F390212

General Info

Members Datasets Scaffolds Average Seq Length
291 161 582 498

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100004802|Ga0070708_1000048027
Length 548
Sequence MNEGNFKTNANEGSGMFHAEHNNYRRAFWIAVTATIVLALIASLLWWRLSHAGTPSQAGNSSTSQPMEAMPSSGNMSGSESTSLGDTEVPLAPIQLTPQRMQSIGIVLGKVESKAVNSELRFYGNVQVDERRQAYVQTRFAGWIRKVYADATGNFIGKGQPLFTIYSPDLVATEQEYLLAKKNSESLQQSEVSGVASGASSLFGAAKERLLQWEVSPAEIEKLDQTGKAITDLTVHSPVSGYITQKNALPNMYVQPETMLYTVADLSDVWVVAQVFQSDTGKIKPGDPAEVTVDAYPGRVFNGRVDYILLQLDMNTRTLPVRLVFSNPGLKLRPGMYVNVRAKVPLGRQLVIPASAAFHSGTKNLVFVYRGEGNIEPREVELGPQVGNEIVVTQGVKASEEIVTSANFLIDSEAQLQAAAGAFVPXXXGAGQAAFMNAPAREQANVELTTDPNPPHKGSNTVRVKLTGQDGNPITGANVTVTFFMPAMPAMGMSAMKTVINFADKGGGIYEGKGDLGSGGTWQVTIRAQQNGRTIATKQFTLNATGGM

