F390109

General Info

Members Datasets Scaffolds Average Seq Length
290 232 581 424

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8022914991|8022917677
Length 483
Sequence DNNDRIEKKQVTVYTKKGLILTRTRQQTKKNKDYSPFYPMLRDLSVNKLKFFKNRQVGESMIYDVVVIGGGPSGLMASIAAGESGANVLLIDKGNKLGRKLAISGGGRCNVTNRLPIDELIKHIPGNGRFLYSAFSVFNNEDIISYFEGLGIKLKEEDHGRMFPVSNKAQSVVDALISELHRLRVTIRTNTAVKRVTYENNTVKEVVLQNGEAIQTKSVVIAVGGKSVPHTGSTGDGYQWAKDAGHKITELYPTEVPITSSEHFIKTKTLQGLSLRSVGLSVLNKKGKPVITHQMDMIFTHFGISGPAALRCSQYVVKELKKQKSNTVQMSLDLFPSQNEEEIFQQLAKMTKEEPKKAIKNVLKGFVSERYLLFLLEQADIDSQALAGQLQHEKLREFSRMCKRFEFAVNGTLSLEKAFVTGGGVSVKEIHPKEMSSKFMQGLYFCGEILDIHGYTGGYNITSALVTGRLAGSNAGEFATSLA

