F390102

General Info

Members Datasets Scaffolds Average Seq Length
290 214 173 301

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3005710791|3005712796
Length 326
Sequence RPAAFVAIPLALVAAGALLYVMRNSAPPAAIVGVVRSTEVRVEPEVGGQLQSIAVEKGAHVRAGDILAQLSAVELTAQADQARAALASVTANRDNVYAGVRREQVDSLKAAIAKAGARLDFVQAQLTRTSTLARQSFESQQSLDQAENDVASARADVAEAQANYDAAVAGPTREERAIADAQVQAATTAVAVLERRLDKMVLRAPADGVVSVIAAEVGENVRAGQPILMVEAAGKRWLSFNVREDHLDRLAMGATTDVMRNGAAVPMKAVITELRPLGVFATWQAERVIGDHDRNTLRLRLDPKGELADLEPGMTVWIDHSIPPPQ

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
8 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
11 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
12 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
13 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
14 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
15 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
18 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
19 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
20 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
21 2904699407
22 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
23 2906610324
24 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
25 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
26 2922368715
27 2922425934
28 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
29 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
30 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
31 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
32 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
33 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
34 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
35 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
36 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
37 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
38 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
39 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
40 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
41 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
42 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
43 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
44 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
45 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
46 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
47 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
48 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
49 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
50 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
51 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
52 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
53 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
54 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
55 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
56 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
57 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
58 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
59 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
60 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
61 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
62 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
63 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
64 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
65 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
66 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
67 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
68 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
69 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