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.15
Rhizosphere 94.5
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100004802 3300005445 Bacteria 10662
2 rootL2_10073842 3300003322 Bacteria 5346
3 Ga0070683_100003242 3300005329 Bacteria 13141
4 Ga0070680_100002627 3300005336 Bacteria 13311
5 Ga0070680_100163266 3300005336 Bacteria 1872
6 Ga0068868_100020355 3300005338 Bacteria 4983
7 Ga0070709_10000286 3300005434 Bacteria 32137
8 Ga0070713_100010014 3300005436 Bacteria 6831
9 Ga0070713_100017113 3300005436 Bacteria 5472
10 Ga0070713_100044679 3300005436 Bacteria 3627
11 Ga0070708_100005018 3300005445 Bacteria 10469
12 Ga0070708_100006505 3300005445 Bacteria 9296
13 Ga0070708_100028831 3300005445 Bacteria 4780
14 Ga0070708_100034659 3300005445 Bacteria 4393
15 Ga0070708_100054744 3300005445 Bacteria 3545
16 Ga0070681_10003023 3300005458 Bacteria 15596
17 Ga0070706_100005784 3300005467 Bacteria 11748
18 Ga0070706_100006878 3300005467 Bacteria 10736
19 Ga0070706_100010458 3300005467 Bacteria 8611
20 Ga0070706_100028121 3300005467 Bacteria 5175
21 Ga0070706_100092935 3300005467 Unclassified 2799
22 Ga0070706_100123012 3300005467 Bacteria 2419
23 Ga0070707_100000774 3300005468 Bacteria 31590
24 Ga0070707_100007183 3300005468 Bacteria 10331
25 Ga0070707_100011301 3300005468 Bacteria 8322
26 Ga0070698_100001390 3300005471 Bacteria 26820
27 Ga0070698_100008825 3300005471 Bacteria 10844
28 Ga0070698_100012811 3300005471 Bacteria 8881
29 Ga0070698_100021869 3300005471 Bacteria 6697
30 Ga0070698_100024222 3300005471 Bacteria 6333
31 Ga0070698_100025537 3300005471 Bacteria 6158
32 Ga0070698_100152918 3300005471 Bacteria 2254
33 Ga0070699_100001528 3300005518 Bacteria 21160
34 Ga0070699_100019352 3300005518 Bacteria 5860
35 Ga0070699_100037270 3300005518 Bacteria 4207
36 Ga0070679_100024684 3300005530 Bacteria 5891
37 Ga0070679_100047019 3300005530 Bacteria 4302
38 Ga0070697_100000527 3300005536 Bacteria 28763
39 Ga0070697_100000827 3300005536 Bacteria 23222
40 Ga0070697_100001797 3300005536 Bacteria 16375
41 Ga0070697_100005660 3300005536 Bacteria 9620
42 Ga0070697_100015573 3300005536 Bacteria 5971
43 Ga0070697_100053581 3300005536 Bacteria 3278
44 Ga0070697_100101147 3300005536 Bacteria 2395
45 Ga0068853_100014480 3300005539 Bacteria 6460
46 Ga0068853_100060477 3300005539 Bacteria 3273
47 Ga0070704_100171865 3300005549 Bacteria 1724
48 Ga0068855_100000518 3300005563 Bacteria 47531
49 Ga0068855_100002581 3300005563 Bacteria 22323
50 Ga0068855_100014556 3300005563 Bacteria 9476
51 Ga0068855_100014750 3300005563 Bacteria 9415
52 Ga0068855_100084230 3300005563 Bacteria 3682
53 Ga0068855_100154009 3300005563 Bacteria 2612
54 Ga0068857_100006486 3300005577 Bacteria 10035
55 Ga0068856_100000323 3300005614 Bacteria 52568
56 Ga0068856_100002189 3300005614 Bacteria 20283
57 Ga0068856_100005181 3300005614 Bacteria 12869
58 Ga0068852_100002365 3300005616 Bacteria 12998
59 Ga0068859_100108596 3300005617 Bacteria 2836
60 Ga0068864_100004801 3300005618 Bacteria 11074
61 Ga0068866_10041145 3300005718 Unclassified 2291
62 Ga0068863_100019873 3300005841 Bacteria 6425
63 Ga0068858_100013973 3300005842 Bacteria 7574
64 Ga0068858_100105789 3300005842 Bacteria 2626
65 Ga0068860_100099731 3300005843 Bacteria 2770
66 Ga0068860_100146629 3300005843 Bacteria 2271
67 Ga0070717_10007490 3300006028 Bacteria 8108
68 Ga0070717_10010787 3300006028 Bacteria 6914
69 Ga0070716_100003958 3300006173 Bacteria 7030
70 Ga0070716_100013039 3300006173 Bacteria 4227
