F390137

General Info

Members Datasets Scaffolds Average Seq Length
291 202 582 175

Family's Representative Sequence

Representative Sequence 3300004799|Ga0058863_11285541|Ga0058863_112855412
Length 192
Sequence VQKRISKKSQILTNNKRGIMKRQVFSSLIAVTTFAFFLSYGSAQKSVTVEVKNGQGESVGTATIRPSGSGVSIKLDLKNLPPGEHAIHIHQMAKCEGPTFQTAGAHFNPDSKEHGLKNPKGPHAGDMLNFMVSAKGTATATVTDSRVNLGSGSNSLFANGGTSLVIHAKADDMKTDPSGNSGDRIACGLITQ

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
162 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
163 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
172 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
173 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
174 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
175 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
176 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
177 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
178 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
179 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
182 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
183 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
190 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
193 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 4.81
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 32.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11285541 3300004799 Unclassified 1202
2 CNAas_1001588 3300000532 Bacteria 1866
3 JGI25406J46586_10009156 3300003203 Unclassified 4442
4 Ga0058861_10584226 3300004800 Bacteria 2284
5 Ga0058862_12128191 3300004803 Unclassified 1397
6 Ga0070670_100053182 3300005331 Bacteria 3477
7 Ga0070670_100063998 3300005331 Bacteria 3156
8 Ga0068869_100721637 3300005334 Bacteria 851
9 Ga0070666_10601641 3300005335 Unclassified 802
10 Ga0070680_100000684 3300005336 Bacteria 23493
11 Ga0070660_100442870 3300005339 Bacteria 1077
12 Ga0070692_10194883 3300005345 Unclassified 1183
13 Ga0070692_10331594 3300005345 Bacteria 939
14 Ga0070671_100025276 3300005355 Unclassified 4872
15 Ga0070674_101055744 3300005356 Bacteria 715
16 Ga0070673_100022001 3300005364 Unclassified 4634
17 Ga0070659_100065157 3300005366 Unclassified 2885
18 Ga0070667_100526607 3300005367 Unclassified 1085
19 Ga0070703_10000105 3300005406 Bacteria 43523
20 Ga0070701_10170110 3300005438 Bacteria 1268
21 Ga0070700_100000036 3300005441 Bacteria 111099
22 Ga0070694_100063242 3300005444 Bacteria 2530
23 Ga0070708_100965000 3300005445 Unclassified 800
24 Ga0070678_100044678 3300005456 Bacteria 3165
25 Ga0070662_100175412 3300005457 Bacteria 1686
26 Ga0070681_10000339 3300005458 Bacteria 38031
27 Ga0068867_100763430 3300005459 Bacteria 859
28 Ga0070685_10407424 3300005466 Bacteria 943
29 Ga0070706_100684969 3300005467 Bacteria 951
30 Ga0070707_100136280 3300005468 Bacteria 2388
31 Ga0070698_100082094 3300005471 Bacteria 3216
32 Ga0070699_100372835 3300005518 Unclassified 1288
33 Ga0070699_100621217 3300005518 Unclassified 986
34 Ga0070679_100000102 3300005530 Bacteria 66094