70 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
71 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
72 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
73 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
74 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
78 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
202 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
203 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
204 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
205 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
206 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
207 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
208 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
209 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
210 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
211 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
212 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
213 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
214 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.49
Metatranscriptomes 0
Isolates 39.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 34.48
Rhizoplane 5.17
Rhizosphere 40.69
Stem 0
Stem Tuber 0
Unclassified 14.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055543_1002635 3300004625 Bacteria 5780
2 Ga0065165_1000363 3300005262 Bacteria 74442
3 Ga0068869_100106116 3300005334 Bacteria 2131
4 Ga0070709_10002286 3300005434 Bacteria 10397
5 Ga0070709_10056606 3300005434 Bacteria 2480
6 Ga0070714_100001315 3300005435 Bacteria 17947
7 Ga0070714_100395541 3300005435 Unclassified 1305
8 Ga0070713_100007124 3300005436 Bacteria 7819
9 Ga0070713_100015117 3300005436 Bacteria 5753
10 Ga0070713_100310589 3300005436 Bacteria 1454
11 Ga0070713_100345032 3300005436 Bacteria 1380
12 Ga0070710_10001275 3300005437 Bacteria 11967
13 Ga0070710_10114377 3300005437 Bacteria 1625
14 Ga0070711_100071178 3300005439 Bacteria 2450
15 Ga0070681_10054244 3300005458 Bacteria 3994
16 Ga0070706_100431119 3300005467 Bacteria 1227
17 Ga0070698_100237447 3300005471 Bacteria 1756
18 Ga0070697_100328160 3300005536 Bacteria 1319
19 Ga0070665_100004411 3300005548 Bacteria 14786
20 Ga0068857_100254357 3300005577 Bacteria 1611
21 Ga0068859_100521516 3300005617 Bacteria 1283
22 Ga0068870_10289966 3300005840 Bacteria 1029
23 Ga0068863_100020098 3300005841 Bacteria 6388
24 Ga0068860_100000071 3300005843 Bacteria 178413
25 Ga0068862_100140970 3300005844 Bacteria 2140
26 Ga0081540_1005817 3300005983 Bacteria 9123
27 Ga0081540_1007832 3300005983 Bacteria 7557
28 Ga0081540_1029922 3300005983 Bacteria 3025
29 Ga0081540_1031975 3300005983 Bacteria 2880
30 Ga0070717_10008198 3300006028 Bacteria 7802
31 Ga0070717_10130513 3300006028 Bacteria 2161
32 Ga0070717_10374583 3300006028 Bacteria 1276
33 Ga0070715_10009365 3300006163 Bacteria 3451
34 Ga0070716_100000796 3300006173 Bacteria 13518
35 Ga0070712_100007573 3300006175 Bacteria 6787
36 Ga0070712_100333254 3300006175 Bacteria 1237
37 Ga0075369_10170741 3300006186 Bacteria 999
38 Ga0075434_100046234 3300006871 Bacteria 4320
39 Ga0075434_100047832 3300006871 Bacteria 4244
40 Ga0097620_100521553 3300006931 Bacteria 1283
41 Ga0157369_10211315 3300013105 Bacteria 2033
42 Ga0157375_10050830 3300013308 Bacteria 4067
43 Ga0214544_1003798 3300021320 Bacteria 30812
44 Ga0209233_1009962 3300025261 Bacteria 2868
45 Ga0209256_1021533 3300025299 Bacteria 1975
46 Ga0209257_1004841 3300025304 Bacteria 9968
47 Ga0207692_10000199 3300025898 Bacteria 20003
48 Ga0207685_10032380 3300025905 Bacteria 1881
49 Ga0207699_10178624 3300025906 Bacteria 1425
50 Ga0207684_10073334 3300025910 Bacteria 2907