71 Ga0070716_100060150 3300006173 Bacteria 2193
72 Ga0070712_100000652 3300006175 Bacteria 20427
73 Ga0070712_100188553 3300006175 Bacteria 1612
74 Ga0097621_100000325 3300006237 Bacteria 32304
75 Ga0097621_100000893 3300006237 Bacteria 20904
76 Ga0068871_100000140 3300006358 Bacteria 46678
77 Ga0068871_100000963 3300006358 Bacteria 19249
78 Ga0068871_100001216 3300006358 Bacteria 17176
79 Ga0068871_100088591 3300006358 Bacteria 2575
80 Ga0075434_100016480 3300006871 Bacteria 7104
81 Ga0075434_100018781 3300006871 Bacteria 6684
82 Ga0075434_100042801 3300006871 Bacteria 4491
83 Ga0068865_100006432 3300006881 Bacteria 7165
84 Ga0075436_100001515 3300006914 Bacteria 15851
85 Ga0097620_100108596 3300006931 Bacteria 2836
86 Ga0075435_100013415 3300007076 Bacteria 6096
87 Ga0099794_10001903 3300007265 Bacteria 7487
88 Ga0099794_10001981 3300007265 Bacteria 7383
89 Ga0099794_10008992 3300007265 Plasmid 4170
90 Ga0099794_10016277 3300007265 Unclassified 3293
91 Ga0099795_10006548 3300007788 Unclassified 3186
92 Ga0099795_10017137 3300007788 Unclassified 2305
93 Ga0105240_10018128 3300009093 Bacteria 9465
94 Ga0105240_10021799 3300009093 Bacteria 8513
95 Ga0105240_10033630 3300009093 Bacteria 6620
96 Ga0105240_10037038 3300009093 Bacteria 6270
97 Ga0105240_10082378 3300009093 Bacteria 3952
98 Ga0105240_10230386 3300009093 Bacteria 2153
99 Ga0105240_10377135 3300009093 Unclassified 1602
100 Ga0105245_10002438 3300009098 Bacteria 16829
101 Ga0105247_10006218 3300009101 Bacteria 7407
102 Ga0105241_10010281 3300009174 Bacteria 6873
103 Ga0105242_10006164 3300009176 Bacteria 9237
104 Ga0105248_10003204 3300009177 Bacteria 18149
105 Ga0105248_10012589 3300009177 Bacteria 9333
106 Ga0105248_10161579 3300009177 Bacteria 2526
107 Ga0105237_10032193 3300009545 Bacteria 5310
108 Ga0105237_10064406 3300009545 Bacteria 3662
109 Ga0105238_10002385 3300009551 Bacteria 18840
110 Ga0105239_10005929 3300010375 Bacteria 14221
111 Ga0105239_10055232 3300010375 Bacteria 4355
112 Ga0105239_10056430 3300010375 Bacteria 4308
113 Ga0105239_10211066 3300010375 Unclassified 2176
114 Ga0105239_10325014 3300010375 Bacteria 1735
115 Ga0157373_10039082 3300013100 Bacteria 3398
116 Ga0157371_10011015 3300013102 Bacteria 7005
117 Ga0157370_10003495 3300013104 Bacteria 18421
118 Ga0157370_10012600 3300013104 Bacteria 8763
119 Ga0157370_10183031 3300013104 Bacteria 1946
120 Ga0157369_10000569 3300013105 Bacteria 48601
121 Ga0157369_10006811 3300013105 Bacteria 13179
122 Ga0157369_10014969 3300013105 Bacteria 8754
123 Ga0157369_10076364 3300013105 Bacteria 3591
124 Ga0157369_10266489 3300013105 Bacteria 1786
125 Ga0157374_10000284 3300013296 Bacteria 46945
126 Ga0157374_10004857 3300013296 Bacteria 11283
127 Ga0157374_10019617 3300013296 Bacteria 5986
128 Ga0157374_10022792 3300013296 Bacteria 5592
129 Ga0157374_10055275 3300013296 Bacteria 3704
130 Ga0157378_10000968 3300013297 Bacteria 26320
131 Ga0157378_10003935 3300013297 Bacteria 13144
132 Ga0157378_10012485 3300013297 Bacteria 7438
133 Ga0157378_10017543 3300013297 Bacteria 6283
134 Ga0157372_10000265 3300013307 Bacteria 58016
135 Ga0157372_10001824 3300013307 Bacteria 23103
136 Ga0157372_10004204 3300013307 Bacteria 15413
137 Ga0157375_10013249 3300013308 Bacteria 7331
138 Ga0157375_10107016 3300013308 Bacteria 2889
139 Ga0157379_10013402 3300014968 Bacteria 7181
140 Ga0157376_10002305 3300014969 Bacteria 12892
141 Ga0228598_1001257 3300024227 Bacteria 5573
142 Ga0228598_1001996 3300024227 Bacteria 4460