35 Ga0070697_100154076 3300005536 Bacteria 1939
36 Ga0070697_101093126 3300005536 Unclassified 710
37 Ga0068853_100130761 3300005539 Bacteria 2247
38 Ga0070672_100930075 3300005543 Bacteria 769
39 Ga0070686_100737232 3300005544 Bacteria 789
40 Ga0070695_100204783 3300005545 Bacteria 1412
41 Ga0070695_100299637 3300005545 Unclassified 1188
42 Ga0070695_100788064 3300005545 Unclassified 761
43 Ga0070696_100063966 3300005546 Bacteria 2577
44 Ga0070693_100281778 3300005547 Bacteria 1113
45 Ga0070693_100719822 3300005547 Unclassified 732
46 Ga0070665_100347031 3300005548 Bacteria 1489
47 Ga0070665_100823338 3300005548 Bacteria 941
48 Ga0068855_100017921 3300005563 Bacteria 8508
49 Ga0068855_100244964 3300005563 Bacteria 2001
50 Ga0068855_100258339 3300005563 Unclassified 1941
51 Ga0070664_100084577 3300005564 Unclassified 2739
52 Ga0068857_100022707 3300005577 Bacteria 5519
53 Ga0068857_100184846 3300005577 Bacteria 1897
54 Ga0068857_100282242 3300005577 Bacteria 1528
55 Ga0068854_100069952 3300005578 Unclassified 2564
56 Ga0068854_100364303 3300005578 Bacteria 1187
57 Ga0068854_100376970 3300005578 Bacteria 1168
58 Ga0068856_100001090 3300005614 Bacteria 28642
59 Ga0068856_100025846 3300005614 Bacteria 5725
60 Ga0068856_100092860 3300005614 Bacteria 3003
61 Ga0070702_100544894 3300005615 Bacteria 860
62 Ga0068852_100064944 3300005616 Unclassified 3183
63 Ga0068859_100058866 3300005617 Bacteria 3871
64 Ga0068859_100532936 3300005617 Bacteria 1269
65 Ga0068864_100196791 3300005618 Unclassified 1850
66 Ga0068864_100359593 3300005618 Bacteria 1375
67 Ga0068864_100873759 3300005618 Bacteria 887
68 Ga0068866_10072325 3300005718 Bacteria 1826
69 Ga0068866_10357552 3300005718 Bacteria 930
70 Ga0068863_100023456 3300005841 Bacteria 5892
71 Ga0068863_100122117 3300005841 Unclassified 2484
72 Ga0068860_100058685 3300005843 Bacteria 3658
73 Ga0068860_100397279 3300005843 Bacteria 1363
74 Ga0081539_10000487 3300005985 Bacteria 83994
75 Ga0081539_10098662 3300005985 Unclassified 1493
76 Ga0070716_100076732 3300006173 Unclassified 1981
77 Ga0097621_100331203 3300006237 Bacteria 1350
78 Ga0068871_100016677 3300006358 Bacteria 5540
79 Ga0075431_100298052 3300006847 Bacteria 1629
80 Ga0075433_10810799 3300006852 Unclassified 818
81 Ga0075434_100278239 3300006871 Bacteria 1693
82 Ga0075434_100570957 3300006871 Bacteria 1150
83 Ga0075434_100602307 3300006871 Bacteria 1118
84 Ga0075434_101136984 3300006871 Unclassified 794
85 Ga0075434_101469179 3300006871 Unclassified 691
86 Ga0075429_100237480 3300006880 Bacteria 1596
87 Ga0068865_100006659 3300006881 Bacteria 7068
88 Ga0075436_100046658 3300006914 Bacteria 2988
89 Ga0097620_100058867 3300006931 Bacteria 3871
90 Ga0097620_100532976 3300006931 Bacteria 1269
91 Ga0075435_100012481 3300007076 Bacteria 6295
92 Ga0105240_10010188 3300009093 Bacteria 13230
93 Ga0111539_10195294 3300009094 Bacteria 2361
94 Ga0105247_10089355 3300009101 Unclassified 1953
95 Ga0105247_10143262 3300009101 Bacteria 1568
96 Ga0114129_10291727 3300009147 Bacteria 2177