51 Ga0207693_10006359 3300025915 Bacteria 9788
52 Ga0207663_10001700 3300025916 Bacteria 10350
53 Ga0207700_10002029 3300025928 Bacteria 11578
54 Ga0207664_10120750 3300025929 Bacteria 2192
55 Ga0207664_10172952 3300025929 Bacteria 1850
56 Ga0207665_10000154 3300025939 Bacteria 46682
57 Ga0207689_10067576 3300025942 Bacteria 2937
58 Ga0207668_10109534 3300025972 Bacteria 2069
59 Ga0207703_10134956 3300026035 Bacteria 2135
60 Ga0207641_10030284 3300026088 Bacteria 4483
61 Ga0209588_1001763 3300027671 Bacteria 5739
62 Ga0268265_10237791 3300028380 Bacteria 1605
63 Ga0268264_10000073 3300028381 Bacteria 260615
64 Ga0268264_10171957 3300028381 Bacteria 1960
65 Ga0268264_10554182 3300028381 Bacteria 1128
66 Ga0307508_10000092 3300031616 Bacteria 105585
67 Ga0265314_10001980 3300031711 Bacteria 21759
68 Ga0307516_10075612 3300031730 Bacteria 3222
69 Ga0307507_10025202 3300033179 Bacteria 6459
70 Ga0307510_10008458 3300033180 Bacteria 12263
71 Ga0307510_10012589 3300033180 Bacteria 10029
72 Ga0307510_10212835 3300033180 Bacteria 1453
73 Ga0373956_0106769 3300035119 Bacteria 1302
74 Ga0373946_0103216 3300035171 Bacteria 1281
75 Ga0373935_0008432 3300035692 Bacteria 6167
76 Ga0373927_0002480 3300035695 Bacteria 13468
77 Ga0373927_0009391 3300035695 Bacteria 6561
78 Ga0373927_0104659 3300035695 Unclassified 1843
79 Ga0373947_0045818 3300035725 Bacteria 2617
80 Ga0373947_0177728 3300035725 Bacteria 1384
81 Ga0395900_0189785 3300037418 Bacteria 2085
82 Ga0395900_0228763 3300037418 Bacteria 1871
83 Ga0395898_0021929 3300037466 Bacteria 6470
84 Ga0395898_0050750 3300037466 Bacteria 4059
85 Ga0395905_0037508 3300037471 Bacteria 4550
86 Ga0436365_1910825 3300039437 Bacteria 2512
87 Ga0436360_0071764 3300039438 Bacteria 2037
88 Ga0436361_0466958 3300039447 Bacteria 1383
89 Ga0436363_1102080 3300039450 Unclassified 1703
90 Ga0436362_0598408 3300039453 Bacteria 1999
91 Ga0495629_0005828 3300046459 Bacteria 9190
92 Ga0495638_0004919 3300046460 Bacteria 10042
93 Ga0495651_0197168 3300046462 Bacteria 1412
94 Ga0495580_0098762 3300046472 Bacteria 2031
95 Ga0495582_0057899 3300046473 Bacteria 2137
96 Ga0495639_0093808 3300046475 Bacteria 1411
97 Ga0495583_0095953 3300046506 Bacteria 1271
98 Ga0495606_0009172 3300046507 Bacteria 8416
99 Ga0495606_0131697 3300046507 Bacteria 1486
100 Ga0495608_0206772 3300046511 Bacteria 1235
101 Ga0495618_0085270 3300046514 Bacteria 2019
102 Ga0495648_0001190 3300046524 Bacteria 26086
103 Ga0495648_0137474 3300046524 Bacteria 1290
104 Ga0495652_0027794 3300046529 Bacteria 4983
105 Ga0495652_0028096 3300046529 Bacteria 4954
106 Ga0495640_0013919 3300046533 Bacteria 6105
107 Ga0495640_0110030 3300046533 Bacteria 1801
108 Ga0495622_0015389 3300046557 Bacteria 3555
109 Ga0495622_0041921 3300046557 Bacteria 2129
110 Ga0495667_0158450 3300046559 Bacteria 1456
111 Ga0495668_0087452 3300046616 Bacteria 1709
112 Ga0495634_0069618 3300046642 Bacteria 2321
113 Ga0495625_0066692 3300046660 Bacteria 2535
114 Ga0495635_0005560 3300046663 Bacteria 8772
115 Ga0495657_0024823 3300046675 Bacteria 4263
116 Ga0495623_0025127 3300046679 Bacteria 3837
117 Ga0495671_0100303 3300046692 Bacteria 1416
118 Ga0495649_0027036 3300046694 Bacteria 3185
119 Ga0495600_0042504 3300046809 Bacteria 2963
120 Ga0495581_0014130 3300047315 Bacteria 4627
121 Ga0495604_0051801 3300047317 Bacteria 3180
122 Ga0495674_0117277 3300047319 Bacteria 2252
123 Ga0495676_0062976 3300047321 Bacteria 2893
124 Ga0495676_0081813 3300047321 Bacteria 2446
125 Ga0495680_0013460 3300047322 Bacteria 7135
126 Ga0495680_0141011 3300047322 Bacteria 1764
127 Ga0495675_0004002 3300047444 Bacteria 8928
128 Ga0495602_0131040 3300048088 Bacteria 2000
129 Ga0496100_0334585 3300048903 Unclassified 1140