143 Ga0228598_1002829 3300024227 Bacteria 3764
144 Ga0207642_10028592 3300025899 Unclassified 2298
145 Ga0207647_10005711 3300025904 Bacteria 9083
146 Ga0207699_10000121 3300025906 Bacteria 55187
147 Ga0207699_10003889 3300025906 Bacteria 7134
148 Ga0207699_10046006 3300025906 Bacteria 2550
149 Ga0207684_10000307 3300025910 Bacteria 69402
150 Ga0207684_10001064 3300025910 Bacteria 30762
151 Ga0207684_10002245 3300025910 Bacteria 19691
152 Ga0207684_10005049 3300025910 Bacteria 12297
153 Ga0207684_10007914 3300025910 Bacteria 9499
154 Ga0207654_10060100 3300025911 Bacteria 2219
155 Ga0207707_10001573 3300025912 Bacteria 21019
156 Ga0207695_10006818 3300025913 Bacteria 14715
157 Ga0207695_10013323 3300025913 Bacteria 9811
158 Ga0207695_10109812 3300025913 Bacteria 2739
159 Ga0207695_10131703 3300025913 Bacteria 2458
160 Ga0207693_10015678 3300025915 Bacteria 6074
161 Ga0207663_10001528 3300025916 Bacteria 10827
162 Ga0207660_10005595 3300025917 Bacteria 8158
163 Ga0207652_10000995 3300025921 Bacteria 26201
164 Ga0207646_10000666 3300025922 Bacteria 44524
165 Ga0207646_10002928 3300025922 Bacteria 19795
166 Ga0207646_10003282 3300025922 Bacteria 18431
167 Ga0207646_10169888 3300025922 Bacteria 1969
168 Ga0207694_10000485 3300025924 Bacteria 36137
169 Ga0207687_10009843 3300025927 Bacteria 6258
170 Ga0207700_10006797 3300025928 Bacteria 6950
171 Ga0207700_10013889 3300025928 Bacteria 5260
172 Ga0207700_10038192 3300025928 Bacteria 3484
173 Ga0207664_10057390 3300025929 Bacteria 3094
174 Ga0207665_10041926 3300025939 Bacteria 3058
175 Ga0207711_10012728 3300025941 Bacteria 6987
176 Ga0207689_10010852 3300025942 Bacteria 7836
177 Ga0207661_10003914 3300025944 Bacteria 10396
178 Ga0207667_10001624 3300025949 Bacteria 28284
179 Ga0207667_10035460 3300025949 Bacteria 5351
180 Ga0207667_10115662 3300025949 Bacteria 2764
181 Ga0207640_10096874 3300025981 Unclassified 2058
182 Ga0207703_10005436 3300026035 Bacteria 10253
183 Ga0207639_10010329 3300026041 Bacteria 6464
184 Ga0207702_10000354 3300026078 Bacteria 52521
185 Ga0207702_10002651 3300026078 Bacteria 16796
186 Ga0207641_10021188 3300026088 Bacteria 5343
187 Ga0207676_10014496 3300026095 Bacteria 5673
188 Ga0207674_10003732 3300026116 Bacteria 18591
189 Ga0209588_1004560 3300027671 Unclassified 3916
190 Ga0268264_10155004 3300028381 Unclassified 2058
191 Ga0265336_10014056 3300028666 Unclassified 2658
192 Ga0265338_10011731 3300028800 Bacteria 10084
193 Ga0265338_10014688 3300028800 Bacteria 8679
194 Ga0265338_10016816 3300028800 Bacteria 7923
195 Ga0265338_10116124 3300028800 Bacteria 2144
196 Ga0265760_10001184 3300031090 Bacteria 7627
197 Ga0265330_10000740 3300031235 Bacteria 20625
198 Ga0265332_10005479 3300031238 Bacteria 5852
199 Ga0265325_10000037 3300031241 Bacteria 93463
200 Ga0265340_10001155 3300031247 Bacteria 15095
201 Ga0265339_10001029 3300031249 Bacteria 21250
202 Ga0265339_10014309 3300031249 Unclassified 4784
203 Ga0265339_10066473 3300031249 Bacteria 1930
204 Ga0265316_10011498 3300031344 Bacteria 7975
205 Ga0265316_10023929 3300031344 Bacteria 5129
206 Ga0265316_10073042 3300031344 Bacteria 2642
207 Ga0265313_10001365 3300031595 Bacteria 22954
208 Ga0265314_10000249 3300031711 Bacteria 79187
209 Ga0265314_10001698 3300031711 Bacteria 23924
210 Ga0265314_10004287 3300031711 Bacteria 13322
211 Ga0265342_10000302 3300031712 Bacteria 56104
212 Ga0373926_0006985 3300035083 Bacteria 3753
213 Ga0373944_0020709 3300035089 Bacteria 1897