97 Ga0114129_10423064 3300009147 Unclassified 1752
98 Ga0114129_10933383 3300009147 Bacteria 1097
99 Ga0114129_10947463 3300009147 Bacteria 1088
100 Ga0105241_10134430 3300009174 Bacteria 2006
101 Ga0105241_10525249 3300009174 Bacteria 1059
102 Ga0105241_11035162 3300009174 Unclassified 770
103 Ga0105248_10001999 3300009177 Bacteria 22692
104 Ga0105248_10528932 3300009177 Bacteria 1330
105 Ga0105237_10151407 3300009545 Bacteria 2316
106 Ga0105237_10205111 3300009545 Bacteria 1972
107 Ga0105237_11401231 3300009545 Unclassified 705
108 Ga0105238_10255741 3300009551 Bacteria 1730
109 Ga0105238_10266377 3300009551 Unclassified 1693
110 Ga0105249_10650969 3300009553 Bacteria 1111
111 Ga0099796_10039946 3300010159 Bacteria 1582
112 Ga0105246_10026429 3300011119 Bacteria 3792
113 Ga0105246_10184673 3300011119 Bacteria 1609
114 Ga0157369_10625880 3300013105 Bacteria 1110
115 Ga0157374_10590070 3300013296 Bacteria 1120
116 Ga0157378_10120776 3300013297 Bacteria 2415
117 Ga0157378_10303784 3300013297 Bacteria 1545
118 Ga0163162_10084268 3300013306 Bacteria 3254
119 Ga0157372_10038830 3300013307 Bacteria 5253
120 Ga0157372_10132716 3300013307 Unclassified 2867
121 Ga0157372_10379024 3300013307 Bacteria 1648
122 Ga0157372_10735595 3300013307 Bacteria 1147
123 Ga0157375_10081492 3300013308 Bacteria 3276
124 Ga0157375_10145853 3300013308 Unclassified 2498
125 Ga0157375_10293021 3300013308 Bacteria 1790
126 Ga0163163_10024660 3300014325 Bacteria 5726
127 Ga0163163_10037356 3300014325 Bacteria 4724
128 Ga0163163_10076775 3300014325 Bacteria 3336
129 Ga0157380_10843812 3300014326 Unclassified 937
130 Ga0157377_10078538 3300014745 Unclassified 1924
131 Ga0157379_10473634 3300014968 Bacteria 1158
132 Ga0157376_10104320 3300014969 Bacteria 2484
133 Ga0157376_11762162 3300014969 Bacteria 655
134 Ga0157376_11975282 3300014969 Bacteria 621
135 Ga0207653_10000031 3300025885 Bacteria 111372
136 Ga0207682_10174781 3300025893 Unclassified 978
137 Ga0207642_10047257 3300025899 Bacteria 1923
138 Ga0207710_10083998 3300025900 Bacteria 1481
139 Ga0207710_10115083 3300025900 Bacteria 1280
140 Ga0207645_10122337 3300025907 Bacteria 1690
141 Ga0207643_10001319 3300025908 Bacteria 14392
142 Ga0207654_10121919 3300025911 Bacteria 1638
143 Ga0207707_10000013 3300025912 Bacteria 264517
144 Ga0207695_10003786 3300025913 Bacteria 20991
145 Ga0207671_11174713 3300025914 Unclassified 601
146 Ga0207660_10002939 3300025917 Bacteria 11135
147 Ga0207652_10001275 3300025921 Bacteria 22442
148 Ga0207646_10133860 3300025922 Bacteria 2232
149 Ga0207694_10016237 3300025924 Bacteria 5619
150 Ga0207694_10038825 3300025924 Unclassified 3661
151 Ga0207650_10133257 3300025925 Bacteria 1947
152 Ga0207659_10303749 3300025926 Bacteria 1311
153 Ga0207687_10121291 3300025927 Unclassified 1956
154 Ga0207644_10081229 3300025931 Unclassified 2395
155 Ga0207690_10478441 3300025932 Unclassified 1005
156 Ga0207706_10084102 3300025933 Unclassified 2797
157 Ga0207686_10566163 3300025934 Bacteria 890
158 Ga0207709_10076823 3300025935 Unclassified 2138
