
205 3300046689 Ga0495613_0179225 Ga0495613_0179225_534_1415 286
206 3300046690 Ga0495624_0198550 Ga0495624_0198550_134_1012 286
207 3300046691 Ga0495670_0002207 Ga0495670_0002207_1566_2498 286
208 3300047315 Ga0495581_0002019 Ga0495581_0002019_1136_2014 286
209 3300047318 Ga0495636_0058165 Ga0495636_0058165_659_1591 286
210 3300047319 Ga0495674_0023854 Ga0495674_0023854_3196_4074 286
211 3300047319 Ga0495674_0142154 Ga0495674_0142154_981_1859 286
212 3300047321 Ga0495676_0049389 Ga0495676_0049389_473_1351 286
213 3300047322 Ga0495680_0043241 Ga0495680_0043241_1136_2014 286
214 3300047471 Ga0495684_0072810 Ga0495684_0072810_1639_2517 286
215 3300047673 Ga0495593_0014261 Ga0495593_0014261_2222_3100 286
216 3300048089 Ga0495614_0015595 Ga0495614_0015595_749_1627 286
217 3300048903 Ga0496100_0024397 Ga0496100_0024397_1166_2044 286
218 3300048905 Ga0496102_0007042 Ga0496102_0007042_5645_6532 286
219 3300048906 Ga0496103_0026897 Ga0496103_0026897_1261_2148 286
220 3300048908 Ga0496105_0262291 Ga0496105_0262291_22_903 286
221 3300048909 Ga0496106_0003478 Ga0496106_0003478_388_1266 286
222 3300048909 Ga0496106_0049741 Ga0496106_0049741_2034_2918 286
223 3300048910 Ga0496107_0039431 Ga0496107_0039431_2247_3125 286
224 3300048911 Ga0496108_0005128 Ga0496108_0005128_1300_2184 286
225 3300048912 Ga0496109_0016706 Ga0496109_0016706_1111_1995 286
226 3300048914 Ga0496111_0070064 Ga0496111_0070064_328_1212 286
227 3300048914 Ga0496111_0074926 Ga0496111_0074926_1307_2185 286
228 3300048915 Ga0496112_0035622 Ga0496112_0035622_54_932 286
229 3300048915 Ga0496112_0039902 Ga0496112_0039902_2034_2918 286
230 3300048917 Ga0496114_0020083 Ga0496114_0020083_419_1297 286
231 3300050507 nmdc:mga05p37_6637_c1 nmdc:mga05p37_6637_c1_10385_11269 286
232 3300050512 nmdc:mga0n895_165979_c1 nmdc:mga0n895_165979_c1_577_1461 286
233 3300050512 nmdc:mga0n895_54228_c1 nmdc:mga0n895_54228_c1_1654_2538 286
234 3300050515 nmdc:mga0a205_49477_c1 nmdc:mga0a205_49477_c1_3090_3974 286
235 3300050515 nmdc:mga0a205_72765_c1 nmdc:mga0a205_72765_c1_519_1403 286
236 3300053153 Ga0500616_0006508 Ga0500616_0006508_1990_2871 286
237 iso_pu_bacteria 8025530807 8025533970 286
238 3300003203 JGI25406J46586_10003089 JGI25406J46586_100030897 287
239 3300005329 Ga0070683_100205595 Ga0070683_1002055952 287
240 3300005985 Ga0081539_10000911 Ga0081539_1000091149 287
241 3300031616 Ga0307508_10223179 Ga0307508_102231792 287
242 3300033179 Ga0307507_10019950 Ga0307507_100199506 287
243 3300046452 Ga0495617_025239 Ga0495617_025239_28_912 287
244 3300046454 Ga0495592_0001976 Ga0495592_0001976_6449_7369 287
245 3300046455 Ga0495603_0039953 Ga0495603_0039953_124_1023 287
246 3300046459 Ga0495629_0104830 Ga0495629_0104830_412_1332 287
247 3300046459 Ga0495629_0150621 Ga0495629_0150621_294_1193 287
248 3300046472 Ga0495580_0152466 Ga0495580_0152466_60_959 287
249 3300046473 Ga0495582_0011793 Ga0495582_0011793_3813_4733 287
250 3300046476 Ga0495662_0016944 Ga0495662_0016944_396_1316 287
251 3300046477 Ga0495664_0001427 Ga0495664_0001427_10406_11326 287
252 3300046499 Ga0495594_0028133 Ga0495594_0028133_346_1245 287
253 3300046516 Ga0495628_0088425 Ga0495628_0088425_626_1546 287
254 3300046517 Ga0495630_0002027 Ga0495630_0002027_4569_5489 287
255 3300046529 Ga0495652_0051068 Ga0495652_0051068_1591_2511 287
256 3300046533 Ga0495640_0048872 Ga0495640_0048872_656_1555 287
257 3300046535 Ga0495586_0039439 Ga0495586_0039439_172_1092 287
258 3300046536 Ga0495587_0041300 Ga0495587_0041300_427_1347 287
259 3300046543 Ga0495645_0042457 Ga0495645_0042457_495_1415 287
260 3300046557 Ga0495622_0007268 Ga0495622_0007268_2373_3272 287
261 3300046557 Ga0495622_0031828 Ga0495622_0031828_1142_2062 287
262 3300046642 Ga0495634_0000830 Ga0495634_0000830_9931_10851 287
263 3300046663 Ga0495635_0028412 Ga0495635_0028412_641_1561 287
264 3300046675 Ga0495657_0026392 Ga0495657_0026392_2188_3087 287
265 3300046675 Ga0495657_0052306 Ga0495657_0052306_1178_2098 287
266 3300046680 Ga0495646_0001039 Ga0495646_0001039_2185_3105 287
267 3300046683 Ga0495658_0038449 Ga0495658_0038449_1177_2097 287
268 3300046689 Ga0495613_0001710 Ga0495613_0001710_9955_10875 287
269 3300046689 Ga0495613_0027057 Ga0495613_0027057_1019_1918 287
270 3300046690 Ga0495624_0108518 Ga0495624_0108518_652_1551 287
271 3300046809 Ga0495600_0009296 Ga0495600_0009296_4332_5252 287
272 3300047315 Ga0495581_0011785 Ga0495581_0011785_3131_4030 287
273 3300047315 Ga0495581_0027925 Ga0495581_0027925_2181_3101 287
274 3300047317 Ga0495604_0006812 Ga0495604_0006812_788_1708 287
275 3300047321 Ga0495676_0019000 Ga0495676_0019000_181_1080 287
276 3300047321 Ga0495676_0022666 Ga0495676_0022666_2326_3246 287
277 3300047443 Ga0495687_017865 Ga0495687_017865_2506_3405 287
278 3300047444 Ga0495675_0038020 Ga0495675_0038020_1269_2189 287
279 3300047447 Ga0495685_041348 Ga0495685_041348_30_929 287
280 3300047471 Ga0495684_0097421 Ga0495684_0097421_438_1358 287
281 3300047673 Ga0495593_0016695 Ga0495593_0016695_286_1185 287
282 3300048088 Ga0495602_0005106 Ga0495602_0005106_6628_7548 287
283 3300048089 Ga0495614_0014852 Ga0495614_0014852_2057_2977 287
284 3300048089 Ga0495614_0053236 Ga0495614_0053236_709_1608 287
285 3300053085 Ga0495619_0120863 Ga0495619_0120863_813_1733 287
286 3300053095 Ga0500640_045520 Ga0500640_045520_944_1864 287
287 iso_pu_bacteria 2547132111 2547405611 287
288 iso_pu_bacteria 2616644814 2616703189 287
289 iso_pu_bacteria 2862290372 2862293650 287
290 iso_pu_bacteria 2862507626 2862508806 287
291 iso_pu_bacteria 3006493962 3006497599 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