214 Ga0373923_0070888 3300035111 Bacteria 1496
215 Ga0373936_0054935 3300035113 Unclassified 1616
216 Ga0373956_0018893 3300035119 Bacteria 2920
217 Ga0373943_0004351 3300035170 Bacteria 6426
218 Ga0373943_0112148 3300035170 Bacteria 1439
219 Ga0373946_0002696 3300035171 Bacteria 6281
220 Ga0373924_0000007 3300035410 Bacteria 54976
221 Ga0373924_0000033 3300035410 Bacteria 35461
222 Ga0373935_0004294 3300035692 Bacteria 8361
223 Ga0373927_0006398 3300035695 Bacteria 8023
224 Ga0373927_0016987 3300035695 Bacteria 4795
225 Ga0373947_0035661 3300035725 Bacteria 2946
226 Ga0373937_0000026 3300036401 Bacteria 124071
227 Ga0373925_0020015 3300037068 Bacteria 4869
228 Ga0373925_0020298 3300037068 Bacteria 4835
229 Ga0373925_0047263 3300037068 Bacteria 3203
230 Ga0395898_0036163 3300037466 Bacteria 4905
231 Ga0453683_0099437 3300044673 Bacteria 1826
232 Ga0451576_0024435 3300045051 Bacteria 6527
233 Ga0451576_0340405 3300045051 Bacteria 1570
234 Ga0495580_0024314 3300046472 Bacteria 4438
235 Ga0495580_0085524 3300046472 Bacteria 2196
236 Ga0495580_0097283 3300046472 Bacteria 2047
237 Ga0495582_0014185 3300046473 Bacteria 4385
238 Ga0495628_0045554 3300046516 Unclassified 3487
239 Ga0495630_0005064 3300046517 Bacteria 9271
240 Ga0495665_0006576 3300046531 Bacteria 6278
241 Ga0495635_0044808 3300046663 Bacteria 3051
242 Ga0495658_0040909 3300046683 Bacteria 2579
243 Ga0495613_0040263 3300046689 Bacteria 3463
244 Ga0495624_0097928 3300046690 Bacteria 1807
245 Ga0496100_0040116 3300048903 Bacteria 2977
246 Ga0496102_0002056 3300048905 Bacteria 17344
247 Ga0496102_0052126 3300048905 Bacteria 3727
248 Ga0496103_0008085 3300048906 Bacteria 6246
249 Ga0496103_0030752 3300048906 Bacteria 3269
250 Ga0496104_0035147 3300048907 Bacteria 4678
251 Ga0496104_0231498 3300048907 Bacteria 1760
252 Ga0496105_0133228 3300048908 Bacteria 2048
253 Ga0496110_0014303 3300048913 Bacteria 6585
254 Ga0496111_0002034 3300048914 Bacteria 12036
255 Ga0496112_0010106 3300048915 Bacteria 8544
256 Ga0496112_0101886 3300048915 Bacteria 2841
257 Ga0496112_0139097 3300048915 Bacteria 2397
258 Ga0496113_0000145 3300048916 Bacteria 30751
259 Ga0496115_0029583 3300048918 Bacteria 4303
260 Ga0501031_0022611 3300049568 Bacteria 4097
261 Ga0501032_0004869 3300049569 Bacteria 10049
262 Ga0501033_0002876 3300049570 Bacteria 14423
263 Ga0501034_0006850 3300049571 Bacteria 12193
264 Ga0501036_0002999 3300049572 Bacteria 13429
265 Ga0501036_0158652 3300049572 Bacteria 1908
266 Ga0501037_0003751 3300049573 Bacteria 11027
267 Ga0501042_0006370 3300049578 Bacteria 7652
268 Ga0501043_0003239 3300049579 Bacteria 13442
269 Ga0501043_0096651 3300049579 Bacteria 2322
270 Ga0501046_0005720 3300049580 Bacteria 11093
271 Ga0501047_0005069 3300049581 Bacteria 12361
272 Ga0501047_0030635 3300049581 Bacteria 5186
273 Ga0501048_0002129 3300049582 Bacteria 15100
274 Ga0501067_0019071 3300049583 Bacteria 3796
275 Ga0501069_0021854 3300049585 Bacteria 3475
276 Ga0501070_0003874 3300049586 Bacteria 12907
277 Ga0501073_0002451 3300049589 Bacteria 13855
278 Ga0501074_0002034 3300049590 Bacteria 13960
279 Ga0501079_0001769 3300049741 Bacteria 15409
280 Ga0501080_0009288 3300049742 Bacteria 8966
281 Ga0501083_0002940 3300049744 Bacteria 11799
282 Ga0501035_0000826 3300049822 Bacteria 33043
283 Ga0501035_0057392 3300049822 Bacteria 3471
284 Ga0501044_0004852 3300049823 Bacteria 15037
285 Ga0501044_0157947 3300049823 Bacteria 2246
286 Ga0501045_0068218 3300049824 Bacteria 2612
287 nmdc:mga0n895_20538_c1 3300050512 Bacteria 6161