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
28 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
37 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
38 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
43 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
44 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
45 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
46 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
50 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
51 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
52 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
53 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
54 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
55 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
56 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
57 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
58 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
59 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
60 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
61 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
62 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
63 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
64 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
65 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
69 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
70 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
71 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
72 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
73 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
74 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
75 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
76 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
77 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
78 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
79 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
80 2554235283 Bacillus safensis VK Isolate Rhizosphere
81 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
82 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
83 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
84 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
85 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
86 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
87 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
88 2643221729 Bacillus sp. Root11 Isolate Unclassified
89 2643221730 Bacillus sp. Root131 Isolate Unclassified
90 2643221731 Bacillus sp. Root147 Isolate Unclassified
91 2643221732 Bacillus sp. Root239 Isolate Unclassified
92 2643221735 Bacillus sp. Root920 Isolate Unclassified
93 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
94 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
95 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
96 2684622632 Bacillus cereus 905 Isolate Unclassified
97 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
98 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
99 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
100 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
101 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
102 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
103 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
104 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
105 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
106 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
107 2738541295 Bacillus sp. OK085 Isolate Unclassified
108 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
109 2738541358 Bacillus sp. OV752 Isolate Unclassified
110 2738543006 Bacillus sp. OK077 Isolate Unclassified
111 2738543010 Bacillus sp. YR335 Isolate Unclassified
112 2738543017 Bacillus sp. OV186 Isolate Unclassified
113 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
114 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
115 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
116 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
117 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
118 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
119 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
120 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
121 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
122 2811994870 Bacillus sp. JB4 Isolate Unclassified
123 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
124 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
125 2818991441 Niallia circulans 3243 Isolate Rhizosphere
126 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
127 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
128 2818991459 Paenibacillus sp. 597 Isolate Unclassified
129 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
130 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
