F390026

General Info

Members Datasets Scaffolds Average Seq Length
290 156 290 206

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0316761|Ga0501032_0316761_179_889
Length 236
Sequence MGPDFRPFLPPYFRFARYPPKLSAQGSFFGMKPILKSFVVAAALAGAPFLAAAPIQPAQAQAADPAVAQVQGFYDTLQASMKAGGTAKSRYEKLKPAVEKAFDLPAMTAAAVGPAWASASEADKKALVDAFSRMTIANYAKNFDSYSGEKFTVEPASIVRGNDHFVKSTMKTSSETIAFNYRLHQAGAEWKITDVLLAGNISQMAQKRSDFAGVLASGGPSALTKRINALSDQMLG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 0.34
Rhizosphere 97.24
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10004056 3300005327 Bacteria 12008
2 Ga0070658_10817687 3300005327 Bacteria 810
3 Ga0070676_10139258 3300005328 Bacteria 1543
4 Ga0070676_10379373 3300005328 Unclassified 979
5 Ga0070683_100097852 3300005329 Bacteria 2761
6 Ga0070683_100788028 3300005329 Unclassified 911
7 Ga0070690_100205405 3300005330 Bacteria 1373
8 Ga0070670_100609229 3300005331 Unclassified 978
9 Ga0068869_100255650 3300005334 Bacteria 1401
10 Ga0068869_100617883 3300005334 Unclassified 917
11 Ga0068869_100688763 3300005334 Bacteria 871
12 Ga0070666_10023144 3300005335 Bacteria 4041
13 Ga0070666_10573941 3300005335 Unclassified 822
14 Ga0070666_10761734 3300005335 Unclassified 712
15 Ga0070680_100049307 3300005336 Bacteria 3432
16 Ga0070680_100529182 3300005336 Unclassified 1009
17 Ga0068868_100359480 3300005338 Bacteria 1249
18 Ga0068868_100409612 3300005338 Bacteria 1171
19 Ga0068868_100620713 3300005338 Unclassified 960
20 Ga0070660_100005543 3300005339 Bacteria 8744
21 Ga0070660_100058587 3300005339 Bacteria 2985
22 Ga0070689_100585707 3300005340 Unclassified 965
23 Ga0070661_100197837 3300005344 Bacteria 1535
24 Ga0070661_100301323 3300005344 Bacteria 1248
25 Ga0070661_100316554 3300005344 Bacteria 1218
26 Ga0070675_100304597 3300005354 Unclassified 1404
27 Ga0070671_100434796 3300005355 Unclassified 1125
28 Ga0070673_100664454 3300005364 Unclassified 955
29 Ga0070667_100045702 3300005367 Bacteria 3682
30 Ga0070709_10629669 3300005434 Unclassified 829
31 Ga0070714_101009715 3300005435 Unclassified 810
32 Ga0070713_100225755 3300005436 Bacteria 1701
33 Ga0070713_100403595 3300005436 Bacteria 1277
34 Ga0070701_10369031 3300005438 Bacteria 901
35 Ga0070711_100192967 3300005439 Bacteria 1567
36 Ga0070700_100053891 3300005441 Unclassified 2512
37 Ga0070678_100018146 3300005456 Bacteria 4555
38 Ga0070678_100322749 3300005456 Bacteria 1319
39 Ga0070681_10706417 3300005458 Bacteria 924
40 Ga0068867_100016315 3300005459 Bacteria 5274
41 Ga0068867_100147424 3300005459 Bacteria 1846
42 Ga0070679_100015867 3300005530 Bacteria 7249
43 Ga0070679_100164107 3300005530 Bacteria 2195
44 Ga0070672_100654140 3300005543 Unclassified 918
45 Ga0070693_100362562 3300005547 Unclassified 995
46 Ga0070665_100005978 3300005548 Bacteria 12453
47 Ga0070665_100006286 3300005548 Bacteria 12135
48 Ga0070665_100009536 3300005548 Bacteria 9819
49 Ga0070665_100173167 3300005548 Bacteria 2159
50 Ga0070665_100353694 3300005548 Bacteria 1475
51 Ga0070665_100625688 3300005548 Unclassified 1089
52 Ga0068855_100078531 3300005563 Bacteria 3828
53 Ga0068857_100099799 3300005577 Bacteria 2604
54 Ga0068854_100484405 3300005578 Bacteria 1039
55 Ga0070702_100554278 3300005615 Unclassified 854
56 Ga0070702_100652760 3300005615 Unclassified 796
57 Ga0068852_100136048 3300005616 Bacteria 2269
58 Ga0068859_100629047 3300005617 Unclassified 1166
59 Ga0068864_100194910 3300005618 Bacteria 1858
60 Ga0068864_100794572 3300005618 Bacteria 930
61 Ga0068866_10078452 3300005718 Bacteria 1767
62 Ga0068866_10232338 3300005718 Unclassified 1119
63 Ga0068870_10072629 3300005840 Bacteria 1880
64 Ga0068863_100085891 3300005841 Bacteria 2981
65 Ga0068863_100348457 3300005841 Bacteria 1442
66 Ga0068858_101207069 3300005842 Unclassified 744
67 Ga0068860_100182588 3300005843 Unclassified 2028
68 Ga0070712_100323925 3300006175 Bacteria 1254
69 Ga0097621_100000667 3300006237 Bacteria 24145
70 Ga0097621_100110150 3300006237 Bacteria 2326
71 Ga0097621_100126398 3300006237 Bacteria 2172
72 Ga0097621_100157104 3300006237 Unclassified 1952
73 Ga0097621_100451207 3300006237 Unclassified 1158
74 Ga0068871_100000806 3300006358 Bacteria 21077
75 Ga0068871_100073566 3300006358 Bacteria 2817
