F390026
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 156 | 290 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0316761|Ga0501032_0316761_179_889 |
| Length | 236 |
| Sequence | MGPDFRPFLPPYFRFARYPPKLSAQGSFFGMKPILKSFVVAAALAGAPFLAAAPIQPAQAQAADPAVAQVQGFYDTLQASMKAGGTAKSRYEKLKPAVEKAFDLPAMTAAAVGPAWASASEADKKALVDAFSRMTIANYAKNFDSYSGEKFTVEPASIVRGNDHFVKSTMKTSSETIAFNYRLHQAGAEWKITDVLLAGNISQMAQKRSDFAGVLASGGPSALTKRINALSDQMLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 111 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 117 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 123 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 124 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 141 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 150 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 151 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 156 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.72 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 97.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10004056 | 3300005327 | Bacteria | 12008 |
| 2 | Ga0070658_10817687 | 3300005327 | Bacteria | 810 |
| 3 | Ga0070676_10139258 | 3300005328 | Bacteria | 1543 |
| 4 | Ga0070676_10379373 | 3300005328 | Unclassified | 979 |
| 5 | Ga0070683_100097852 | 3300005329 | Bacteria | 2761 |
| 6 | Ga0070683_100788028 | 3300005329 | Unclassified | 911 |
| 7 | Ga0070690_100205405 | 3300005330 | Bacteria | 1373 |
| 8 | Ga0070670_100609229 | 3300005331 | Unclassified | 978 |
| 9 | Ga0068869_100255650 | 3300005334 | Bacteria | 1401 |
| 10 | Ga0068869_100617883 | 3300005334 | Unclassified | 917 |
| 11 | Ga0068869_100688763 | 3300005334 | Bacteria | 871 |
| 12 | Ga0070666_10023144 | 3300005335 | Bacteria | 4041 |
| 13 | Ga0070666_10573941 | 3300005335 | Unclassified | 822 |
| 14 | Ga0070666_10761734 | 3300005335 | Unclassified | 712 |
| 15 | Ga0070680_100049307 | 3300005336 | Bacteria | 3432 |
| 16 | Ga0070680_100529182 | 3300005336 | Unclassified | 1009 |
| 17 | Ga0068868_100359480 | 3300005338 | Bacteria | 1249 |
| 18 | Ga0068868_100409612 | 3300005338 | Bacteria | 1171 |
| 19 | Ga0068868_100620713 | 3300005338 | Unclassified | 960 |
| 20 | Ga0070660_100005543 | 3300005339 | Bacteria | 8744 |
| 21 | Ga0070660_100058587 | 3300005339 | Bacteria | 2985 |
| 22 | Ga0070689_100585707 | 3300005340 | Unclassified | 965 |
| 23 | Ga0070661_100197837 | 3300005344 | Bacteria | 1535 |
| 24 | Ga0070661_100301323 | 3300005344 | Bacteria | 1248 |
| 25 | Ga0070661_100316554 | 3300005344 | Bacteria | 1218 |
| 26 | Ga0070675_100304597 | 3300005354 | Unclassified | 1404 |
| 27 | Ga0070671_100434796 | 3300005355 | Unclassified | 1125 |
| 28 | Ga0070673_100664454 | 3300005364 | Unclassified | 955 |
| 29 | Ga0070667_100045702 | 3300005367 | Bacteria | 3682 |
| 30 | Ga0070709_10629669 | 3300005434 | Unclassified | 829 |
| 31 | Ga0070714_101009715 | 3300005435 | Unclassified | 810 |
| 32 | Ga0070713_100225755 | 3300005436 | Bacteria | 1701 |
| 33 | Ga0070713_100403595 | 3300005436 | Bacteria | 1277 |
| 34 | Ga0070701_10369031 | 3300005438 | Bacteria | 901 |
| 35 | Ga0070711_100192967 | 3300005439 | Bacteria | 1567 |