55

280

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tdw-assembly1.cif.gz_A the gdp complex of the aminoglycoside 2'-phosphotransfere-iiia f108l mutant 0.8176 9 286
3tdw-assembly1.cif.gz_A the gdp complex of the aminoglycoside 2'-phosphotransfere-iiia f108l mutant 0.7918 9 286
6ctz-assembly1.cif.gz_A "structure of the gdp and kanamycin complex of aph(2"")-iiia" 0.7902 13 286
3tdv-assembly2.cif.gz_B structure of the gdp complex of wild-type aminoglycoside 2'-phosphotransferase-iiia 0.7715 13 286
6ctz-assembly1.cif.gz_A "structure of the gdp and kanamycin complex of aph(2"")-iiia" 0.7554 13 286
ID Description Score Start End Superfamily
af_O05841_280_430_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9719 104 251 3.90.1200.10
af_O05841_187_276_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9647 13 100 3.30.200.20
af_O05841_280_430_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9468 104 251 3.90.1200.10
af_O05841_187_276_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9338 13 100 3.30.200.20
3tdvA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9054 7 105 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A2D9QTI5-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.985 162 287
AF-A0A212SWF6-F1-model_v4 Predicted kinase, aminoglycoside phosphotransferase (APT) family 0.9843 8 285 GO:0016301
AF-A0A1Q5HXD2-F1-model_v4 Phosphotransferase 0.9837 7 285 GO:0016301
AF-A0A329BVI1-F1-model_v4 deleted 0.9816 118 287
AF-A0A6B3GQ75-F1-model_v4 Phosphotransferase 0.9805 149 286 GO:0016301

Feature Viewer

pLDDT pTM Quality
93.18 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map