76 Ga0068871_100093652 3300006358 Bacteria 2507
77 Ga0068865_100006179 3300006881 Bacteria 7302
78 Ga0068865_100517297 3300006881 Unclassified 997
79 Ga0097620_100629074 3300006931 Unclassified 1166
80 Ga0105240_10042761 3300009093 Bacteria 5771
81 Ga0105240_10077043 3300009093 Bacteria 4109
82 Ga0105240_10085153 3300009093 Bacteria 3874
83 Ga0105240_10246498 3300009093 Bacteria 2068
84 Ga0105240_10276510 3300009093 Bacteria 1931
85 Ga0105240_10766847 3300009093 Unclassified 1047
86 Ga0105245_10283121 3300009098 Bacteria 1621
87 Ga0105243_10041679 3300009148 Bacteria 3590
88 Ga0105243_10506506 3300009148 Unclassified 1145
89 Ga0105241_10066538 3300009174 Bacteria 2787
90 Ga0105241_10266699 3300009174 Bacteria 1457
91 Ga0105241_10326770 3300009174 Bacteria 1324
92 Ga0105242_10043568 3300009176 Bacteria 3630
93 Ga0105242_10204157 3300009176 Bacteria 1757
94 Ga0105242_10411878 3300009176 Bacteria 1264
95 Ga0105242_11293125 3300009176 Unclassified 753
96 Ga0105248_10029930 3300009177 Bacteria 6076
97 Ga0105248_10422702 3300009177 Bacteria 1501
98 Ga0105248_10518360 3300009177 Bacteria 1344
99 Ga0105248_11056791 3300009177 Unclassified 917
100 Ga0105237_10021039 3300009545 Bacteria 6713
101 Ga0105237_10130629 3300009545 Bacteria 2506
102 Ga0105237_10458965 3300009545 Bacteria 1280
103 Ga0105237_10758925 3300009545 Bacteria 976
104 Ga0105238_10018243 3300009551 Bacteria 7138
105 Ga0105238_10097166 3300009551 Bacteria 2931
106 Ga0105238_10315163 3300009551 Bacteria 1549
107 Ga0105238_10516727 3300009551 Bacteria 1196
108 Ga0105238_10532211 3300009551 Bacteria 1178
109 Ga0105238_10803124 3300009551 Bacteria 956
110 Ga0105249_11180855 3300009553 Bacteria 836
111 Ga0105249_11678393 3300009553 Unclassified 708
112 Ga0105239_10070850 3300010375 Bacteria 3830
113 Ga0105246_10008459 3300011119 Bacteria 6325
114 Ga0105246_10189731 3300011119 Bacteria 1590
115 Ga0157369_10182239 3300013105 Bacteria 2209
116 Ga0157369_10924095 3300013105 Bacteria 894
117 Ga0157369_11330163 3300013105 Unclassified 732
118 Ga0157374_10132260 3300013296 Unclassified 2415
119 Ga0157374_10278364 3300013296 Bacteria 1651
120 Ga0157374_10434465 3300013296 Bacteria 1313
121 Ga0157374_11178819 3300013296 Unclassified 787
122 Ga0157378_10017445 3300013297 Bacteria 6301
123 Ga0157378_10412688 3300013297 Unclassified 1333
124 Ga0157378_10695333 3300013297 Bacteria 1036
125 Ga0163162_10035832 3300013306 Bacteria 4943
126 Ga0163162_10085017 3300013306 Bacteria 3240
127 Ga0163162_10090934 3300013306 Bacteria 3134
128 Ga0163162_10395424 3300013306 Bacteria 1515
129 Ga0157372_10250348 3300013307 Bacteria 2056
130 Ga0157372_10496698 3300013307 Bacteria 1423
131 Ga0157375_10420222 3300013308 Bacteria 1503
132 Ga0157375_11355138 3300013308 Unclassified 837
133 Ga0163163_10000016 3300014325 Bacteria 213966
134 Ga0163163_10015252 3300014325 Bacteria 7100
135 Ga0163163_11345427 3300014325 Unclassified 776
136 Ga0157379_10001653 3300014968 Bacteria 18410
137 Ga0157379_10032005 3300014968 Bacteria 4687
138 Ga0157376_10008091 3300014969 Bacteria 7556
139 Ga0157376_10412660 3300014969 Unclassified 1308
140 Ga0163161_10042985 3300017792 Bacteria 3252
141 Ga0209233_1000006 3300025261 Bacteria 1473685
142 Ga0209233_1007760 3300025261 Bacteria 3371
143 Ga0207682_10115335 3300025893 Bacteria 1186
144 Ga0207680_10110894 3300025903 Bacteria 1779
145 Ga0207680_10217203 3300025903 Bacteria 1309
146 Ga0207645_10026531 3300025907 Bacteria 3743
147 Ga0207643_10078863 3300025908 Bacteria 1905
148 Ga0207705_10002317 3300025909 Bacteria 14722
149 Ga0207705_10221744 3300025909 Bacteria 1436
150 Ga0207654_10460805 3300025911 Unclassified 893
151 Ga0207707_10420543 3300025912 Bacteria 1146
152 Ga0207695_10031933 3300025913 Bacteria 5767
153 Ga0207695_10064633 3300025913 Bacteria 3765
154 Ga0207695_10075233 3300025913 Bacteria 3436
155 Ga0207695_10226662 3300025913 Bacteria 1775
156 Ga0207695_10875943 3300025913 Unclassified 778
157 Ga0207671_10086641 3300025914 Bacteria 2354
158 Ga0207671_10312850 3300025914 Bacteria 1242
159 Ga0207671_10493352 3300025914 Bacteria 976
160 Ga0207693_10165685 3300025915 Bacteria 1740
161 Ga0207663_10115700 3300025916 Bacteria 1827
162 Ga0207660_10069993 3300025917 Bacteria 2550