131 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
132 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
133 2842682962 Bacillus sp. R-72492 Isolate Unclassified
134 2842882022 Bacillus sp. R-71893 Isolate Unclassified
135 2849139964 Bacillus sp. R-71875 Isolate Unclassified
136 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
137 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
138 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
139 2857581216 Bacillus sp. R-71922 Isolate Unclassified
140 2857586860 Bacillus sp. R-71935 Isolate Unclassified
141 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
142 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
143 2860837431 Bacillus sp. WR11 Isolate Unclassified
144 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
145 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
146 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
147 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
148 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
149 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
150 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
151 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
152 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
153 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
154 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
155 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
156 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
157 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
158 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
159 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
160 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
161 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
162 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
163 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
164 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
165 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
166 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
167 2919720352 Priestia megaterium 4340 Isolate Unclassified
168 2919726948 Bacillus pumilus 4489 Isolate Unclassified
169 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
170 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
171 2929004312 Priestia megaterium 1104 Isolate Unclassified
172 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
173 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
174 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
175 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
176 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
177 2938917290 Bacillus sp. CR71 Isolate Unclassified
178 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
179 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
180 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
181 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
182 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
183 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
184 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
185 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
186 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
187 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
188 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
189 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
190 2965761152 Bacillus sp. COPE52 Isolate Unclassified
191 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
192 2969141011 Bacillus velezensis MH25 Isolate Unclassified
193 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
194 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
195 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
196 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
197 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
198 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
199 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
200 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
201 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
202 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
203 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
204 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
205 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
206 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
207 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
208 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
209 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
210 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
211 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
212 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
213 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
214 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
215 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