159 Ga0207709_10110605 3300025935 Bacteria 1836
160 Ga0207670_10002254 3300025936 Bacteria 10091
161 Ga0207669_10861931 3300025937 Bacteria 754
162 Ga0207704_10005329 3300025938 Bacteria 5928
163 Ga0207665_10068981 3300025939 Unclassified 2410
164 Ga0207711_10005327 3300025941 Bacteria 10909
165 Ga0207711_10053456 3300025941 Unclassified 3464
166 Ga0207679_10103451 3300025945 Unclassified 2232
167 Ga0207667_10060005 3300025949 Unclassified 3982
168 Ga0207667_10143242 3300025949 Bacteria 2460
169 Ga0207667_10202897 3300025949 Bacteria 2034
170 Ga0207667_10508334 3300025949 Bacteria 1221
171 Ga0207651_10464071 3300025960 Bacteria 1089
172 Ga0207651_10504263 3300025960 Bacteria 1047
173 Ga0207712_10652590 3300025961 Bacteria 915
174 Ga0207640_10282327 3300025981 Bacteria 1305
175 Ga0207658_10385798 3300025986 Unclassified 1228
176 Ga0207677_10375162 3300026023 Unclassified 1199
177 Ga0207677_11042520 3300026023 Bacteria 743
178 Ga0207639_10062131 3300026041 Bacteria 2886
179 Ga0207639_10130152 3300026041 Bacteria 2082
180 Ga0207639_10428192 3300026041 Bacteria 1198
181 Ga0207708_10000016 3300026075 Bacteria 193989
182 Ga0207702_10300498 3300026078 Unclassified 1523
183 Ga0207702_11753471 3300026078 Unclassified 613
184 Ga0207641_10015674 3300026088 Bacteria 6210
185 Ga0207641_11014417 3300026088 Unclassified 827
186 Ga0207648_10021617 3300026089 Bacteria 5782
187 Ga0207648_10447580 3300026089 Bacteria 1176
188 Ga0207676_10005013 3300026095 Bacteria 9380
189 Ga0207676_10196328 3300026095 Bacteria 1780
190 Ga0207676_10655081 3300026095 Bacteria 1014
191 Ga0207674_10052701 3300026116 Unclassified 4148
192 Ga0207674_10052988 3300026116 Unclassified 4136
193 Ga0207674_10439319 3300026116 Unclassified 1261
194 Ga0207698_10769104 3300026142 Unclassified 963
195 Ga0268266_10934151 3300028379 Unclassified 839
196 Ga0268265_11876975 3300028380 Bacteria 606
197 Ga0268264_10114817 3300028381 Bacteria 2365
198 Ga0268264_10300670 3300028381 Bacteria 1510
199 Ga0307408_100003108 3300031548 Bacteria 11441
200 Ga0307408_101150261 3300031548 Bacteria 722
201 Ga0307405_10011629 3300031731 Unclassified 4625
202 Ga0307413_10032581 3300031824 Unclassified 2956
203 Ga0307410_10013042 3300031852 Unclassified 4833
204 Ga0307406_10003911 3300031901 Bacteria 8103
205 Ga0307407_10068503 3300031903 Bacteria 2102
206 Ga0307412_10040250 3300031911 Unclassified 3023
207 Ga0307409_100089900 3300031995 Unclassified 2512
208 Ga0307409_100242000 3300031995 Bacteria 1643
209 Ga0307416_100000838 3300032002 Bacteria 16180
210 Ga0307416_100013345 3300032002 Bacteria 5580
211 Ga0307414_10000401 3300032004 Bacteria 23470
212 Ga0307411_10040432 3300032005 Unclassified 2958
213 Ga0307415_100000262 3300032126 Bacteria 22775
214 Ga0307415_100502165 3300032126 Unclassified 1061
215 Ga0307415_100801306 3300032126 Bacteria 860
216 Ga0373944_0361948 3300035089 Bacteria 554
217 Ga0373937_1323576 3300036401 Unclassified 668
218 Ga0395899_0315347 3300037312 Bacteria 1055
219 Ga0395900_0342529 3300037418 Bacteria 1470