163 Ga0207660_10365890 3300025917 Unclassified 1157
164 Ga0207657_10004742 3300025919 Bacteria 14355
165 Ga0207657_10049125 3300025919 Bacteria 3679
166 Ga0207649_10388554 3300025920 Bacteria 1042
167 Ga0207649_10517745 3300025920 Unclassified 909
168 Ga0207652_10024717 3300025921 Bacteria 4986
169 Ga0207652_10103525 3300025921 Bacteria 2517
170 Ga0207694_10004917 3300025924 Bacteria 10366
171 Ga0207694_10077073 3300025924 Unclassified 2612
172 Ga0207694_10216905 3300025924 Bacteria 1560
173 Ga0207659_10247134 3300025926 Unclassified 1446
174 Ga0207659_10625302 3300025926 Bacteria 919
175 Ga0207687_10110242 3300025927 Bacteria 2041
176 Ga0207687_10399677 3300025927 Unclassified 1130
177 Ga0207700_10039966 3300025928 Bacteria 3420
178 Ga0207700_10525599 3300025928 Bacteria 1049
179 Ga0207700_10665782 3300025928 Bacteria 928
180 Ga0207664_10746475 3300025929 Unclassified 880
181 Ga0207644_10204084 3300025931 Bacteria 1560
182 Ga0207686_10022268 3300025934 Bacteria 3648
183 Ga0207686_10044827 3300025934 Bacteria 2718
184 Ga0207686_10166858 3300025934 Unclassified 1549
185 Ga0207686_10175048 3300025934 Bacteria 1517
186 Ga0207709_10896035 3300025935 Bacteria 721
187 Ga0207670_10267742 3300025936 Unclassified 1327
188 Ga0207704_10022115 3300025938 Bacteria 3400
189 Ga0207704_10536434 3300025938 Bacteria 949
190 Ga0207691_10318459 3300025940 Unclassified 1334
191 Ga0207691_10967481 3300025940 Unclassified 711
192 Ga0207711_10022831 3300025941 Bacteria 5235
193 Ga0207711_10128023 3300025941 Bacteria 2273
194 Ga0207689_10009654 3300025942 Bacteria 8317
195 Ga0207689_10722681 3300025942 Unclassified 840
196 Ga0207667_10132788 3300025949 Bacteria 2564
197 Ga0207667_10750635 3300025949 Unclassified 975
198 Ga0207677_10769285 3300026023 Unclassified 860
199 Ga0207703_10072113 3300026035 Bacteria 2854
200 Ga0207678_10096833 3300026067 Bacteria 2522
201 Ga0207708_10477828 3300026075 Bacteria 1042
202 Ga0207702_10205232 3300026078 Bacteria 1829
203 Ga0207641_10062148 3300026088 Bacteria 3186
204 Ga0207641_10330060 3300026088 Bacteria 1449
205 Ga0207648_10022893 3300026089 Bacteria 5604
206 Ga0207648_10113041 3300026089 Unclassified 2384
207 Ga0207674_10061669 3300026116 Bacteria 3788
208 Ga0207674_10086900 3300026116 Bacteria 3121
209 Ga0207674_10279614 3300026116 Bacteria 1617
210 Ga0207674_10666871 3300026116 Bacteria 1004
211 Ga0207683_10032253 3300026121 Bacteria 4551
212 Ga0207683_10083364 3300026121 Bacteria 2841
213 Ga0268266_10001078 3300028379 Bacteria 34195
214 Ga0268266_10028972 3300028379 Bacteria 4705
215 Ga0268266_10084400 3300028379 Bacteria 2773
216 Ga0268266_10108417 3300028379 Bacteria 2457
217 Ga0268266_10154754 3300028379 Bacteria 2070
218 Ga0268266_10833427 3300028379 Unclassified 891
219 Ga0268264_10626917 3300028381 Bacteria 1062
220 Ga0265338_10002483 3300028800 Bacteria 27550
221 Ga0265338_10341526 3300028800 Bacteria 1079
222 Ga0265325_10006304 3300031241 Bacteria 7216
223 Ga0265340_10182852 3300031247 Unclassified 947
224 Ga0265339_10027842 3300031249 Bacteria 3219
225 Ga0265313_10002619 3300031595 Bacteria 15305
226 Ga0265313_10015377 3300031595 Bacteria 4460
227 Ga0265314_10040279 3300031711 Bacteria 3355
228 Ga0265342_10036589 3300031712 Bacteria 2998
229 Ga0307516_10095340 3300031730 Bacteria 2798
230 Ga0373931_0624649 3300035691 Unclassified 706
231 Ga0373935_0159705 3300035692 Unclassified 1536
232 Ga0395900_0034293 3300037418 Bacteria 5225
233 Ga0395898_0330516 3300037466 Bacteria 1453
234 Ga0395901_0372261 3300038443 Bacteria 1471
235 Ga0436360_0502399 3300039438 Bacteria 1856
236 Ga0436361_1222762 3300039447 Unclassified 952
237 Ga0436362_0617007 3300039453 Bacteria 1000
238 Ga0466967_0024034 3300045976 Bacteria 5004
239 Ga0495617_144750 3300046452 Unclassified 758
240 Ga0495592_0380772 3300046454 Unclassified 898
241 Ga0495596_0098183 3300046500 Unclassified 1137
242 Ga0495630_0708674 3300046517 Unclassified 770
243 Ga0495652_0544884 3300046529 Unclassified 798
244 Ga0495609_0041521 3300046538 Bacteria 2067
245 Ga0495656_0046070 3300046615 Bacteria 1844
246 Ga0495599_0453408 3300046678 Unclassified 759
247 Ga0495669_0322805 3300046684 Unclassified 745
248 Ga0495613_0295204 3300046689 Unclassified 1123