288 nmdc:mga0n895_41605_c1 3300050512 Bacteria 4468
289 nmdc:mga08x19_713_c1 3300050514 Bacteria 21268
290 Ga0501084_0004068 3300054114 Bacteria 11912
291 Ga0501082_0002539 3300060353 Bacteria 15986
292 Ga0070708_100004802
293 rootL2_10073842
294 Ga0070683_100003242
295 Ga0070680_100002627
296 Ga0070680_100163266
297 Ga0068868_100020355
298 Ga0070709_10000286
299 Ga0070713_100010014
300 Ga0070713_100017113
301 Ga0070713_100044679
302 Ga0070708_100005018
303 Ga0070708_100006505
304 Ga0070708_100028831
305 Ga0070708_100034659
306 Ga0070708_100054744
307 Ga0070681_10003023
308 Ga0070706_100005784
309 Ga0070706_100006878
310 Ga0070706_100010458
311 Ga0070706_100028121
312 Ga0070706_100092935
313 Ga0070706_100123012
314 Ga0070707_100000774
315 Ga0070707_100007183
316 Ga0070707_100011301
317 Ga0070698_100001390
318 Ga0070698_100008825
319 Ga0070698_100012811
320 Ga0070698_100021869
321 Ga0070698_100024222
322 Ga0070698_100025537
323 Ga0070698_100152918
324 Ga0070699_100001528
325 Ga0070699_100019352
326 Ga0070699_100037270
327 Ga0070679_100024684
328 Ga0070679_100047019
329 Ga0070697_100000527
330 Ga0070697_100000827
331 Ga0070697_100001797
332 Ga0070697_100005660
333 Ga0070697_100015573
334 Ga0070697_100053581
335 Ga0070697_100101147
336 Ga0068853_100014480
337 Ga0068853_100060477
338 Ga0070704_100171865
339 Ga0068855_100000518
340 Ga0068855_100002581
341 Ga0068855_100014556
342 Ga0068855_100014750
343 Ga0068855_100084230
344 Ga0068855_100154009
345 Ga0068857_100006486
346 Ga0068856_100000323
347 Ga0068856_100002189
348 Ga0068856_100005181
349 Ga0068852_100002365
350 Ga0068859_100108596
351 Ga0068864_100004801
352 Ga0068866_10041145
353 Ga0068863_100019873
354 Ga0068858_100013973
355 Ga0068858_100105789
356 Ga0068860_100099731
357 Ga0068860_100146629
358 Ga0070717_10007490
359 Ga0070717_10010787
360 Ga0070716_100003958
361 Ga0070716_100013039
362 Ga0070716_100060150
363 Ga0070712_100000652
364 Ga0070712_100188553
365 Ga0097621_100000325
366 Ga0097621_100000893
367 Ga0068871_100000140
368 Ga0068871_100000963
369 Ga0068871_100001216
370 Ga0068871_100088591
371 Ga0075434_100016480
372 Ga0075434_100018781
373 Ga0075434_100042801
374 Ga0068865_100006432
375 Ga0075436_100001515
376 Ga0097620_100108596
377 Ga0075435_100013415
378 Ga0099794_10001903
379 Ga0099794_10001981
380 Ga0099794_10008992
381 Ga0099794_10016277
382 Ga0099795_10006548
383 Ga0099795_10017137
384 Ga0105240_10018128
385 Ga0105240_10021799
386 Ga0105240_10033630
387 Ga0105240_10037038
388 Ga0105240_10082378
389 Ga0105240_10230386
390 Ga0105240_10377135
391 Ga0105245_10002438
392 Ga0105247_10006218
393 Ga0105241_10010281
394 Ga0105242_10006164
395 Ga0105248_10003204
396 Ga0105248_10012589
397 Ga0105248_10161579
398 Ga0105237_10032193
399 Ga0105237_10064406
400 Ga0105238_10002385
401 Ga0105239_10005929
402 Ga0105239_10055232
403 Ga0105239_10056430
404 Ga0105239_10211066
405 Ga0105239_10325014
406 Ga0157373_10039082
407 Ga0157371_10011015
408 Ga0157370_10003495
409 Ga0157370_10012600
410 Ga0157370_10183031
411 Ga0157369_10000569
412 Ga0157369_10006811
413 Ga0157369_10014969
414 Ga0157369_10076364
415 Ga0157369_10266489
416 Ga0157374_10000284
417 Ga0157374_10004857
418 Ga0157374_10019617
419 Ga0157374_10022792
420 Ga0157374_10055275
421 Ga0157378_10000968
422 Ga0157378_10003935
423 Ga0157378_10012485
424 Ga0157378_10017543
425 Ga0157372_10000265
426 Ga0157372_10001824
427 Ga0157372_10004204
428 Ga0157375_10013249
429 Ga0157375_10107016
430 Ga0157379_10013402