130 Ga0496102_0082819 3300048905 Bacteria 2959
131 Ga0496102_0247732 3300048905 Bacteria 1680
132 Ga0496104_0022926 3300048907 Bacteria 5737
133 Ga0496104_0336035 3300048907 Bacteria 1423
134 Ga0496105_0018613 3300048908 Bacteria 5589
135 Ga0496107_0104293 3300048910 Bacteria 2081
136 Ga0496107_0365397 3300048910 Bacteria 1073
137 Ga0496109_0448404 3300048912 Bacteria 1219
138 Ga0496109_0786602 3300048912 Unclassified 889
139 Ga0496111_0076562 3300048914 Bacteria 2439
140 Ga0496113_0259518 3300048916 Bacteria 1388
141 Ga0496115_0123172 3300048918 Bacteria 2134
142 Ga0496115_0148899 3300048918 Bacteria 1932
143 Ga0496115_0294970 3300048918 Bacteria 1329
144 Ga0496118_0029143 3300048921 Bacteria 4635
145 Ga0496118_0173627 3300048921 Bacteria 1313
146 Ga0496119_0164526 3300048922 Bacteria 1176
147 Ga0496120_0005572 3300048923 Bacteria 10004
148 Ga0496121_0000578 3300048924 Bacteria 68826
149 Ga0496121_0186243 3300048924 Bacteria 1493
150 Ga0496121_0261456 3300048924 Bacteria 1195
151 Ga0496124_0200864 3300048927 Bacteria 1516
152 Ga0496125_0081026 3300048928 Bacteria 2482
153 Ga0496126_0000602 3300048929 Bacteria 67975
154 Ga0496126_0006376 3300048929 Bacteria 13162
155 Ga0496126_0035983 3300048929 Bacteria 4634
156 Ga0496126_0139886 3300048929 Bacteria 2085
157 Ga0496126_0152849 3300048929 Bacteria 1977
158 Ga0496126_0332975 3300048929 Bacteria 1245
159 Ga0495682_0006909 3300049460 Bacteria 4559
160 Ga0495682_0082235 3300049460 Bacteria 1158
161 nmdc:mga0yw44_102128_c1 3300050492 Bacteria 1828
162 nmdc:mga07m45_119820_c1 3300050496 Bacteria 1520
163 nmdc:mga0n895_32537_c1 3300050512 Bacteria 5006
164 nmdc:mga0n895_50480_c1 3300050512 Bacteria 4078
165 nmdc:mga0sz30_22321_c1 3300050516 Bacteria 2568
166 Ga0495601_0006940 3300053077 Bacteria 6632
167 Ga0500635_0010477 3300053080 Bacteria 2605
168 Ga0500578_0076385 3300053086 Bacteria 2133
169 Ga0500578_0272466 3300053086 Bacteria 1012
170 Ga0500566_0037322 3300053094 Bacteria 2816
171 Ga0500556_0003155 3300053104 Bacteria 4910
172 Ga0500638_027365 3300053162 Bacteria 2736
173 Ga0500636_0015563 3300053177 Bacteria 4483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0786602 Ga0496109_0786602_24_818 204
2 iso_pu_bacteria 8019576017 8019583370 211
3 3300035171 Ga0373946_0103216 Ga0373946_0103216_393_1253 222
4 3300046472 Ga0495580_0098762 Ga0495580_0098762_1167_2006 222
5 3300035119 Ga0373956_0106769 Ga0373956_0106769_62_1039 238
6 3300050512 nmdc:mga0n895_50480_c1 nmdc:mga0n895_50480_c1_2606_3475 238
7 3300005436 Ga0070713_100007124 Ga0070713_1000071243 240
8 3300025928 Ga0207700_10002029 Ga0207700_100020299 240
9 3300025929 Ga0207664_10172952 Ga0207664_101729522 240
10 3300048929 Ga0496126_0152849 Ga0496126_0152849_445_1410 241
11 3300028381 Ga0268264_10171957 Ga0268264_101719572 244
12 3300048922 Ga0496119_0164526 Ga0496119_0164526_100_1065 244
13 iso_pu_bacteria 8017057580 8017064046 244
14 3300035695 Ga0373927_0009391 Ga0373927_0009391_3187_4158 245
15 3300053080 Ga0500635_0010477 Ga0500635_0010477_1541_2512 245
16 3300046660 Ga0495625_0066692 Ga0495625_0066692_1590_2516 246
17 3300033179 Ga0307507_10025202 Ga0307507_100252023 248
18 3300035692 Ga0373935_0008432 Ga0373935_0008432_828_1799 248
19 3300048921 Ga0496118_0029143 Ga0496118_0029143_980_1945 248
20 3300053094 Ga0500566_0037322 Ga0500566_0037322_1545_2516 248
21 3300053177 Ga0500636_0015563 Ga0500636_0015563_2485_3456 248
22 3300048929 Ga0496126_0332975 Ga0496126_0332975_214_1191 251
23 3300005841 Ga0068863_100020098 Ga0068863_1000200984 252
24 3300005844 Ga0068862_100140970 Ga0068862_1001409702 252
25 3300025972 Ga0207668_10109534 Ga0207668_101095342 252
26 3300026088 Ga0207641_10030284 Ga0207641_100302847 252