249 Ga0495670_0397692 3300046691 Bacteria 744
250 Ga0495636_0060372 3300047318 Bacteria 1602
251 Ga0495676_0507584 3300047321 Bacteria 791
252 Ga0496101_0677748 3300048904 Unclassified 814
253 Ga0496121_0000447 3300048924 Bacteria 81300
254 Ga0501032_0266594 3300049569 Unclassified 1110
255 Ga0501032_0316761 3300049569 Unclassified 1007
256 Ga0501033_0011651 3300049570 Bacteria 6724
257 Ga0501033_0019808 3300049570 Bacteria 5085
258 Ga0501033_0065343 3300049570 Bacteria 2677
259 Ga0501033_0065871 3300049570 Bacteria 2664
260 Ga0501033_0127807 3300049570 Bacteria 1842
261 Ga0501034_0110220 3300049571 Bacteria 2744
262 Ga0501037_0560724 3300049573 Bacteria 770
263 Ga0501038_0193561 3300049574 Bacteria 1635
264 Ga0501038_0212738 3300049574 Bacteria 1546
265 Ga0501038_0403570 3300049574 Bacteria 1057
266 Ga0501046_0024008 3300049580 Bacteria 5007
267 Ga0501046_0149809 3300049580 Bacteria 1760
268 Ga0501047_0003299 3300049581 Bacteria 15279
269 Ga0501047_0029599 3300049581 Bacteria 5279
270 Ga0501047_0053164 3300049581 Bacteria 3915
271 Ga0501047_0664909 3300049581 Bacteria 860
272 Ga0501048_0273401 3300049582 Bacteria 1201
273 Ga0501224_014394 3300049664 Bacteria 1170
274 Ga0501249_010515 3300049679 Bacteria 1937
275 Ga0501080_0036560 3300049742 Bacteria 4584
276 Ga0501080_0112143 3300049742 Bacteria 2528
277 Ga0501080_0150552 3300049742 Bacteria 2151
278 Ga0501083_0336008 3300049744 Bacteria 982
279 Ga0501035_0017511 3300049822 Bacteria 6610
280 Ga0501035_0101961 3300049822 Bacteria 2518
281 Ga0501035_0115261 3300049822 Bacteria 2352
282 Ga0501044_0005515 3300049823 Bacteria 14047
283 Ga0501044_0029483 3300049823 Bacteria 5785
284 Ga0501044_0051134 3300049823 Bacteria 4261
285 Ga0501044_0090838 3300049823 Bacteria 3080
286 Ga0501044_0423682 3300049823 Unclassified 1241
287 Ga0501044_1246912 3300049823 Bacteria 611
288 Ga0500595_001289 3300053119 Bacteria 13640
289 Ga0500595_011434 3300053119 Bacteria 3477
290 Ga0500573_0000028 3300053140 Bacteria 142610

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1246912 Ga0501044_1246912_38_598 184
2 3300049581 Ga0501047_0664909 Ga0501047_0664909_260_823 185
3 3300053119 Ga0500595_011434 Ga0500595_011434_2844_3464 190
4 3300046454 Ga0495592_0380772 Ga0495592_0380772_45_701 191
5 3300046529 Ga0495652_0544884 Ga0495652_0544884_31_687 191
6 3300046615 Ga0495656_0046070 Ga0495656_0046070_785_1360 191
7 3300046678 Ga0495599_0453408 Ga0495599_0453408_62_718 191
8 3300046689 Ga0495613_0295204 Ga0495613_0295204_126_782 191
9 3300005328 Ga0070676_10139258 Ga0070676_101392582 193
10 3300005355 Ga0070671_100434796 Ga0070671_1004347961 193
11 3300006358 Ga0068871_100093652 Ga0068871_1000936522 193
12 3300009176 Ga0105242_10411878 Ga0105242_104118782 193
13 3300011119 Ga0105246_10008459 Ga0105246_100084593 193
14 3300013296 Ga0157374_10278364 Ga0157374_102783642 193
15 3300025927 Ga0207687_10110242 Ga0207687_101102422 193
16 3300025934 Ga0207686_10175048 Ga0207686_101750482 193
17 3300026121 Ga0207683_10083364 Ga0207683_100833642 193
18 3300035691 Ga0373931_0624649 Ga0373931_0624649_101_685 194
19 3300046691 Ga0495670_0397692 Ga0495670_0397692_16_600 194
20 3300049664 Ga0501224_014394 Ga0501224_014394_354_941 194
21 3300049679 Ga0501249_010515 Ga0501249_010515_42_629 194
22 3300005334 Ga0068869_100617883 Ga0068869_1006178832 196
23 3300006175 Ga0070712_100323925 Ga0070712_1003239251 196
24 3300025915 Ga0207693_10165685 Ga0207693_101656852 196
25 3300005548 Ga0070665_100353694 Ga0070665_1003536942 198
26 3300028800 Ga0265338_10341526 Ga0265338_103415262 199
27 3300031241 Ga0265325_10006304 Ga0265325_100063045 199
28 3300031249 Ga0265339_10027842 Ga0265339_100278422 199
29 3300031595 Ga0265313_10015377 Ga0265313_100153772 199
30 3300031712 Ga0265342_10036589 Ga0265342_100365892 199
31 3300049570 Ga0501033_0019808 Ga0501033_0019808_3342_3941 199
32 3300031595 Ga0265313_10002619 Ga0265313_100026192 201
33 3300049570 Ga0501033_0065871 Ga0501033_0065871_696_1307 201
34 3300049580 Ga0501046_0024008 Ga0501046_0024008_346_957 201
35 3300049581 Ga0501047_0053164 Ga0501047_0053164_2763_3374 201
36 3300049742 Ga0501080_0036560 Ga0501080_0036560_2036_2647 201
37 3300049742 Ga0501080_0150552 Ga0501080_0150552_418_1029 201