216 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
217 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
218 8022653035 Bacillus sp. Rc4 Isolate Unclassified
219 8022792930 Bacillus sp. Xin Isolate Rhizosphere
220 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
221 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
222 8023438354 Bacillus sp. BH2 Isolate Unclassified
223 8023444577 Bacillus sp. BH32 Isolate Unclassified
224 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
225 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
226 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
227 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
228 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
229 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
230 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
231 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
232 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 44.83
Metatranscriptomes 0.69
Isolates 54.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 14.14
Nodule 0.34
Rhizoplane 6.9
Rhizosphere 41.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1006271 3300002737 Bacteria 2092
2 JGI25159J45721_1004377 3300002987 Bacteria 4703
3 JGI25151J46595_10000046 3300003187 Bacteria 168647
4 JGI25151J46595_10002100 3300003187 Bacteria 12426
5 JGI25151J46595_10008706 3300003187 Bacteria 4858
6 JGI25151J46595_10010936 3300003187 Bacteria 4194
7 JGI25151J46595_10010940 3300003187 Bacteria 4194
8 JGI25151J46595_10033178 3300003187 Bacteria 1992
9 JGI25151J46595_10037690 3300003187 Bacteria 1810
10 rootH1_10000644 3300003316 Bacteria 71850
11 rootH1_10000644 3300003323 Bacteria 3522
12 rootL2_10013974 3300003322 Bacteria 148551
13 rootH1_10079273 3300003323 Bacteria 3472
14 Ga0006562J51391_1008343 3300003578 Bacteria 4650
15 Ga0006562J51391_1008345 3300003578 Bacteria 6430
16 Ga0055538_1003188 3300003751 Bacteria 2142
17 Ga0055532_1000088 3300003758 Bacteria 106291
18 Ga0055536_1007244 3300003781 Bacteria 4999
19 Ga0055528_1015435 3300003790 Bacteria 2760
20 Ga0105251_10012021 3300009011 Bacteria 4913
21 Ga0105251_10040265 3300009011 Bacteria 2278
22 Ga0105244_10021915 3300009036 Bacteria 3522
23 Ga0105244_10073874 3300009036 Bacteria 1697
24 Ga0105250_10004406 3300009092 Bacteria 6485
25 Ga0105250_10060193 3300009092 Bacteria 1526
26 Ga0105245_10040999 3300009098 Bacteria 4126
27 Ga0105247_10005449 3300009101 Bacteria 8017
28 Ga0105243_10002375 3300009148 Bacteria 15760
29 Ga0105242_10019167 3300009176 Bacteria 5359
30 Ga0105249_10238541 3300009553 Bacteria 1797
31 Ga0105239_10149703 3300010375 Bacteria 2604
32 Ga0105246_10002601 3300011119 Bacteria 10922
33 Ga0105246_10002941 3300011119 Bacteria 10313
34 Ga0105246_10010303 3300011119 Bacteria 5778
35 Ga0157371_10008633 3300013102 Bacteria 8094
36 Ga0157376_10059728 3300014969 Bacteria 3198
37 Ga0209784_100648 3300025224 Bacteria 10356
38 Ga0209566_100082 3300025225 Bacteria 155379
39 Ga0209147_100058 3300025229 Bacteria 252750
40 Ga0209147_100231 3300025229 Bacteria 55288
41 Ga0209147_100498 3300025229 Bacteria 22935
42 Ga0209147_102124 3300025229 Bacteria 5508
43 Ga0209437_100569 3300025233 Bacteria 24024
44 Ga0209673_1002530 3300025273 Bacteria 12514
45 Ga0209130_1003086 3300025284 Bacteria 7452
46 Ga0209130_1003136 3300025284 Bacteria 7332
47 Ga0209130_1005434 3300025284 Bacteria 4417
48 Ga0209676_1000574 3300025292 Bacteria 55392
49 Ga0209025_1000001 3300025294 Bacteria 1888151
50 Ga0209025_1000780 3300025294 Bacteria 52525
51 Ga0209025_1000801 3300025294 Bacteria 51045
52 Ga0209025_1001403 3300025294 Bacteria 31984
53 Ga0209025_1001470 3300025294 Bacteria 30704
54 Ga0209025_1001834 3300025294 Bacteria 24955
55 Ga0209025_1003512 3300025294 Bacteria 14721
56 Ga0209025_1003683 3300025294 Bacteria 14141
57 Ga0209025_1006513 3300025294 Bacteria 9032
58 Ga0209025_1008547 3300025294 Bacteria 7347
59 Ga0209025_1015142 3300025294 Bacteria 4676
60 Ga0209025_1016674 3300025294 Bacteria 4308
61 Ga0209025_1016756 3300025294 Bacteria 4290
62 Ga0209025_1017569 3300025294 Bacteria 4118
63 Ga0209025_1039302 3300025294 Bacteria 2065
64 Ga0209025_1047208 3300025294 Bacteria 1761
65 Ga0207696_1001538 3300025711 Bacteria 12331
66 Ga0207696_1002417 3300025711 Bacteria 9170
67 Ga0207696_1008565 3300025711 Bacteria 3893
68 Ga0207696_1026707 3300025711 Bacteria 1784
69 Ga0207655_1002224 3300025728 Bacteria 16073
70 Ga0207655_1006335 3300025728 Bacteria 7860
71 Ga0207655_1014809 3300025728 Bacteria 4379
72 Ga0207713_1000495 3300025735 Bacteria 40605
73 Ga0207713_1046520 3300025735 Bacteria 1764
74 Ga0207709_10092355 3300025935 Bacteria 1982
75 Ga0209371_1013011 3300027312 Bacteria 2369
76 Ga0237817_10172 3300030083 Bacteria 18424
77 Ga0237817_10178 3300030083 Bacteria 17649
78 Ga0268256_1014264 3300030500 Bacteria 2369
79 Ga0307408_100023784 3300031548 Bacteria 4176