| 36 | Ga0070700_100053891 | 3300005441 | Unclassified | 2512 |
| 37 | Ga0070678_100018146 | 3300005456 | Bacteria | 4555 |
| 38 | Ga0070678_100322749 | 3300005456 | Bacteria | 1319 |
| 39 | Ga0070681_10706417 | 3300005458 | Bacteria | 924 |
| 40 | Ga0068867_100016315 | 3300005459 | Bacteria | 5274 |
| 41 | Ga0068867_100147424 | 3300005459 | Bacteria | 1846 |
| 42 | Ga0070679_100015867 | 3300005530 | Bacteria | 7249 |
| 43 | Ga0070679_100164107 | 3300005530 | Bacteria | 2195 |
| 44 | Ga0070672_100654140 | 3300005543 | Unclassified | 918 |
| 45 | Ga0070693_100362562 | 3300005547 | Unclassified | 995 |
| 46 | Ga0070665_100005978 | 3300005548 | Bacteria | 12453 |
| 47 | Ga0070665_100006286 | 3300005548 | Bacteria | 12135 |
| 48 | Ga0070665_100009536 | 3300005548 | Bacteria | 9819 |
| 49 | Ga0070665_100173167 | 3300005548 | Bacteria | 2159 |
| 50 | Ga0070665_100353694 | 3300005548 | Bacteria | 1475 |
| 51 | Ga0070665_100625688 | 3300005548 | Unclassified | 1089 |
| 52 | Ga0068855_100078531 | 3300005563 | Bacteria | 3828 |
| 53 | Ga0068857_100099799 | 3300005577 | Bacteria | 2604 |
| 54 | Ga0068854_100484405 | 3300005578 | Bacteria | 1039 |
| 55 | Ga0070702_100554278 | 3300005615 | Unclassified | 854 |
| 56 | Ga0070702_100652760 | 3300005615 | Unclassified | 796 |
| 57 | Ga0068852_100136048 | 3300005616 | Bacteria | 2269 |
| 58 | Ga0068859_100629047 | 3300005617 | Unclassified | 1166 |
| 59 | Ga0068864_100194910 | 3300005618 | Bacteria | 1858 |
| 60 | Ga0068864_100794572 | 3300005618 | Bacteria | 930 |
| 61 | Ga0068866_10078452 | 3300005718 | Bacteria | 1767 |
| 62 | Ga0068866_10232338 | 3300005718 | Unclassified | 1119 |
| 63 | Ga0068870_10072629 | 3300005840 | Bacteria | 1880 |
| 64 | Ga0068863_100085891 | 3300005841 | Bacteria | 2981 |
| 65 | Ga0068863_100348457 | 3300005841 | Bacteria | 1442 |
| 66 | Ga0068858_101207069 | 3300005842 | Unclassified | 744 |
| 67 | Ga0068860_100182588 | 3300005843 | Unclassified | 2028 |
| 68 | Ga0070712_100323925 | 3300006175 | Bacteria | 1254 |
| 69 | Ga0097621_100000667 | 3300006237 | Bacteria | 24145 |
| 70 | Ga0097621_100110150 | 3300006237 | Bacteria | 2326 |
| 71 | Ga0097621_100126398 | 3300006237 | Bacteria | 2172 |
| 72 | Ga0097621_100157104 | 3300006237 | Unclassified | 1952 |
| 73 | Ga0097621_100451207 | 3300006237 | Unclassified | 1158 |
| 74 | Ga0068871_100000806 | 3300006358 | Bacteria | 21077 |
| 75 | Ga0068871_100073566 | 3300006358 | Bacteria | 2817 |
| 76 | Ga0068871_100093652 | 3300006358 | Bacteria | 2507 |
| 77 | Ga0068865_100006179 | 3300006881 | Bacteria | 7302 |
| 78 | Ga0068865_100517297 | 3300006881 | Unclassified | 997 |
| 79 | Ga0097620_100629074 | 3300006931 | Unclassified | 1166 |
| 80 | Ga0105240_10042761 | 3300009093 | Bacteria | 5771 |
| 81 | Ga0105240_10077043 | 3300009093 | Bacteria | 4109 |
| 82 | Ga0105240_10085153 | 3300009093 | Bacteria | 3874 |
| 83 | Ga0105240_10246498 | 3300009093 | Bacteria | 2068 |
| 84 | Ga0105240_10276510 | 3300009093 | Bacteria | 1931 |
| 85 | Ga0105240_10766847 | 3300009093 | Unclassified | 1047 |
| 86 | Ga0105245_10283121 | 3300009098 | Bacteria | 1621 |