27 3300027671 Ga0209588_1001763 Ga0209588_10017633 252
28 3300028380 Ga0268265_10237791 Ga0268265_102377912 252
29 3300039437 Ga0436365_1910825 Ga0436365_1910825_572_1543 252
30 3300048910 Ga0496107_0104293 Ga0496107_0104293_652_1626 252
31 3300048921 Ga0496118_0173627 Ga0496118_0173627_24_998 252
32 3300048924 Ga0496121_0000578 Ga0496121_0000578_61791_62765 252
33 3300048929 Ga0496126_0000602 Ga0496126_0000602_62930_63904 252
34 3300050492 nmdc:mga0yw44_102128_c1 nmdc:mga0yw44_102128_c1_523_1494 252
35 3300050496 nmdc:mga07m45_119820_c1 nmdc:mga07m45_119820_c1_72_1043 252
36 3300005983 Ga0081540_1031975 Ga0081540_10319752 253
37 3300046533 Ga0495640_0110030 Ga0495640_0110030_833_1789 253
38 3300050512 nmdc:mga0n895_32537_c1 nmdc:mga0n895_32537_c1_758_1726 253
39 3300053162 Ga0500638_027365 Ga0500638_027365_1086_2012 253
40 3300005435 Ga0070714_100395541 Ga0070714_1003955412 254
41 3300005458 Ga0070681_10054244 Ga0070681_100542442 254
42 3300005548 Ga0070665_100004411 Ga0070665_1000044112 254
43 3300006028 Ga0070717_10374583 Ga0070717_103745832 254
44 3300048903 Ga0496100_0334585 Ga0496100_0334585_155_1114 254
45 3300031730 Ga0307516_10075612 Ga0307516_100756122 255
46 3300046559 Ga0495667_0158450 Ga0495667_0158450_500_1426 255
47 3300046679 Ga0495623_0025127 Ga0495623_0025127_1780_2706 255
48 3300048905 Ga0496102_0247732 Ga0496102_0247732_441_1412 255
49 3300005434 Ga0070709_10002286 Ga0070709_100022861 256
50 3300005435 Ga0070714_100001315 Ga0070714_1000013151 256
51 3300005436 Ga0070713_100015117 Ga0070713_1000151171 256
52 3300005437 Ga0070710_10001275 Ga0070710_100012756 256
53 3300006028 Ga0070717_10008198 Ga0070717_100081982 256
54 3300006163 Ga0070715_10009365 Ga0070715_100093652 256
55 3300006173 Ga0070716_100000796 Ga0070716_1000007967 256
56 3300006175 Ga0070712_100007573 Ga0070712_1000075731 256
57 3300025898 Ga0207692_10000199 Ga0207692_100001994 256
58 3300025905 Ga0207685_10032380 Ga0207685_100323802 256
59 3300025906 Ga0207699_10178624 Ga0207699_101786242 256
60 3300025915 Ga0207693_10006359 Ga0207693_100063595 256
61 3300025916 Ga0207663_10001700 Ga0207663_100017003 256
62 3300025929 Ga0207664_10120750 Ga0207664_101207502 256
63 3300025939 Ga0207665_10000154 Ga0207665_100001545 256
64 3300028381 Ga0268264_10554182 Ga0268264_105541822 258
65 3300035725 Ga0373947_0177728 Ga0373947_0177728_150_1124 258
66 3300046524 Ga0495648_0001190 Ga0495648_0001190_1052_2023 258
67 3300046616 Ga0495668_0087452 Ga0495668_0087452_173_1135 258
68 3300047319 Ga0495674_0117277 Ga0495674_0117277_1195_2169 258
69 3300048914 Ga0496111_0076562 Ga0496111_0076562_456_1427 258
70 3300005439 Ga0070711_100071178 Ga0070711_1000711781 259
71 3300005617 Ga0068859_100521516 Ga0068859_1005215161 259
72 3300005983 Ga0081540_1007832 Ga0081540_10078323 259
73 3300006931 Ga0097620_100521553 Ga0097620_1005215531 259
74 3300035695 Ga0373927_0104659 Ga0373927_0104659_96_1070 259
75 3300046642 Ga0495634_0069618 Ga0495634_0069618_1128_2102 259
76 3300048918 Ga0496115_0148899 Ga0496115_0148899_811_1788 259
77 3300053077 Ga0495601_0006940 Ga0495601_0006940_4413_5387 259
78 3300006028 Ga0070717_10130513 Ga0070717_101305132 260
79 iso_pu_bacteria 2874628541 2874632574 260
80 3300006871 Ga0075434_100046234 Ga0075434_1000462343 261
81 3300005536 Ga0070697_100328160 Ga0070697_1003281602 263
82 3300037418 Ga0395900_0189785 Ga0395900_0189785_1081_2025 263
83 3300037466 Ga0395898_0050750 Ga0395898_0050750_2142_3086 263
84 3300037471 Ga0395905_0037508 Ga0395905_0037508_866_1810 263
85 3300046460 Ga0495638_0004919 Ga0495638_0004919_3982_4956 263
86 3300046692 Ga0495671_0100303 Ga0495671_0100303_256_1230 263
87 3300048907 Ga0496104_0022926 Ga0496104_0022926_800_1786 263