80 Ga0307408_100138690 3300031548 Bacteria 1906
81 Ga0307409_100037716 3300031995 Bacteria 3565
82 Ga0307416_100068369 3300032002 Bacteria 2935
83 Ga0237819_00267 3300038705 Bacteria 19055
84 Ga0237819_01220 3300038705 Bacteria 7126
85 Ga0439436_0002455 3300041404 Bacteria 5574
86 Ga0439439_0000235 3300041406 Bacteria 8661
87 Ga0439433_0001411 3300041999 Bacteria 4947
88 Ga0451577_0000019 3300042876 Bacteria 506976
89 Ga0453684_0000057 3300044712 Bacteria 506899
90 Ga0466967_0000061 3300045976 Bacteria 39905
91 Ga0495585_0007738 3300046492 Bacteria 6549
92 Ga0495622_0044347 3300046557 Bacteria 2067
93 Ga0495660_0027668 3300046810 Bacteria 3207
94 Ga0495683_0027596 3300047323 Bacteria 2903
95 Ga0496100_0000652 3300048903 Bacteria 16475
96 Ga0496101_0002388 3300048904 Bacteria 11525
97 Ga0496102_0001279 3300048905 Bacteria 22701
98 Ga0496104_0021700 3300048907 Bacteria 5897
99 Ga0496105_0000067 3300048908 Bacteria 82959
100 Ga0496106_0002480 3300048909 Bacteria 13754
101 Ga0496107_0000130 3300048910 Bacteria 36645
102 Ga0496108_0001894 3300048911 Bacteria 16762
103 Ga0496109_0001748 3300048912 Bacteria 18124
104 Ga0496110_0000405 3300048913 Bacteria 29252
105 Ga0496110_0000447 3300048913 Bacteria 28092
106 Ga0496110_0002851 3300048913 Bacteria 13054
107 Ga0496111_0002212 3300048914 Bacteria 11664
108 Ga0496111_0009845 3300048914 Bacteria 6390
109 Ga0496112_0000487 3300048915 Bacteria 26669
110 Ga0496112_0071412 3300048915 Bacteria 3431
111 Ga0496113_0001262 3300048916 Bacteria 13954
112 Ga0496116_0007293 3300048919 Bacteria 9847
113 Ga0496116_0016398 3300048919 Bacteria 5797
114 Ga0496117_0005208 3300048920 Bacteria 13833
115 Ga0496119_0003518 3300048922 Bacteria 16186
116 Ga0496119_0005014 3300048922 Bacteria 12907
117 Ga0496121_0126600 3300048924 Bacteria 1919
118 Ga0496122_0038681 3300048925 Bacteria 3815
119 Ga0496122_0044471 3300048925 Bacteria 3465
120 Ga0496122_0113520 3300048925 Bacteria 1770
121 Ga0496122_0140975 3300048925 Bacteria 1508
122 Ga0496123_0006478 3300048926 Bacteria 11331
123 Ga0496123_0035930 3300048926 Bacteria 3523
124 Ga0496123_0036687 3300048926 Bacteria 3472
125 Ga0496124_0001554 3300048927 Bacteria 33181
126 Ga0496124_0022744 3300048927 Bacteria 5740
127 Ga0496124_0052789 3300048927 Bacteria 3452
128 Ga0496124_0130194 3300048927 Bacteria 2000
129 Ga0496125_0001304 3300048928 Bacteria 36984
130 Ga0496125_0004186 3300048928 Bacteria 16819
131 Ga0496125_0005510 3300048928 Bacteria 14031
132 Ga0496125_0014445 3300048928 Bacteria 7688
133 Ga0496126_0004419 3300048929 Bacteria 16826
134 8022917677 8022914991 Bacteria 5584517
135 2511700681 2511231119 Bacteria 4019861
136 2540607889 2540341094 Bacteria 4061186
137 2545557379 2545555800 Bacteria 4222588
138 2553396266 2551306519 Bacteria 5465154
139 2555469958 2554235283 Bacteria 3683090
140 2556064273 2554235469 Bacteria 3590176
141 2578931645 2576861599 Bacteria 4217202
142 2595090878 2593339131 Bacteria 5116855
143 2600200102 2599185353 Bacteria 2219443
144 2600402153 2600254943 Bacteria 2613887
145 2631983559 2630968484 Bacteria 3876276
146 2643738587 2643221543 Bacteria 6628015
147 2644706315 2643221729 Bacteria 6621700
148 2644712996 2643221730 Bacteria 6523787
149 2644715472 2643221731 Bacteria 5623886
150 2644726776 2643221732 Bacteria 5756404
151 2644741545 2643221735 Bacteria 3676263
152 2651532601 2648501850 Bacteria 3975476
153 2672337468 2671180330 Bacteria 5521719
154 2674418497 2671180844 Bacteria 4164150
155 2685152689 2684622632 Bacteria 5380049
156 2686997968 2684623153 Bacteria 3878815
157 2687499311 2687453109 Bacteria 3860091
158 2695628671 2695420354 Bacteria 3922431
159 2698320486 2695420987 Bacteria 6152737
160 2705996601 2703719227 Bacteria 5631989
161 2712196626 2711768088 Bacteria 3195027
162 2717915632 2716884898 Bacteria 3928789
163 2721507841 2718218445 Bacteria 5113413
164 2723602114 2721755693 Bacteria 6126117
165 2730138180 2728369359 Bacteria 5621728
166 2738815572 2738541295 Bacteria 5730091
167 2738840565 2738541299 Bacteria 4020721
168 2739157534 2738541358 Bacteria 5932299
169 2739209626 2738543006 Bacteria 5904091
170 2739229809 2738543010 Bacteria 5583595
171 2739270580 2738543017 Bacteria 4271950
172 2753812352 2751185905 Bacteria 6142767
173 2757568535 2757320391 Bacteria 4746095
174 2777763549 2775507177 Bacteria 4384303
175 2777835763 2775507192 Bacteria 4622234
176 2791214877 2788500588 Bacteria 4584915
177 2793184993 2791355222 Bacteria 5898266
178 2802439919 2802428803 Bacteria 5806948
179 2808869820 2808606364 Bacteria 4465927
180 2809056256 2808606399 Bacteria 4021018
181 2812317164 2811994870 Bacteria 3776934
182 2816862119 2816332186 Bacteria 5331395
183 2817481261 2816332295 Bacteria 4352468
184 2819570937 2818991441 Bacteria 5062707
185 2819581588 2818991443 Bacteria 6598732
186 2819628893 2818991451 Bacteria 4697364
187 2819675929 2818991459 Bacteria 8736032
188 2819708940 2818991465 Bacteria 5388835