38 3300049823 Ga0501044_0051134 Ga0501044_0051134_2735_3346 201
39 3300049570 Ga0501033_0127807 Ga0501033_0127807_712_1326 202
40 3300049573 Ga0501037_0560724 Ga0501037_0560724_132_746 202
41 3300049574 Ga0501038_0212738 Ga0501038_0212738_158_772 202
42 3300049582 Ga0501048_0273401 Ga0501048_0273401_354_968 202
43 3300049822 Ga0501035_0101961 Ga0501035_0101961_923_1537 202
44 3300049823 Ga0501044_0090838 Ga0501044_0090838_1754_2368 202
45 3300005334 Ga0068869_100255650 Ga0068869_1002556501 204
46 3300005547 Ga0070693_100362562 Ga0070693_1003625622 204
47 3300005615 Ga0070702_100652760 Ga0070702_1006527601 204
48 3300006237 Ga0097621_100110150 Ga0097621_1001101501 204
49 3300009174 Ga0105241_10326770 Ga0105241_103267701 204
50 3300013297 Ga0157378_10017445 Ga0157378_100174452 204
51 3300013308 Ga0157375_10420222 Ga0157375_104202222 204
52 3300014968 Ga0157379_10032005 Ga0157379_100320053 204
53 3300046517 Ga0495630_0708674 Ga0495630_0708674_42_674 204
54 3300005435 Ga0070714_101009715 Ga0070714_1010097151 205
55 3300025929 Ga0207664_10746475 Ga0207664_107464751 205
56 3300049570 Ga0501033_0065343 Ga0501033_0065343_1184_1807 205
57 3300049581 Ga0501047_0029599 Ga0501047_0029599_4435_5058 205
58 3300005327 Ga0070658_10004056 Ga0070658_100040564 206
59 3300005327 Ga0070658_10817687 Ga0070658_108176871 206
60 3300005328 Ga0070676_10379373 Ga0070676_103793731 206
61 3300005329 Ga0070683_100097852 Ga0070683_1000978522 206
62 3300005329 Ga0070683_100788028 Ga0070683_1007880281 206
63 3300005330 Ga0070690_100205405 Ga0070690_1002054052 206
64 3300005331 Ga0070670_100609229 Ga0070670_1006092292 206
65 3300005334 Ga0068869_100688763 Ga0068869_1006887631 206
66 3300005335 Ga0070666_10023144 Ga0070666_100231442 206
67 3300005335 Ga0070666_10573941 Ga0070666_105739411 206
68 3300005335 Ga0070666_10761734 Ga0070666_107617341 206
69 3300005336 Ga0070680_100049307 Ga0070680_1000493072 206
70 3300005336 Ga0070680_100529182 Ga0070680_1005291821 206
71 3300005338 Ga0068868_100359480 Ga0068868_1003594801 206
72 3300005338 Ga0068868_100409612 Ga0068868_1004096122 206
73 3300005338 Ga0068868_100620713 Ga0068868_1006207132 206
74 3300005339 Ga0070660_100005543 Ga0070660_1000055433 206
75 3300005339 Ga0070660_100058587 Ga0070660_1000585872 206
76 3300005340 Ga0070689_100585707 Ga0070689_1005857071 206
77 3300005344 Ga0070661_100197837 Ga0070661_1001978371 206
78 3300005344 Ga0070661_100301323 Ga0070661_1003013232 206
79 3300005344 Ga0070661_100316554 Ga0070661_1003165541 206
80 3300005354 Ga0070675_100304597 Ga0070675_1003045972 206
81 3300005364 Ga0070673_100664454 Ga0070673_1006644542 206
82 3300005367 Ga0070667_100045702 Ga0070667_1000457021 206
83 3300005434 Ga0070709_10629669 Ga0070709_106296691 206
84 3300005436 Ga0070713_100225755 Ga0070713_1002257552 206
85 3300005436 Ga0070713_100403595 Ga0070713_1004035952 206
86 3300005438 Ga0070701_10369031 Ga0070701_103690311 206
87 3300005439 Ga0070711_100192967 Ga0070711_1001929671 206
88 3300005441 Ga0070700_100053891 Ga0070700_1000538912 206
89 3300005456 Ga0070678_100018146 Ga0070678_1000181463 206
90 3300005456 Ga0070678_100322749 Ga0070678_1003227492 206
91 3300005458 Ga0070681_10706417 Ga0070681_107064171 206
92 3300005459 Ga0068867_100016315 Ga0068867_1000163154 206
93 3300005459 Ga0068867_100147424 Ga0068867_1001474242 206
94 3300005530 Ga0070679_100015867 Ga0070679_1000158677 206
95 3300005530 Ga0070679_100164107 Ga0070679_1001641072 206
96 3300005543 Ga0070672_100654140 Ga0070672_1006541402 206
97 3300005548 Ga0070665_100005978 Ga0070665_1000059784 206
98 3300005548 Ga0070665_100006286 Ga0070665_1000062866 206
99 3300005548 Ga0070665_100009536 Ga0070665_1000095366 206
100 3300005548 Ga0070665_100173167 Ga0070665_1001731672 206
101 3300005548 Ga0070665_100625688 Ga0070665_1006256882 206
102 3300005563 Ga0068855_100078531 Ga0068855_1000785313 206
103 3300005577 Ga0068857_100099799 Ga0068857_1000997993 206
104 3300005578 Ga0068854_100484405 Ga0068854_1004844052 206
105 3300005615 Ga0070702_100554278 Ga0070702_1005542781 206
106 3300005616 Ga0068852_100136048 Ga0068852_1001360481 206
107 3300005617 Ga0068859_100629047 Ga0068859_1006290472 206
108 3300005618 Ga0068864_100194910 Ga0068864_1001949101 206