88 3300053104 Ga0500556_0003155 Ga0500556_0003155_2176_3147 264
89 iso_pu_bacteria 2885409591 2885410205 264
90 3300005436 Ga0070713_100310589 Ga0070713_1003105892 265
91 3300006175 Ga0070712_100333254 Ga0070712_1003332541 265
92 3300053086 Ga0500578_0076385 Ga0500578_0076385_1049_2023 265
93 iso_pu_bacteria 8019555841 8019559366 265
94 iso_pu_bacteria 8019565922 8019565933 265
95 3300005843 Ga0068860_100000071 Ga0068860_100000071104 266
96 3300005983 Ga0081540_1029922 Ga0081540_10299222 266
97 3300025261 Ga0209233_1009962 Ga0209233_10099622 266
98 3300028381 Ga0268264_10000073 Ga0268264_10000073170 266
99 3300033180 Ga0307510_10212835 Ga0307510_102128352 266
100 3300035695 Ga0373927_0002480 Ga0373927_0002480_9598_10569 266
101 3300035725 Ga0373947_0045818 Ga0373947_0045818_530_1501 266
102 3300046475 Ga0495639_0093808 Ga0495639_0093808_119_1090 266
103 3300046524 Ga0495648_0137474 Ga0495648_0137474_169_1131 266
104 3300047321 Ga0495676_0081813 Ga0495676_0081813_1084_2055 266
105 3300048918 Ga0496115_0123172 Ga0496115_0123172_1026_1997 266
106 3300049460 Ga0495682_0082235 Ga0495682_0082235_68_1030 266
107 iso_pu_bacteria 2932794094 2932797125 266
108 iso_pu_bacteria 2932801729 2932807474 266
109 iso_pu_bacteria 3005710791 3005711239 266
110 3300005840 Ga0068870_10289966 Ga0068870_102899661 267
111 3300006871 Ga0075434_100047832 Ga0075434_1000478323 267
112 3300021320 Ga0214544_1003798 Ga0214544_10037985 267
113 3300025304 Ga0209257_1004841 Ga0209257_100484111 267
114 3300031616 Ga0307508_10000092 Ga0307508_1000009226 267
115 3300046462 Ga0495651_0197168 Ga0495651_0197168_184_1146 267
116 3300046473 Ga0495582_0057899 Ga0495582_0057899_318_1280 267
117 3300046514 Ga0495618_0085270 Ga0495618_0085270_42_1004 267
118 3300046529 Ga0495652_0027794 Ga0495652_0027794_1674_2636 267
119 3300046533 Ga0495640_0013919 Ga0495640_0013919_433_1395 267
120 3300046663 Ga0495635_0005560 Ga0495635_0005560_6784_7746 267
121 3300047315 Ga0495581_0014130 Ga0495581_0014130_1581_2543 267
122 3300047317 Ga0495604_0051801 Ga0495604_0051801_379_1341 267
123 3300047322 Ga0495680_0141011 Ga0495680_0141011_307_1269 267
124 3300048088 Ga0495602_0131040 Ga0495602_0131040_988_1950 267
125 3300048929 Ga0496126_0139886 Ga0496126_0139886_970_1941 267
126 3300005434 Ga0070709_10056606 Ga0070709_100566062 268
127 3300005471 Ga0070698_100237447 Ga0070698_1002374472 268
128 3300025910 Ga0207684_10073334 Ga0207684_100733342 268
129 3300046459 Ga0495629_0005828 Ga0495629_0005828_4861_5823 268
130 3300046511 Ga0495608_0206772 Ga0495608_0206772_14_982 268
131 3300046529 Ga0495652_0028096 Ga0495652_0028096_587_1555 268
132 3300046557 Ga0495622_0015389 Ga0495622_0015389_297_1259 268
133 3300046675 Ga0495657_0024823 Ga0495657_0024823_74_1036 268
134 3300047322 Ga0495680_0013460 Ga0495680_0013460_5819_6787 268
135 3300048905 Ga0496102_0082819 Ga0496102_0082819_503_1465 268
136 3300048907 Ga0496104_0336035 Ga0496104_0336035_366_1328 268
137 3300048908 Ga0496105_0018613 Ga0496105_0018613_2204_3166 268
138 3300048916 Ga0496113_0259518 Ga0496113_0259518_49_1011 268
139 3300048923 Ga0496120_0005572 Ga0496120_0005572_5884_6846 268
140 3300048924 Ga0496121_0186243 Ga0496121_0186243_313_1284 268
141 3300048927 Ga0496124_0200864 Ga0496124_0200864_88_1050 268
142 3300048928 Ga0496125_0081026 Ga0496125_0081026_480_1442 268
143 3300048929 Ga0496126_0035983 Ga0496126_0035983_2227_3189 268
144 iso_pu_bacteria 2508501128 2509148665 268
145 iso_pu_bacteria 2513237098 2513671369 268
146 iso_pu_bacteria 2513237141 2513889142 268
147 iso_pu_bacteria 2524023210 2524467000 268
148 iso_pu_bacteria 2524023228 2524534564 268
149 iso_pu_bacteria 2791355197 2793071274 268