189 2819724243 2818991468 Bacteria 3723169
190 2821118079 2821111986 Bacteria 6894338
191 2823529128 2823526263 Bacteria 3765752
192 2842684977 2842682962 Bacteria 5589973
193 2842884822 2842882022 Bacteria 6158489
194 2849141537 2849139964 Bacteria 5613304
195 2852676019 2852673933 Bacteria 3347676
196 2857458964 2857453340 Bacteria 8090534
197 2857464554 2857460504 Bacteria 5194327
198 2857584030 2857581216 Bacteria 5522813
199 2857589273 2857586860 Bacteria 4354574
200 2857604648 2857604169 Bacteria 5111450
201 2857610496 2857609550 Bacteria 3753890
202 2860840668 2860837431 Bacteria 4202080
203 2864738541 2864733723 Bacteria 6770668
204 2877771594 2877768649 Bacteria 3957164
205 2880172440 2880169592 Bacteria 3900066
206 2881648304 2881644220 Bacteria 5302661
207 2885528531 2885526491 Bacteria 7164189
208 2889043175 2889042446 Bacteria 7618936
209 2889278183 2889276214 Bacteria 5979355
210 2897112712 2897109615 Bacteria 4009619
211 2904117138 2904113452 Bacteria 7796941
212 2904168447 2904162308 Bacteria 7086713
213 2904496761 2904490793 Bacteria 7046938
214 2904524148 2904524088 Bacteria 5887454
215 2904564041 2904560550 Bacteria 4029838
216 2904598112 2904595352 Bacteria 6124848
217 2904609663 2904606771 Bacteria 4684500
218 2908667667 2908665501 Bacteria 3678115
219 2915602901 2915597211 Bacteria 6475886
220 2916975118 2916971899 Bacteria 4250608
221 2919095461 2919093281 Bacteria 3660974
222 2919147275 2919143609 Bacteria 6219228
223 2919166103 2919160200 Bacteria 6929020
224 2919417242 2919414237 Bacteria 5429133
225 2919519180 2919517244 Bacteria 5858162
226 2919723547 2919720352 Bacteria 5986006
227 2919728831 2919726948 Bacteria 3696050
228 2928095926 2928093941 Bacteria 5965005
229 2928514480 2928510474 Bacteria 4815308
230 2929006704 2929004312 Bacteria 5678476
231 2929187958 2929183550 Bacteria 6377511
232 2929238385 2929233124 Bacteria 5948380
233 2931386637 2931384279 Bacteria 7299545
234 2936342048 2936340661 Bacteria 5139038
235 2936362179 2936361878 Bacteria 5632809
236 2938922583 2938917290 Bacteria 5914775
237 2939596474 2939593269 Bacteria 4798695
238 2939684943 2939679117 Bacteria 6921672
239 2939707340 2939702853 Bacteria 5139229
240 2945994753 2945991243 Bacteria 7008369
241 2946057548 2946053406 Bacteria 6978655
242 2947431468 2947426588 Bacteria 5357194
243 2954773330 2954773129 Bacteria 3741715
244 2956897763 2956897341 Bacteria 5447711
245 2960319544 2960319331 Bacteria 5502575
246 2960381245 2960375949 Bacteria 5361395
247 2962293886 2962290636 Bacteria 4072939
248 2964379472 2964375228 Bacteria 4909004
249 2965766176 2965761152 Bacteria 5806513
250 2969139873 2969136845 Bacteria 3923176
251 2969144037 2969141011 Bacteria 4118468
252 2969769659 2969765954 Bacteria 4216713
253 2969772722 2969770375 Bacteria 4271280
254 2971896262 2971893375 Bacteria 3929648
255 2977256226 2977254563 Bacteria 4828420
256 2979088374 2979083700 Bacteria 5894929
257 2980182385 2980182181 Bacteria 9454109
258 2980495662 2980492589 Bacteria 4072961
259 2984532559 2984527788 Bacteria 5288478
260 2984533816 2984532647 Bacteria 5288506
261 2990277111 2990275345 Bacteria 4887158
262 2996706911 2996706504 Bacteria 5757485
263 3001268823 3001267043 Bacteria 4823521
264 3001274290 3001272096 Bacteria 4729684
265 3001897423 3001892409 Bacteria 6328293
266 3006827482 3006826541 Bacteria 4678913
267 3006861681 3006858327 Bacteria 4317835
268 3006882154 3006879489 Bacteria 4064221
269 3006971716 3006969106 Bacteria 4739423
270 3006976283 3006973921 Bacteria 4423788
271 3006982261 3006978542 Bacteria 5328100
272 3006984149 3006984091 Bacteria 4207523
273 3006988540 3006988479 Bacteria 4767936
274 648168618 648028048 Bacteria 5394884
275 8022624636 8022621104 Bacteria 5241040
276 8022632321 8022630665 Bacteria 3886130
277 8022654827 8022653035 Bacteria 4035078
278 8022793379 8022792930 Bacteria 5693794
279 8022898527 8022893055 Bacteria 5300455
280 8022950209 8022948649 Bacteria 5366783
281 8023443602 8023438354 Bacteria 5779374
282 8023445582 8023444577 Bacteria 5661597
283 8051954787 8051952484 Bacteria 3926774
284 8052176506 8052174270 Bacteria 3881265
285 8054280759 8054280661 Bacteria 4232245
286 8055535972 8055531788 Bacteria 5249694
287 8055636531 8055632911 Bacteria 5283357
288 8056535501 8056533031 Bacteria 8964429
289 8057587130 8057582654 Bacteria 5218944
290 8057635870 8057632132 Bacteria 4726859
291 8057736252 8057733483 Bacteria 6578323
292 JGI25162J39368_1006271
293 JGI25159J45721_1004377
294 JGI25151J46595_10000046
295 JGI25151J46595_10002100
296 JGI25151J46595_10008706
297 JGI25151J46595_10010936
298 JGI25151J46595_10010940
299 JGI25151J46595_10033178
300 JGI25151J46595_10037690
301 rootH1_10000644
302 rootL2_10013974
303 rootH1_10079273
304 Ga0006562J51391_1008343
305 Ga0006562J51391_1008345
306 Ga0055538_1003188
307 Ga0055532_1000088
308 Ga0055536_1007244
309 Ga0055528_1015435
310 Ga0105251_10012021
311 Ga0105251_10040265