220 Ga0395901_0540470 3300038443 Bacteria 1182
221 Ga0453683_0119885 3300044673 Bacteria 1656
222 Ga0451576_0538343 3300045051 Unclassified 1227
223 Ga0495604_0097304 3300047317 Bacteria 2171
224 Ga0496102_0080881 3300048905 Bacteria 2994
225 Ga0496102_0087282 3300048905 Bacteria 2882
226 Ga0496103_0029524 3300048906 Bacteria 3333
227 Ga0496104_0106049 3300048907 Bacteria 2693
228 Ga0496104_0204180 3300048907 Bacteria 1888
229 Ga0496104_1103115 3300048907 Unclassified 697
230 Ga0496106_0386391 3300048909 Unclassified 1125
231 Ga0496106_1167915 3300048909 Bacteria 601
232 Ga0496107_0031500 3300048910 Bacteria 3785
233 Ga0496107_0375991 3300048910 Unclassified 1057
234 Ga0496108_0373926 3300048911 Unclassified 1244
235 Ga0496110_0568283 3300048913 Unclassified 1030
236 Ga0496112_0328721 3300048915 Unclassified 1473
237 Ga0496113_0369806 3300048916 Bacteria 1151
238 Ga0501306_037184 3300049127 Unclassified 744
239 Ga0501291_008778 3300049514 Bacteria 1403
240 Ga0501292_015664 3300049515 Bacteria 1187
241 Ga0501299_013809 3300049522 Unclassified 1397
242 Ga0501299_032022 3300049522 Unclassified 1019
243 Ga0501038_0001977 3300049574 Bacteria 18932
244 Ga0501046_0713589 3300049580 Unclassified 706
245 Ga0501048_0441827 3300049582 Unclassified 931
246 Ga0501068_0687534 3300049584 Unclassified 669
247 Ga0501075_1048065 3300049591 Bacteria 619
248 Ga0501198_005070 3300049649 Bacteria 1844
249 Ga0501202_009627 3300049652 Unclassified 1780
250 Ga0501207_000189 3300049654 Bacteria 5980
251 Ga0501208_078754 3300049655 Bacteria 674
252 Ga0501209_026442 3300049656 Bacteria 1432
253 Ga0501216_000220 3300049660 Bacteria 6240
254 Ga0501216_012657 3300049660 Unclassified 1388
255 Ga0501216_111310 3300049660 Bacteria 615
256 Ga0501217_001569 3300049661 Bacteria 4317
257 Ga0501217_010288 3300049661 Unclassified 2046
258 Ga0501224_000117 3300049664 Bacteria 8559
259 Ga0501227_002505 3300049665 Unclassified 4056
260 Ga0501230_001916 3300049667 Unclassified 2578
261 Ga0501233_019353 3300049668 Unclassified 1441
262 Ga0501235_043632 3300049669 Bacteria 1029
263 Ga0501235_073485 3300049669 Unclassified 811
264 Ga0501240_003495 3300049673 Unclassified 1758
265 Ga0501243_008195 3300049675 Unclassified 1609
266 Ga0501253_011492 3300049683 Unclassified 1362
267 Ga0501257_008483 3300049686 Bacteria 2310
268 Ga0501221_005825 3300049704 Unclassified 2070
269 Ga0501225_0000745 3300049705 Bacteria 10183
270 Ga0501225_0028716 3300049705 Bacteria 1528
271 Ga0501225_0033629 3300049705 Bacteria 1411
272 Ga0501234_002164 3300049707 Unclassified 3104
273 Ga0501234_028186 3300049707 Unclassified 903
274 Ga0501081_0172206 3300049743 Unclassified 1563
275 Ga0501241_031099 3300049758 Bacteria 1009
276 Ga0501267_012938 3300049764 Bacteria 864
277 Ga0501268_041788 3300049765 Bacteria 865
278 Ga0501268_072968 3300049765 Bacteria 697
279 Ga0501212_006789 3300049851 Bacteria 1553
280 Ga0501226_000218 3300049853 Bacteria 9100
281 nmdc:mga07m45_359768_c1 3300050496 Bacteria 845
282 nmdc:mga05p37_463107_c1 3300050507 Unclassified 1464