109 3300005618 Ga0068864_100794572 Ga0068864_1007945721 206
110 3300005718 Ga0068866_10078452 Ga0068866_100784521 206
111 3300005718 Ga0068866_10232338 Ga0068866_102323382 206
112 3300005840 Ga0068870_10072629 Ga0068870_100726292 206
113 3300005841 Ga0068863_100085891 Ga0068863_1000858912 206
114 3300005841 Ga0068863_100348457 Ga0068863_1003484571 206
115 3300005842 Ga0068858_101207069 Ga0068858_1012070691 206
116 3300005843 Ga0068860_100182588 Ga0068860_1001825882 206
117 3300006237 Ga0097621_100000667 Ga0097621_10000066722 206
118 3300006237 Ga0097621_100126398 Ga0097621_1001263983 206
119 3300006237 Ga0097621_100157104 Ga0097621_1001571042 206
120 3300006237 Ga0097621_100451207 Ga0097621_1004512071 206
121 3300006358 Ga0068871_100000806 Ga0068871_10000080615 206
122 3300006358 Ga0068871_100073566 Ga0068871_1000735662 206
123 3300006881 Ga0068865_100006179 Ga0068865_1000061795 206
124 3300006881 Ga0068865_100517297 Ga0068865_1005172972 206
125 3300006931 Ga0097620_100629074 Ga0097620_1006290742 206
126 3300009093 Ga0105240_10042761 Ga0105240_100427613 206
127 3300009093 Ga0105240_10077043 Ga0105240_100770432 206
128 3300009093 Ga0105240_10085153 Ga0105240_100851532 206
129 3300009093 Ga0105240_10246498 Ga0105240_102464982 206
130 3300009093 Ga0105240_10276510 Ga0105240_102765102 206
131 3300009093 Ga0105240_10766847 Ga0105240_107668472 206
132 3300009098 Ga0105245_10283121 Ga0105245_102831212 206
133 3300009148 Ga0105243_10041679 Ga0105243_100416793 206
134 3300009148 Ga0105243_10506506 Ga0105243_105065062 206
135 3300009174 Ga0105241_10066538 Ga0105241_100665383 206
136 3300009174 Ga0105241_10266699 Ga0105241_102666991 206
137 3300009176 Ga0105242_10043568 Ga0105242_100435683 206
138 3300009176 Ga0105242_10204157 Ga0105242_102041572 206
139 3300009176 Ga0105242_11293125 Ga0105242_112931251 206
140 3300009177 Ga0105248_10029930 Ga0105248_100299304 206
141 3300009177 Ga0105248_10422702 Ga0105248_104227022 206
142 3300009177 Ga0105248_10518360 Ga0105248_105183602 206
143 3300009177 Ga0105248_11056791 Ga0105248_110567911 206
144 3300009545 Ga0105237_10021039 Ga0105237_100210395 206
145 3300009545 Ga0105237_10130629 Ga0105237_101306292 206
146 3300009545 Ga0105237_10458965 Ga0105237_104589651 206
147 3300009545 Ga0105237_10758925 Ga0105237_107589251 206
148 3300009551 Ga0105238_10018243 Ga0105238_100182433 206
149 3300009551 Ga0105238_10097166 Ga0105238_100971663 206
150 3300009551 Ga0105238_10315163 Ga0105238_103151632 206
151 3300009551 Ga0105238_10516727 Ga0105238_105167272 206
152 3300009551 Ga0105238_10532211 Ga0105238_105322111 206
153 3300009551 Ga0105238_10803124 Ga0105238_108031242 206
154 3300009553 Ga0105249_11180855 Ga0105249_111808551 206
155 3300009553 Ga0105249_11678393 Ga0105249_116783931 206
156 3300010375 Ga0105239_10070850 Ga0105239_100708502 206
157 3300011119 Ga0105246_10189731 Ga0105246_101897311 206
158 3300013105 Ga0157369_10182239 Ga0157369_101822392 206
159 3300013105 Ga0157369_10924095 Ga0157369_109240952 206
160 3300013105 Ga0157369_11330163 Ga0157369_113301631 206
161 3300013296 Ga0157374_10132260 Ga0157374_101322602 206
162 3300013296 Ga0157374_10434465 Ga0157374_104344652 206
163 3300013296 Ga0157374_11178819 Ga0157374_111788191 206
164 3300013297 Ga0157378_10412688 Ga0157378_104126882 206
165 3300013297 Ga0157378_10695333 Ga0157378_106953332 206
166 3300013306 Ga0163162_10035832 Ga0163162_100358323 206
167 3300013306 Ga0163162_10085017 Ga0163162_100850173 206
168 3300013306 Ga0163162_10090934 Ga0163162_100909342 206
169 3300013306 Ga0163162_10395424 Ga0163162_103954242 206
170 3300013307 Ga0157372_10250348 Ga0157372_102503482 206
171 3300013307 Ga0157372_10496698 Ga0157372_104966982 206
172 3300013308 Ga0157375_11355138 Ga0157375_113551381 206
173 3300014325 Ga0163163_10000016 Ga0163163_1000001678 206
174 3300014325 Ga0163163_10015252 Ga0163163_100152522 206
175 3300014325 Ga0163163_11345427 Ga0163163_113454271 206
176 3300014968 Ga0157379_10001653 Ga0157379_1000165316 206
177 3300014969 Ga0157376_10008091 Ga0157376_100080914 206
178 3300014969 Ga0157376_10412660 Ga0157376_104126602 206
179 3300017792 Ga0163161_10042985 Ga0163161_100429852 206