312 Ga0105244_10021915
313 Ga0105244_10073874
314 Ga0105250_10004406
315 Ga0105250_10060193
316 Ga0105245_10040999
317 Ga0105247_10005449
318 Ga0105243_10002375
319 Ga0105242_10019167
320 Ga0105249_10238541
321 Ga0105239_10149703
322 Ga0105246_10002601
323 Ga0105246_10002941
324 Ga0105246_10010303
325 Ga0157371_10008633
326 Ga0157376_10059728
327 Ga0209784_100648
328 Ga0209566_100082
329 Ga0209147_100058
330 Ga0209147_100231
331 Ga0209147_100498
332 Ga0209147_102124
333 Ga0209437_100569
334 Ga0209673_1002530
335 Ga0209130_1003086
336 Ga0209130_1003136
337 Ga0209130_1005434
338 Ga0209676_1000574
339 Ga0209025_1000001
340 Ga0209025_1000780
341 Ga0209025_1000801
342 Ga0209025_1001403
343 Ga0209025_1001470
344 Ga0209025_1001834
345 Ga0209025_1003512
346 Ga0209025_1003683
347 Ga0209025_1006513
348 Ga0209025_1008547
349 Ga0209025_1015142
350 Ga0209025_1016674
351 Ga0209025_1016756
352 Ga0209025_1017569
353 Ga0209025_1039302
354 Ga0209025_1047208
355 Ga0207696_1001538
356 Ga0207696_1002417
357 Ga0207696_1008565
358 Ga0207696_1026707
359 Ga0207655_1002224
360 Ga0207655_1006335
361 Ga0207655_1014809
362 Ga0207713_1000495
363 Ga0207713_1046520
364 Ga0207709_10092355
365 Ga0209371_1013011
366 Ga0237817_10172
367 Ga0237817_10178
368 Ga0268256_1014264
369 Ga0307408_100023784
370 Ga0307408_100138690
371 Ga0307409_100037716
372 Ga0307416_100068369
373 Ga0237819_00267
374 Ga0237819_01220
375 Ga0439436_0002455
376 Ga0439439_0000235
377 Ga0439433_0001411
378 Ga0451577_0000019
379 Ga0453684_0000057
380 Ga0466967_0000061
381 Ga0495585_0007738
382 Ga0495622_0044347
383 Ga0495660_0027668
384 Ga0495683_0027596
385 Ga0496100_0000652
386 Ga0496101_0002388
387 Ga0496102_0001279
388 Ga0496104_0021700
389 Ga0496105_0000067
390 Ga0496106_0002480
391 Ga0496107_0000130
392 Ga0496108_0001894
393 Ga0496109_0001748
394 Ga0496110_0000405
395 Ga0496110_0000447
396 Ga0496110_0002851
397 Ga0496111_0002212
398 Ga0496111_0009845
399 Ga0496112_0000487
400 Ga0496112_0071412
401 Ga0496113_0001262
402 Ga0496116_0007293
403 Ga0496116_0016398
404 Ga0496117_0005208
405 Ga0496119_0003518
406 Ga0496119_0005014
407 Ga0496121_0126600
408 Ga0496122_0038681
409 Ga0496122_0044471
410 Ga0496122_0113520
411 Ga0496122_0140975
412 Ga0496123_0006478
413 Ga0496123_0035930
414 Ga0496123_0036687
415 Ga0496124_0001554
416 Ga0496124_0022744
417 Ga0496124_0052789
418 Ga0496124_0130194
419 Ga0496125_0001304
420 Ga0496125_0004186
421 Ga0496125_0005510
422 Ga0496125_0014445
423 Ga0496126_0004419
424 8022917677
425 2511700681
426 2540607889
427 2545557379
428 2553396266
429 2555469958
430 2556064273
431 2578931645
432 2595090878
433 2600200102
434 2600402153
435 2631983559
436 2643738587
437 2644706315
438 2644712996
439 2644715472
440 2644726776
441 2644741545
442 2651532601
443 2672337468
444 2674418497
445 2685152689
446 2686997968
447 2687499311
448 2695628671
449 2698320486
450 2705996601
451 2712196626
452 2717915632
453 2721507841
454 2723602114
455 2730138180
456 2738815572
457 2738840565
458 2739157534
459 2739209626
460 2739229809
461 2739270580
462 2753812352
463 2757568535
464 2777763549
465 2777835763
466 2791214877
467 2793184993
468 2802439919
469 2808869820
470 2809056256
471 2812317164
472 2816862119
473 2817481261
474 2819570937
475 2819581588
476 2819628893
477 2819675929
478 2819708940
479 2819724243
480 2821118079
481 2823529128
482 2842684977
483 2842884822
484 2849141537
485 2852676019
486 2857458964
487 2857464554
488 2857584030
489 2857589273
490 2857604648
491 2857610496
492 2860840668
493 2864738541
494 2877771594
495 2880172440
496 2881648304
497 2885528531
498 2889043175
499 2889278183
500 2897112712
501 2904117138
502 2904168447
503 2904496761
504 2904524148
505 2904564041
506 2904598112
507 2904609663
508 2908667667
509 2915602901
510 2916975118
511 2919095461
512 2919147275
513 2919166103
514 2919417242
515 2919519180
516 2919723547
517 2919728831
518 2928095926
519 2928514480
520 2929006704
521 2929187958
522 2929238385
523 2931386637
524 2936342048
525 2936362179
526 2938922583
527 2939596474
528 2939684943
529 2939707340
530 2945994753
531 2946057548
532 2947431468
533 2954773330
534 2956897763
535 2960319544
536 2960381245
537 2962293886
538 2964379472
539 2965766176
540 2969139873
541 2969144037
542 2969769659
543 2969772722
544 2971896262
545 2977256226
546 2979088374
547 2980182385
548 2980495662
549 2984532559
550 2984533816
551 2990277111
552 2996706911
553 3001268823
554 3001274290
555 3001897423
556 3006827482
557 3006861681
558 3006882154
559 3006971716
560 3006976283
561 3006982261
562 3006984149
563 3006988540
564 648168618
565 8022624636
566 8022632321
567 8022654827
568 8022793379
569 8022898527
570 8022950209
571 8023443602
572 8023445582
573 8051954787
574 8052176506
575 8054280759
576 8055535972
577 8055636531
578 8056535501
579 8057587130
580 8057635870
581 8057736252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03486