283 nmdc:mga09592_158710_c1 3300050508 Bacteria 1953
284 nmdc:mga0qj67_384228_c1 3300050509 Bacteria 1134
285 nmdc:mga0n895_113815_c1 3300050512 Bacteria 2723
286 nmdc:mga0n895_1260881_c1 3300050512 Unclassified 711
287 nmdc:mga0n895_324751_c1 3300050512 Bacteria 1559
288 nmdc:mga0rr50_24616_c1 3300050513 Bacteria 4172
289 nmdc:mga08x19_25705_c1 3300050514 Bacteria 3670
290 nmdc:mga0a205_28519_c1 3300050515 Bacteria 5338
291 Ga0587072_055570 3300059643 Bacteria 804
292 Ga0058863_11285541
293 CNAas_1001588
294 JGI25406J46586_10009156
295 Ga0058861_10584226
296 Ga0058862_12128191
297 Ga0070670_100053182
298 Ga0070670_100063998
299 Ga0068869_100721637
300 Ga0070666_10601641
301 Ga0070680_100000684
302 Ga0070660_100442870
303 Ga0070692_10194883
304 Ga0070692_10331594
305 Ga0070671_100025276
306 Ga0070674_101055744
307 Ga0070673_100022001
308 Ga0070659_100065157
309 Ga0070667_100526607
310 Ga0070703_10000105
311 Ga0070701_10170110
312 Ga0070700_100000036
313 Ga0070694_100063242
314 Ga0070708_100965000
315 Ga0070678_100044678
316 Ga0070662_100175412
317 Ga0070681_10000339
318 Ga0068867_100763430
319 Ga0070685_10407424
320 Ga0070706_100684969
321 Ga0070707_100136280
322 Ga0070698_100082094
323 Ga0070699_100372835
324 Ga0070699_100621217
325 Ga0070679_100000102
326 Ga0070697_100154076
327 Ga0070697_101093126
328 Ga0068853_100130761
329 Ga0070672_100930075
330 Ga0070686_100737232
331 Ga0070695_100204783
332 Ga0070695_100299637
333 Ga0070695_100788064
334 Ga0070696_100063966
335 Ga0070693_100281778
336 Ga0070693_100719822
337 Ga0070665_100347031
338 Ga0070665_100823338
339 Ga0068855_100017921
340 Ga0068855_100244964
341 Ga0068855_100258339
342 Ga0070664_100084577
343 Ga0068857_100022707
344 Ga0068857_100184846
345 Ga0068857_100282242
346 Ga0068854_100069952
347 Ga0068854_100364303
348 Ga0068854_100376970
349 Ga0068856_100001090
350 Ga0068856_100025846
351 Ga0068856_100092860
352 Ga0070702_100544894
353 Ga0068852_100064944
354 Ga0068859_100058866
355 Ga0068859_100532936
356 Ga0068864_100196791
357 Ga0068864_100359593
358 Ga0068864_100873759
359 Ga0068866_10072325
360 Ga0068866_10357552
361 Ga0068863_100023456
362 Ga0068863_100122117
363 Ga0068860_100058685
364 Ga0068860_100397279
365 Ga0081539_10000487
366 Ga0081539_10098662
367 Ga0070716_100076732
368 Ga0097621_100331203
369 Ga0068871_100016677
370 Ga0075431_100298052
371 Ga0075433_10810799
372 Ga0075434_100278239
373 Ga0075434_100570957
374 Ga0075434_100602307
375 Ga0075434_101136984
376 Ga0075434_101469179
377 Ga0075429_100237480
378 Ga0068865_100006659
379 Ga0075436_100046658
380 Ga0097620_100058867
381 Ga0097620_100532976
382 Ga0075435_100012481
383 Ga0105240_10010188
384 Ga0111539_10195294
385 Ga0105247_10089355
386 Ga0105247_10143262
387 Ga0114129_10291727
388 Ga0114129_10423064
389 Ga0114129_10933383
390 Ga0114129_10947463
391 Ga0105241_10134430
392 Ga0105241_10525249
393 Ga0105241_11035162
394 Ga0105248_10001999
395 Ga0105248_10528932
396 Ga0105237_10151407
397 Ga0105237_10205111
398 Ga0105237_11401231