| 87 | Ga0105243_10041679 | 3300009148 | Bacteria | 3590 |
| 88 | Ga0105243_10506506 | 3300009148 | Unclassified | 1145 |
| 89 | Ga0105241_10066538 | 3300009174 | Bacteria | 2787 |
| 90 | Ga0105241_10266699 | 3300009174 | Bacteria | 1457 |
| 91 | Ga0105241_10326770 | 3300009174 | Bacteria | 1324 |
| 92 | Ga0105242_10043568 | 3300009176 | Bacteria | 3630 |
| 93 | Ga0105242_10204157 | 3300009176 | Bacteria | 1757 |
| 94 | Ga0105242_10411878 | 3300009176 | Bacteria | 1264 |
| 95 | Ga0105242_11293125 | 3300009176 | Unclassified | 753 |
| 96 | Ga0105248_10029930 | 3300009177 | Bacteria | 6076 |
| 97 | Ga0105248_10422702 | 3300009177 | Bacteria | 1501 |
| 98 | Ga0105248_10518360 | 3300009177 | Bacteria | 1344 |
| 99 | Ga0105248_11056791 | 3300009177 | Unclassified | 917 |
| 100 | Ga0105237_10021039 | 3300009545 | Bacteria | 6713 |
| 101 | Ga0105237_10130629 | 3300009545 | Bacteria | 2506 |
| 102 | Ga0105237_10458965 | 3300009545 | Bacteria | 1280 |
| 103 | Ga0105237_10758925 | 3300009545 | Bacteria | 976 |
| 104 | Ga0105238_10018243 | 3300009551 | Bacteria | 7138 |
| 105 | Ga0105238_10097166 | 3300009551 | Bacteria | 2931 |
| 106 | Ga0105238_10315163 | 3300009551 | Bacteria | 1549 |
| 107 | Ga0105238_10516727 | 3300009551 | Bacteria | 1196 |
| 108 | Ga0105238_10532211 | 3300009551 | Bacteria | 1178 |
| 109 | Ga0105238_10803124 | 3300009551 | Bacteria | 956 |
| 110 | Ga0105249_11180855 | 3300009553 | Bacteria | 836 |
| 111 | Ga0105249_11678393 | 3300009553 | Unclassified | 708 |
| 112 | Ga0105239_10070850 | 3300010375 | Bacteria | 3830 |
| 113 | Ga0105246_10008459 | 3300011119 | Bacteria | 6325 |
| 114 | Ga0105246_10189731 | 3300011119 | Bacteria | 1590 |
| 115 | Ga0157369_10182239 | 3300013105 | Bacteria | 2209 |
| 116 | Ga0157369_10924095 | 3300013105 | Bacteria | 894 |
| 117 | Ga0157369_11330163 | 3300013105 | Unclassified | 732 |
| 118 | Ga0157374_10132260 | 3300013296 | Unclassified | 2415 |
| 119 | Ga0157374_10278364 | 3300013296 | Bacteria | 1651 |
| 120 | Ga0157374_10434465 | 3300013296 | Bacteria | 1313 |
| 121 | Ga0157374_11178819 | 3300013296 | Unclassified | 787 |
| 122 | Ga0157378_10017445 | 3300013297 | Bacteria | 6301 |
| 123 | Ga0157378_10412688 | 3300013297 | Unclassified | 1333 |
| 124 | Ga0157378_10695333 | 3300013297 | Bacteria | 1036 |
| 125 | Ga0163162_10035832 | 3300013306 | Bacteria | 4943 |
| 126 | Ga0163162_10085017 | 3300013306 | Bacteria | 3240 |
| 127 | Ga0163162_10090934 | 3300013306 | Bacteria | 3134 |
| 128 | Ga0163162_10395424 | 3300013306 | Bacteria | 1515 |
| 129 | Ga0157372_10250348 | 3300013307 | Bacteria | 2056 |
| 130 | Ga0157372_10496698 | 3300013307 | Bacteria | 1423 |
| 131 | Ga0157375_10420222 | 3300013308 | Bacteria | 1503 |
| 132 | Ga0157375_11355138 | 3300013308 | Unclassified | 837 |
| 133 | Ga0163163_10000016 | 3300014325 | Bacteria | 213966 |
| 134 | Ga0163163_10015252 | 3300014325 | Bacteria | 7100 |
| 135 | Ga0163163_11345427 | 3300014325 | Unclassified | 776 |
| 136 | Ga0157379_10001653 | 3300014968 | Bacteria | 18410 |
| 137 | Ga0157379_10032005 | 3300014968 | Bacteria | 4687 |
| 138 | Ga0157376_10008091 | 3300014969 | Bacteria | 7556 |