HI0933_like

HI0933-like protein Rossmann domain

63

474

1

PF22780

HI0933_like_1st

HI0933-like protein barrel and H2TH domain

252

420

0.97

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

67

104

0.96

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

118

233

0.83

PF00890

FAD_binding_2

FAD binding domain

64

464

0.75

PF12831

FAD_oxidored

FAD dependent oxidoreductase

64

224

0.7

PF01134

GIDA

Glucose inhibited division protein A

165

482

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6smt-assembly1.cif.gz_B s-enantioselective imine reductase from mycobacterium smegmatis 0.9688 3 32
5a9r-assembly1.cif.gz_A apo form of imine reductase from amycolatopsis orientalis 0.9537 3 35
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.9535 3 31
5a9s-assembly1.cif.gz_B nadph complex of imine reductase from amycolatopsis orientalis 0.9499 3 32
2i0z-assembly1.cif.gz_A crystal structure of a fad binding protein from bacillus cereus, a putative nad(fad)-utilizing dehydrogenases 0.9444 2 416
ID Description Score Start End Superfamily
af_O61709_2_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9704 4 32 3.40.50.720
6hrdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9704 3 32 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9682 3 32 3.40.50.720
3llvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 1 34 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 3 32 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Y3Q5G0-F1-model_v4 FAD-dependent oxidoreductase 2 FAD binding domain-containing protein 0.9928 1 133
AF-A0A661V2P8-F1-model_v4 Aminoacetone oxidase family FAD-binding enzyme 0.9818 1 119
AF-A0A7V3KZ58-F1-model_v4 FAD-binding protein 0.9811 2 162
AF-A0A3M8CP93-F1-model_v4 Aminoacetone oxidase family FAD-binding enzyme 0.98 1 182
AF-A0A533S8F1-F1-model_v4 FAD-binding protein 0.976 3 146

Map