180 3300025261 Ga0209233_1000006 Ga0209233_10000061202 206
181 3300025261 Ga0209233_1007760 Ga0209233_10077603 206
182 3300025893 Ga0207682_10115335 Ga0207682_101153351 206
183 3300025903 Ga0207680_10110894 Ga0207680_101108941 206
184 3300025903 Ga0207680_10217203 Ga0207680_102172031 206
185 3300025907 Ga0207645_10026531 Ga0207645_100265311 206
186 3300025908 Ga0207643_10078863 Ga0207643_100788632 206
187 3300025909 Ga0207705_10002317 Ga0207705_100023172 206
188 3300025909 Ga0207705_10221744 Ga0207705_102217442 206
189 3300025911 Ga0207654_10460805 Ga0207654_104608052 206
190 3300025912 Ga0207707_10420543 Ga0207707_104205431 206
191 3300025913 Ga0207695_10031933 Ga0207695_100319333 206
192 3300025913 Ga0207695_10064633 Ga0207695_100646333 206
193 3300025913 Ga0207695_10075233 Ga0207695_100752334 206
194 3300025913 Ga0207695_10226662 Ga0207695_102266621 206
195 3300025913 Ga0207695_10875943 Ga0207695_108759431 206
196 3300025914 Ga0207671_10086641 Ga0207671_100866412 206
197 3300025914 Ga0207671_10312850 Ga0207671_103128501 206
198 3300025914 Ga0207671_10493352 Ga0207671_104933522 206
199 3300025916 Ga0207663_10115700 Ga0207663_101157001 206
200 3300025917 Ga0207660_10069993 Ga0207660_100699932 206
201 3300025917 Ga0207660_10365890 Ga0207660_103658902 206
202 3300025919 Ga0207657_10004742 Ga0207657_1000474212 206
203 3300025919 Ga0207657_10049125 Ga0207657_100491252 206
204 3300025920 Ga0207649_10388554 Ga0207649_103885542 206
205 3300025920 Ga0207649_10517745 Ga0207649_105177451 206
206 3300025921 Ga0207652_10024717 Ga0207652_100247171 206
207 3300025921 Ga0207652_10103525 Ga0207652_101035252 206
208 3300025924 Ga0207694_10004917 Ga0207694_100049175 206
209 3300025924 Ga0207694_10077073 Ga0207694_100770732 206
210 3300025924 Ga0207694_10216905 Ga0207694_102169052 206
211 3300025926 Ga0207659_10247134 Ga0207659_102471341 206
212 3300025926 Ga0207659_10625302 Ga0207659_106253021 206
213 3300025927 Ga0207687_10399677 Ga0207687_103996771 206
214 3300025928 Ga0207700_10039966 Ga0207700_100399664 206
215 3300025928 Ga0207700_10525599 Ga0207700_105255992 206
216 3300025928 Ga0207700_10665782 Ga0207700_106657821 206
217 3300025931 Ga0207644_10204084 Ga0207644_102040841 206
218 3300025934 Ga0207686_10022268 Ga0207686_100222682 206
219 3300025934 Ga0207686_10044827 Ga0207686_100448272 206
220 3300025934 Ga0207686_10166858 Ga0207686_101668582 206
221 3300025935 Ga0207709_10896035 Ga0207709_108960351 206
222 3300025936 Ga0207670_10267742 Ga0207670_102677421 206
223 3300025938 Ga0207704_10022115 Ga0207704_100221153 206
224 3300025938 Ga0207704_10536434 Ga0207704_105364341 206
225 3300025940 Ga0207691_10318459 Ga0207691_103184592 206
226 3300025940 Ga0207691_10967481 Ga0207691_109674811 206
227 3300025941 Ga0207711_10022831 Ga0207711_100228312 206
228 3300025941 Ga0207711_10128023 Ga0207711_101280232 206
229 3300025942 Ga0207689_10009654 Ga0207689_100096542 206
230 3300025942 Ga0207689_10722681 Ga0207689_107226811 206
231 3300025949 Ga0207667_10132788 Ga0207667_101327881 206
232 3300025949 Ga0207667_10750635 Ga0207667_107506352 206
233 3300026023 Ga0207677_10769285 Ga0207677_107692852 206
234 3300026035 Ga0207703_10072113 Ga0207703_100721132 206
235 3300026067 Ga0207678_10096833 Ga0207678_100968332 206
236 3300026075 Ga0207708_10477828 Ga0207708_104778281 206
237 3300026078 Ga0207702_10205232 Ga0207702_102052321 206
238 3300026088 Ga0207641_10062148 Ga0207641_100621482 206
239 3300026088 Ga0207641_10330060 Ga0207641_103300602 206
240 3300026089 Ga0207648_10022893 Ga0207648_100228936 206
241 3300026089 Ga0207648_10113041 Ga0207648_101130411 206
242 3300026116 Ga0207674_10061669 Ga0207674_100616693 206
243 3300026116 Ga0207674_10086900 Ga0207674_100869002 206
244 3300026116 Ga0207674_10279614 Ga0207674_102796142 206
245 3300026116 Ga0207674_10666871 Ga0207674_106668712 206
246 3300026121 Ga0207683_10032253 Ga0207683_100322532 206
247 3300028379 Ga0268266_10001078 Ga0268266_1000107831 206
248 3300028379 Ga0268266_10028972 Ga0268266_100289723 206
249 3300028379 Ga0268266_10084400 Ga0268266_100844002 206
250 3300028379 Ga0268266_10108417 Ga0268266_101084172 206
251 3300028379 Ga0268266_10154754 Ga0268266_101547542 206
252 3300028379 Ga0268266_10833427 Ga0268266_108334271 206