150 iso_pu_bacteria 2824753945 2824757842 268
151 iso_pu_bacteria 2824763712 2824768647 268
152 iso_pu_bacteria 2876761206 2876770180 268
153 iso_pu_bacteria 2885383462 2885384611 268
154 iso_pu_bacteria 2885409591 2885414443 268
155 iso_pu_bacteria 2903748898 2903754133 268
156 iso_pu_bacteria 2903768456 2903775647 268
157 iso_pu_bacteria 2904690495 2904698241 268
158 iso_pu_bacteria 2904699407 2904705951 268
159 iso_pu_bacteria 2904711408 2904711690 268
160 iso_pu_bacteria 2906610324 2906611527 268
161 iso_pu_bacteria 2908756301 2908762842 268
162 iso_pu_bacteria 2922425934 2922427829 268
163 iso_pu_bacteria 2932809354 2932816206 268
164 iso_pu_bacteria 2935908558 2935915697 268
165 iso_pu_bacteria 2935916978 2935924300 268
166 iso_pu_bacteria 2935926038 2935933087 268
167 iso_pu_bacteria 2935934488 2935941596 268
168 iso_pu_bacteria 2935942939 2935950074 268
169 iso_pu_bacteria 2935951376 2935958558 268
170 iso_pu_bacteria 2935959822 2935961541 268
171 iso_pu_bacteria 2935967501 2935974659 268
172 iso_pu_bacteria 3005474847 3005477541 268
173 iso_pu_bacteria 8006933436 8006933693 268
174 iso_pu_bacteria 8006973647 8006983365 268
175 iso_pu_bacteria 8016630954 8016631185 268
176 iso_pu_bacteria 8019555841 8019559624 268
177 iso_pu_bacteria 8019565922 8019569730 268
178 iso_pu_bacteria 8019687851 8019691829 268
179 iso_pu_bacteria 8056681323 8056685863 268
180 3300005983 Ga0081540_1005817 Ga0081540_10058172 269
181 3300006186 Ga0075369_10170741 Ga0075369_101707411 269
182 3300013105 Ga0157369_10211315 Ga0157369_102113153 269
183 3300013308 Ga0157375_10050830 Ga0157375_100508302 269
184 3300025299 Ga0209256_1021533 Ga0209256_10215332 269
185 3300033180 Ga0307510_10008458 Ga0307510_100084588 269
186 3300037418 Ga0395900_0228763 Ga0395900_0228763_847_1818 269
187 3300037466 Ga0395898_0021929 Ga0395898_0021929_3257_4228 269
188 3300046506 Ga0495583_0095953 Ga0495583_0095953_257_1222 269
189 3300046507 Ga0495606_0009172 Ga0495606_0009172_2963_3928 269
190 3300046694 Ga0495649_0027036 Ga0495649_0027036_485_1450 269
191 3300046809 Ga0495600_0042504 Ga0495600_0042504_1252_2220 269
192 3300047321 Ga0495676_0062976 Ga0495676_0062976_970_1932 269
193 3300047444 Ga0495675_0004002 Ga0495675_0004002_7134_8102 269
194 3300049460 Ga0495682_0006909 Ga0495682_0006909_1462_2427 269
195 3300050516 nmdc:mga0sz30_22321_c1 nmdc:mga0sz30_22321_c1_584_1552 269
196 iso_pu_bacteria 2524023205 2524437826 269
197 iso_pu_bacteria 2528768022 2528852535 269
198 iso_pu_bacteria 2744054633 2745082201 269
199 iso_pu_bacteria 2824661429 2824662232 269
200 iso_pu_bacteria 2879099564 2879107414 269
201 iso_pu_bacteria 2906626472 2906631856 269
202 iso_pu_bacteria 2922368715 2922370816 269
203 iso_pu_bacteria 2929615660 2929616981 269
204 iso_pu_bacteria 2929624759 2929625724 269
205 iso_pu_bacteria 2932784394 2932785514 269
206 iso_pu_bacteria 2932818245 2932819610 269
207 iso_pu_bacteria 2932828146 2932833227 269
208 iso_pu_bacteria 2932828146 2932837049 269
209 iso_pu_bacteria 2933577622 2933577737 269
210 iso_pu_bacteria 2935616580 2935616980 269
211 iso_pu_bacteria 2935616580 2935620617 269
212 iso_pu_bacteria 2935638405 2935639711 269
213 iso_pu_bacteria 2935665750 2935667451 269
214 iso_pu_bacteria 2935675223 2935675294 269
215 iso_pu_bacteria 2935675223 2935677490 269
216 iso_pu_bacteria 2935684952 2935687609 269
217 iso_pu_bacteria 2935684952 2935690567 269
218 iso_pu_bacteria 2935694250 2935697102 269
219 iso_pu_bacteria 2935703347 2935705191 269
220 iso_pu_bacteria 2935703347 2935711732 269
221 iso_pu_bacteria 2935713505 2935717737 269
222 iso_pu_bacteria 2935713505 2935719069 269
223 iso_pu_bacteria 2935722832 2935727113 269
224 iso_pu_bacteria 2935722832 2935728721 269