399 Ga0105238_10255741
400 Ga0105238_10266377
401 Ga0105249_10650969
402 Ga0099796_10039946
403 Ga0105246_10026429
404 Ga0105246_10184673
405 Ga0157369_10625880
406 Ga0157374_10590070
407 Ga0157378_10120776
408 Ga0157378_10303784
409 Ga0163162_10084268
410 Ga0157372_10038830
411 Ga0157372_10132716
412 Ga0157372_10379024
413 Ga0157372_10735595
414 Ga0157375_10081492
415 Ga0157375_10145853
416 Ga0157375_10293021
417 Ga0163163_10024660
418 Ga0163163_10037356
419 Ga0163163_10076775
420 Ga0157380_10843812
421 Ga0157377_10078538
422 Ga0157379_10473634
423 Ga0157376_10104320
424 Ga0157376_11762162
425 Ga0157376_11975282
426 Ga0207653_10000031
427 Ga0207682_10174781
428 Ga0207642_10047257
429 Ga0207710_10083998
430 Ga0207710_10115083
431 Ga0207645_10122337
432 Ga0207643_10001319
433 Ga0207654_10121919
434 Ga0207707_10000013
435 Ga0207695_10003786
436 Ga0207671_11174713
437 Ga0207660_10002939
438 Ga0207652_10001275
439 Ga0207646_10133860
440 Ga0207694_10016237
441 Ga0207694_10038825
442 Ga0207650_10133257
443 Ga0207659_10303749
444 Ga0207687_10121291
445 Ga0207644_10081229
446 Ga0207690_10478441
447 Ga0207706_10084102
448 Ga0207686_10566163
449 Ga0207709_10076823
450 Ga0207709_10110605
451 Ga0207670_10002254
452 Ga0207669_10861931
453 Ga0207704_10005329
454 Ga0207665_10068981
455 Ga0207711_10005327
456 Ga0207711_10053456
457 Ga0207679_10103451
458 Ga0207667_10060005
459 Ga0207667_10143242
460 Ga0207667_10202897
461 Ga0207667_10508334
462 Ga0207651_10464071
463 Ga0207651_10504263
464 Ga0207712_10652590
465 Ga0207640_10282327
466 Ga0207658_10385798
467 Ga0207677_10375162
468 Ga0207677_11042520
469 Ga0207639_10062131
470 Ga0207639_10130152
471 Ga0207639_10428192
472 Ga0207708_10000016
473 Ga0207702_10300498
474 Ga0207702_11753471
475 Ga0207641_10015674
476 Ga0207641_11014417
477 Ga0207648_10021617
478 Ga0207648_10447580
479 Ga0207676_10005013
480 Ga0207676_10196328
481 Ga0207676_10655081
482 Ga0207674_10052701
483 Ga0207674_10052988
484 Ga0207674_10439319
485 Ga0207698_10769104
486 Ga0268266_10934151
487 Ga0268265_11876975
488 Ga0268264_10114817
489 Ga0268264_10300670
490 Ga0307408_100003108
491 Ga0307408_101150261
492 Ga0307405_10011629
493 Ga0307413_10032581
494 Ga0307410_10013042
495 Ga0307406_10003911
496 Ga0307407_10068503
497 Ga0307412_10040250
498 Ga0307409_100089900
499 Ga0307409_100242000
500 Ga0307416_100000838
501 Ga0307416_100013345
502 Ga0307414_10000401
503 Ga0307411_10040432
504 Ga0307415_100000262
505 Ga0307415_100502165
506 Ga0307415_100801306
507 Ga0373944_0361948
508 Ga0373937_1323576
509 Ga0395899_0315347
510 Ga0395900_0342529
511 Ga0395901_0540470
512 Ga0453683_0119885
513 Ga0451576_0538343
514 Ga0495604_0097304
515 Ga0496102_0080881
516 Ga0496102_0087282
517 Ga0496103_0029524
518 Ga0496104_0106049
519 Ga0496104_0204180
520 Ga0496104_1103115
521 Ga0496106_0386391
522 Ga0496106_1167915
523 Ga0496107_0031500
524 Ga0496107_0375991
525 Ga0496108_0373926
526 Ga0496110_0568283
527 Ga0496112_0328721
528 Ga0496113_0369806
529 Ga0501306_037184
530 Ga0501291_008778
531 Ga0501292_015664