253 3300028381 Ga0268264_10626917 Ga0268264_106269171 206
254 3300028800 Ga0265338_10002483 Ga0265338_100024836 206
255 3300031247 Ga0265340_10182852 Ga0265340_101828521 206
256 3300031711 Ga0265314_10040279 Ga0265314_100402792 206
257 3300031730 Ga0307516_10095340 Ga0307516_100953401 206
258 3300035692 Ga0373935_0159705 Ga0373935_0159705_340_960 206
259 3300037418 Ga0395900_0034293 Ga0395900_0034293_2678_3298 206
260 3300037466 Ga0395898_0330516 Ga0395898_0330516_102_722 206
261 3300038443 Ga0395901_0372261 Ga0395901_0372261_825_1445 206
262 3300039438 Ga0436360_0502399 Ga0436360_0502399_550_1170 206
263 3300039447 Ga0436361_1222762 Ga0436361_1222762_67_687 206
264 3300039453 Ga0436362_0617007 Ga0436362_0617007_314_934 206
265 3300045976 Ga0466967_0024034 Ga0466967_0024034_82_702 206
266 3300046452 Ga0495617_144750 Ga0495617_144750_116_736 206
267 3300046500 Ga0495596_0098183 Ga0495596_0098183_175_870 206
268 3300046538 Ga0495609_0041521 Ga0495609_0041521_649_1269 206
269 3300046684 Ga0495669_0322805 Ga0495669_0322805_21_641 206
270 3300047318 Ga0495636_0060372 Ga0495636_0060372_94_714 206
271 3300047321 Ga0495676_0507584 Ga0495676_0507584_97_717 206
272 3300048904 Ga0496101_0677748 Ga0496101_0677748_42_716 206
273 3300048924 Ga0496121_0000447 Ga0496121_0000447_14169_14789 206
274 3300049569 Ga0501032_0266594 Ga0501032_0266594_18_656 206
275 3300049569 Ga0501032_0316761 Ga0501032_0316761_179_889 206
276 3300049570 Ga0501033_0011651 Ga0501033_0011651_349_1059 206
277 3300049571 Ga0501034_0110220 Ga0501034_0110220_535_1245 206
278 3300049574 Ga0501038_0193561 Ga0501038_0193561_137_847 206
279 3300049574 Ga0501038_0403570 Ga0501038_0403570_320_955 206
280 3300049580 Ga0501046_0149809 Ga0501046_0149809_874_1584 206
281 3300049581 Ga0501047_0003299 Ga0501047_0003299_2099_2809 206
282 3300049742 Ga0501080_0112143 Ga0501080_0112143_255_875 206
283 3300049744 Ga0501083_0336008 Ga0501083_0336008_337_957 206
284 3300049822 Ga0501035_0017511 Ga0501035_0017511_4515_5225 206
285 3300049822 Ga0501035_0115261 Ga0501035_0115261_1451_2077 206
286 3300049823 Ga0501044_0005515 Ga0501044_0005515_847_1557 206
287 3300049823 Ga0501044_0029483 Ga0501044_0029483_1992_2618 206
288 3300049823 Ga0501044_0423682 Ga0501044_0423682_416_1036 206
289 3300053119 Ga0500595_001289 Ga0500595_001289_1739_2359 206
290 3300053140 Ga0500573_0000028 Ga0500573_0000028_127644_128264 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05494

MlaC

MlaC protein

68

229

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kph-assembly1.cif.gz_A solution nmr structure of denovo beta sheet design protein, northeast structural genomics consortium (nesg) target or485 0.8595 119 168
2qgu-assembly1.cif.gz_A three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 0.8555 34 206
8dte-assembly1.cif.gz_A crystal structure of a toluene tolerance periplasmic transport protein from neisseria gonorrhoeae 0.8524 34 201
5uwa-assembly2.cif.gz_B structure of e. coli phospholipid binding protein mlac 0.8486 33 206
8dte-assembly1.cif.gz_A crystal structure of a toluene tolerance periplasmic transport protein from neisseria gonorrhoeae 0.83 34 201
ID Description Score Start End Superfamily
af_Q86H45_737_901_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.89 120 152 2.130.10.10
af_P0ADV7_24_204_3.10.450.710 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8588 33 203 3.10.450.710
af_P34324_2_129_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.8525 120 152 2.60.210.10
af_H2KYK6_7_131_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.8234 116 157 2.60.210.10
af_A1ZAW0_1657_1719_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8177 116 152 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A1Q3IXG1-F1-model_v4 Hopanoid biosynthesis protein HpnM 0.9786 68 206
AF-A0A1Q3IXG1-F1-model_v4 Hopanoid biosynthesis protein HpnM 0.9649 68 206
AF-A0A353YCJ5-F1-model_v4 Hopanoid biosynthesis protein HpnM 0.9616 34 205
AF-A0A1G3IPQ4-F1-model_v4 Toluene tolerance protein 0.9475 31 206
AF-A0A1Q2SN27-F1-model_v4 Hopanoid biosynthesis associated membrane protein HpnM 0.9472 57 206

Feature Viewer

pLDDT pTM Quality
85.97 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map