225 iso_pu_bacteria 2935732158 2935735883 269
226 iso_pu_bacteria 2935732158 2935736683 269
227 iso_pu_bacteria 2935741537 2935744846 269
228 iso_pu_bacteria 2935741537 2935746315 269
229 iso_pu_bacteria 2935750917 2935753575 269
230 iso_pu_bacteria 2935750917 2935755576 269
231 iso_pu_bacteria 2935801545 2935806937 269
232 iso_pu_bacteria 2935801545 2935810208 269
233 iso_pu_bacteria 2935810662 2935814232 269
234 iso_pu_bacteria 2935810662 2935818587 269
235 iso_pu_bacteria 2935827899 2935829194 269
236 iso_pu_bacteria 2935837841 2935845271 269
237 iso_pu_bacteria 2935837841 2935846847 269
238 iso_pu_bacteria 2935855204 2935855605 269
239 iso_pu_bacteria 2935855204 2935858425 269
240 iso_pu_bacteria 2935864058 2935870243 269
241 iso_pu_bacteria 2935864058 2935870944 269
242 iso_pu_bacteria 2935864058 2935872369 269
243 iso_pu_bacteria 2935873716 2935876030 269
244 iso_pu_bacteria 2935873716 2935877284 269
245 iso_pu_bacteria 2935992306 2935995096 269
246 iso_pu_bacteria 2936002035 2936006188 269
247 iso_pu_bacteria 2936002035 2936010665 269
248 iso_pu_bacteria 2936037263 2936039787 269
249 iso_pu_bacteria 2936037263 2936045204 269
250 iso_pu_bacteria 2940556831 2940559488 269
251 iso_pu_bacteria 2940556831 2940561143 269
252 iso_pu_bacteria 2941538514 2941545757 269
253 iso_pu_bacteria 2941538514 2941547304 269
254 iso_pu_bacteria 3005710791 3005712796 269
255 iso_pu_bacteria 8016511872 8016516825 269
256 iso_pu_bacteria 8017057580 8017059741 269
257 iso_pu_bacteria 8019576017 8019579218 269
258 iso_pu_bacteria 8019586578 8019591183 269
259 iso_pu_bacteria 8019586578 8019597275 269
260 iso_pu_bacteria 8019597564 8019600155 269
261 iso_pu_bacteria 8019597564 8019604419 269
262 iso_pu_bacteria 8019608314 8019618386 269
263 iso_pu_bacteria 8055742211 8055748627 269
264 3300005334 Ga0068869_100106116 Ga0068869_1001061161 270
265 3300033180 Ga0307510_10012589 Ga0307510_100125892 270
266 3300039438 Ga0436360_0071764 Ga0436360_0071764_651_1637 270
267 3300039447 Ga0436361_0466958 Ga0436361_0466958_161_1144 270
268 3300048910 Ga0496107_0365397 Ga0496107_0365397_33_1007 270
269 3300048912 Ga0496109_0448404 Ga0496109_0448404_156_1130 270
270 iso_pu_bacteria 2935630451 2935632237 271
271 iso_pu_bacteria 2941507105 2941508185 271
272 iso_pu_bacteria 2941515067 2941515309 271
273 iso_pu_bacteria 2941523033 2941524115 271
274 3300005436 Ga0070713_100345032 Ga0070713_1003450322 272
275 3300005437 Ga0070710_10114377 Ga0070710_101143772 272
276 3300005467 Ga0070706_100431119 Ga0070706_1004311192 272
277 3300031711 Ga0265314_10001980 Ga0265314_1000198017 272
278 3300039450 Ga0436363_1102080 Ga0436363_1102080_187_1173 272
279 3300039453 Ga0436362_0598408 Ga0436362_0598408_333_1307 272
280 3300048924 Ga0496121_0261456 Ga0496121_0261456_127_1098 272
281 3300048929 Ga0496126_0006376 Ga0496126_0006376_7174_8145 272
282 3300004625 Ga0055543_1002635 Ga0055543_10026351 273
283 3300005262 Ga0065165_1000363 Ga0065165_100036349 273
284 3300005577 Ga0068857_100254357 Ga0068857_1002543572 273
285 3300025942 Ga0207689_10067576 Ga0207689_100675762 273
286 3300026035 Ga0207703_10134956 Ga0207703_101349561 273
287 3300046507 Ga0495606_0131697 Ga0495606_0131697_459_1433 273
288 3300046557 Ga0495622_0041921 Ga0495622_0041921_35_1018 273
289 3300048918 Ga0496115_0294970 Ga0496115_0294970_153_1127 273
290 3300053086 Ga0500578_0272466 Ga0500578_0272466_27_1001 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

35

87

0.95

PF13437

HlyD_3

HlyD family secretion protein

201

313

0.83

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

29

275

0.8

Feature Viewer

pLDDT pTM Quality
73.54 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map