431 Ga0157376_10002305
432 Ga0228598_1001257
433 Ga0228598_1001996
434 Ga0228598_1002829
435 Ga0207642_10028592
436 Ga0207647_10005711
437 Ga0207699_10000121
438 Ga0207699_10003889
439 Ga0207699_10046006
440 Ga0207684_10000307
441 Ga0207684_10001064
442 Ga0207684_10002245
443 Ga0207684_10005049
444 Ga0207684_10007914
445 Ga0207654_10060100
446 Ga0207707_10001573
447 Ga0207695_10006818
448 Ga0207695_10013323
449 Ga0207695_10109812
450 Ga0207695_10131703
451 Ga0207693_10015678
452 Ga0207663_10001528
453 Ga0207660_10005595
454 Ga0207652_10000995
455 Ga0207646_10000666
456 Ga0207646_10002928
457 Ga0207646_10003282
458 Ga0207646_10169888
459 Ga0207694_10000485
460 Ga0207687_10009843
461 Ga0207700_10006797
462 Ga0207700_10013889
463 Ga0207700_10038192
464 Ga0207664_10057390
465 Ga0207665_10041926
466 Ga0207711_10012728
467 Ga0207689_10010852
468 Ga0207661_10003914
469 Ga0207667_10001624
470 Ga0207667_10035460
471 Ga0207667_10115662
472 Ga0207640_10096874
473 Ga0207703_10005436
474 Ga0207639_10010329
475 Ga0207702_10000354
476 Ga0207702_10002651
477 Ga0207641_10021188
478 Ga0207676_10014496
479 Ga0207674_10003732
480 Ga0209588_1004560
481 Ga0268264_10155004
482 Ga0265336_10014056
483 Ga0265338_10011731
484 Ga0265338_10014688
485 Ga0265338_10016816
486 Ga0265338_10116124
487 Ga0265760_10001184
488 Ga0265330_10000740
489 Ga0265332_10005479
490 Ga0265325_10000037
491 Ga0265340_10001155
492 Ga0265339_10001029
493 Ga0265339_10014309
494 Ga0265339_10066473
495 Ga0265316_10011498
496 Ga0265316_10023929
497 Ga0265316_10073042
498 Ga0265313_10001365
499 Ga0265314_10000249
500 Ga0265314_10001698
501 Ga0265314_10004287
502 Ga0265342_10000302
503 Ga0373926_0006985
504 Ga0373944_0020709
505 Ga0373923_0070888
506 Ga0373936_0054935
507 Ga0373956_0018893
508 Ga0373943_0004351
509 Ga0373943_0112148
510 Ga0373946_0002696
511 Ga0373924_0000007
512 Ga0373924_0000033
513 Ga0373935_0004294
514 Ga0373927_0006398
515 Ga0373927_0016987
516 Ga0373947_0035661
517 Ga0373937_0000026
518 Ga0373925_0020015
519 Ga0373925_0020298
520 Ga0373925_0047263
521 Ga0395898_0036163
522 Ga0453683_0099437
523 Ga0451576_0024435
524 Ga0451576_0340405
525 Ga0495580_0024314
526 Ga0495580_0085524
527 Ga0495580_0097283
528 Ga0495582_0014185
529 Ga0495628_0045554
530 Ga0495630_0005064
531 Ga0495665_0006576
532 Ga0495635_0044808
533 Ga0495658_0040909
534 Ga0495613_0040263
535 Ga0495624_0097928
536 Ga0496100_0040116
537 Ga0496102_0002056
538 Ga0496102_0052126
539 Ga0496103_0008085
540 Ga0496103_0030752
541 Ga0496104_0035147
542 Ga0496104_0231498
543 Ga0496105_0133228
544 Ga0496110_0014303
545 Ga0496111_0002034
546 Ga0496112_0010106
547 Ga0496112_0101886
548 Ga0496112_0139097
549 Ga0496113_0000145
550 Ga0496115_0029583
551 Ga0501031_0022611
552 Ga0501032_0004869
553 Ga0501033_0002876
554 Ga0501034_0006850
555 Ga0501036_0002999
556 Ga0501036_0158652
557 Ga0501037_0003751
558 Ga0501042_0006370
559 Ga0501043_0003239
560 Ga0501043_0096651
561 Ga0501046_0005720
562 Ga0501047_0005069
563 Ga0501047_0030635
564 Ga0501048_0002129
565 Ga0501067_0019071
566 Ga0501069_0021854
567 Ga0501070_0003874
568 Ga0501073_0002451
569 Ga0501074_0002034
570 Ga0501079_0001769
571 Ga0501080_0009288
572 Ga0501083_0002940
573 Ga0501035_0000826
574 Ga0501035_0057392
575 Ga0501044_0004852
576 Ga0501044_0157947
577 Ga0501045_0068218
578 nmdc:mga0n895_20538_c1
579 nmdc:mga0n895_41605_c1
580 nmdc:mga08x19_713_c1
581 Ga0501084_0004068
582 Ga0501082_0002539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