532 Ga0501299_013809
533 Ga0501299_032022
534 Ga0501038_0001977
535 Ga0501046_0713589
536 Ga0501048_0441827
537 Ga0501068_0687534
538 Ga0501075_1048065
539 Ga0501198_005070
540 Ga0501202_009627
541 Ga0501207_000189
542 Ga0501208_078754
543 Ga0501209_026442
544 Ga0501216_000220
545 Ga0501216_012657
546 Ga0501216_111310
547 Ga0501217_001569
548 Ga0501217_010288
549 Ga0501224_000117
550 Ga0501227_002505
551 Ga0501230_001916
552 Ga0501233_019353
553 Ga0501235_043632
554 Ga0501235_073485
555 Ga0501240_003495
556 Ga0501243_008195
557 Ga0501253_011492
558 Ga0501257_008483
559 Ga0501221_005825
560 Ga0501225_0000745
561 Ga0501225_0028716
562 Ga0501225_0033629
563 Ga0501234_002164
564 Ga0501234_028186
565 Ga0501081_0172206
566 Ga0501241_031099
567 Ga0501267_012938
568 Ga0501268_041788
569 Ga0501268_072968
570 Ga0501212_006789
571 Ga0501226_000218
572 nmdc:mga07m45_359768_c1
573 nmdc:mga05p37_463107_c1
574 nmdc:mga09592_158710_c1
575 nmdc:mga0qj67_384228_c1
576 nmdc:mga0n895_113815_c1
577 nmdc:mga0n895_1260881_c1
578 nmdc:mga0n895_324751_c1
579 nmdc:mga0rr50_24616_c1
580 nmdc:mga08x19_25705_c1
581 nmdc:mga0a205_28519_c1
582 Ga0587072_055570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00080

Sod_Cu

Copper/zinc superoxide dismutase (SODC)

58

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xtl-assembly4.cif.gz_B crystal structure of p104h mutant of sod-like protein from bacillus subtilis. 0.9391 28 174
1xtm-assembly1.cif.gz_B crystal structure of the double mutant y88h-p104h of a sod-like protein from bacillus subtilis. 0.9351 28 174
1s4i-assembly6.cif.gz_C crystal structure of a sod-like protein from bacillus subtilis 0.9345 28 172
1xtl-assembly4.cif.gz_B crystal structure of p104h mutant of sod-like protein from bacillus subtilis. 0.9038 28 174
1xtm-assembly1.cif.gz_B crystal structure of the double mutant y88h-p104h of a sod-like protein from bacillus subtilis. 0.8944 28 174
ID Description Score Start End Superfamily
1s4iB00 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.9332 28 172 2.60.40.200
1s4iB00 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.8866 28 172 2.60.40.200
2zkxD00 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.8839 30 174 2.60.40.200
af_P34461_24_185_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.8647 29 174 2.60.40.200
2zkxD00 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.8494 30 174 2.60.40.200
ID Description Score Start End GO Terms
AF-A0A7W1YBU6-F1-model_v4 Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) 0.9742 30 174 GO:0005507
GO:0006801
GO:0016491
AF-A0A1Q6XDD8-F1-model_v4 Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) 0.9733 26 174 GO:0004784
GO:0005507
AF-A0A2W1P349-F1-model_v4 Superoxide dismutase family protein 0.9725 28 173 GO:0005507
GO:0006801
AF-A0A2V9CA36-F1-model_v4 Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) 0.9723 28 174 GO:0004784
GO:0005507
AF-A0A2P6WBS3-F1-model_v4 Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) 0.9686 28 174 GO:0004784
GO:0005507

Map