115

338

0.99

PF13437

HlyD_3

HlyD family secretion protein

234

335

0.98

PF13115

YtkA

YtkA-like

440

527

0.92

PF00529

CusB_dom_1

Cation efflux system protein CusB domain 1

39

404

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n6r-assembly1.cif.gz_K crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) 0.9445 113 240
3n6r-assembly1.cif.gz_E crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) 0.9435 113 240
5ks8-assembly1.cif.gz_F crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.9291 114 240
5ks8-assembly1.cif.gz_D crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.9261 114 240
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.9226 113 241
ID Description Score Start End Superfamily
3n6rA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9457 112 238 2.40.50.100
3n6rK05 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9445 113 240 2.40.50.100
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9361 114 241 2.40.50.100
3lnnA01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9333 325 380 2.40.420.20
af_Q91ZA3_659_724_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.93 116 240 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2V7YJL2-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8653 108 397 GO:0015679
GO:0016020
GO:0022857
GO:0030288
GO:0046914
GO:0060003
AF-A0A2V7YJL2-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8511 108 397 GO:0015679
GO:0016020
GO:0022857
GO:0030288
GO:0046914
GO:0060003
AF-A0A519EJP9-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.8458 245 385 GO:0015562
GO:1990281
AF-A0A1F5AQ82-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.838 56 397 GO:0015679
GO:0030288
GO:0046914
GO:0060003
AF-A0A7U4RRI1-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8356 80 394 GO:0015679
GO:0030288
GO:0046914
GO:0060003

Map