| 139 | Ga0157376_10412660 | 3300014969 | Unclassified | 1308 |
| 140 | Ga0163161_10042985 | 3300017792 | Bacteria | 3252 |
| 141 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 142 | Ga0209233_1007760 | 3300025261 | Bacteria | 3371 |
| 143 | Ga0207682_10115335 | 3300025893 | Bacteria | 1186 |
| 144 | Ga0207680_10110894 | 3300025903 | Bacteria | 1779 |
| 145 | Ga0207680_10217203 | 3300025903 | Bacteria | 1309 |
| 146 | Ga0207645_10026531 | 3300025907 | Bacteria | 3743 |
| 147 | Ga0207643_10078863 | 3300025908 | Bacteria | 1905 |
| 148 | Ga0207705_10002317 | 3300025909 | Bacteria | 14722 |
| 149 | Ga0207705_10221744 | 3300025909 | Bacteria | 1436 |
| 150 | Ga0207654_10460805 | 3300025911 | Unclassified | 893 |
| 151 | Ga0207707_10420543 | 3300025912 | Bacteria | 1146 |
| 152 | Ga0207695_10031933 | 3300025913 | Bacteria | 5767 |
| 153 | Ga0207695_10064633 | 3300025913 | Bacteria | 3765 |
| 154 | Ga0207695_10075233 | 3300025913 | Bacteria | 3436 |
| 155 | Ga0207695_10226662 | 3300025913 | Bacteria | 1775 |
| 156 | Ga0207695_10875943 | 3300025913 | Unclassified | 778 |
| 157 | Ga0207671_10086641 | 3300025914 | Bacteria | 2354 |
| 158 | Ga0207671_10312850 | 3300025914 | Bacteria | 1242 |
| 159 | Ga0207671_10493352 | 3300025914 | Bacteria | 976 |
| 160 | Ga0207693_10165685 | 3300025915 | Bacteria | 1740 |
| 161 | Ga0207663_10115700 | 3300025916 | Bacteria | 1827 |
| 162 | Ga0207660_10069993 | 3300025917 | Bacteria | 2550 |
| 163 | Ga0207660_10365890 | 3300025917 | Unclassified | 1157 |
| 164 | Ga0207657_10004742 | 3300025919 | Bacteria | 14355 |
| 165 | Ga0207657_10049125 | 3300025919 | Bacteria | 3679 |
| 166 | Ga0207649_10388554 | 3300025920 | Bacteria | 1042 |
| 167 | Ga0207649_10517745 | 3300025920 | Unclassified | 909 |
| 168 | Ga0207652_10024717 | 3300025921 | Bacteria | 4986 |
| 169 | Ga0207652_10103525 | 3300025921 | Bacteria | 2517 |
| 170 | Ga0207694_10004917 | 3300025924 | Bacteria | 10366 |
| 171 | Ga0207694_10077073 | 3300025924 | Unclassified | 2612 |
| 172 | Ga0207694_10216905 | 3300025924 | Bacteria | 1560 |
| 173 | Ga0207659_10247134 | 3300025926 | Unclassified | 1446 |
| 174 | Ga0207659_10625302 | 3300025926 | Bacteria | 919 |
| 175 | Ga0207687_10110242 | 3300025927 | Bacteria | 2041 |
| 176 | Ga0207687_10399677 | 3300025927 | Unclassified | 1130 |
| 177 | Ga0207700_10039966 | 3300025928 | Bacteria | 3420 |
| 178 | Ga0207700_10525599 | 3300025928 | Bacteria | 1049 |
| 179 | Ga0207700_10665782 | 3300025928 | Bacteria | 928 |
| 180 | Ga0207664_10746475 | 3300025929 | Unclassified | 880 |
| 181 | Ga0207644_10204084 | 3300025931 | Bacteria | 1560 |
| 182 | Ga0207686_10022268 | 3300025934 | Bacteria | 3648 |
| 183 | Ga0207686_10044827 | 3300025934 | Bacteria | 2718 |
| 184 | Ga0207686_10166858 | 3300025934 | Unclassified | 1549 |
| 185 | Ga0207686_10175048 | 3300025934 | Bacteria | 1517 |
| 186 | Ga0207709_10896035 | 3300025935 | Bacteria | 721 |
| 187 | Ga0207670_10267742 | 3300025936 | Unclassified | 1327 |
| 188 | Ga0207704_10022115 | 3300025938 | Bacteria | 3400 |
| 189 | Ga0207704_10536434 | 3300025938 | Bacteria | 949 |
| 190 | Ga0207691_10318459 | 3300025940 | Unclassified | 1334 |
| 191 | Ga0207691_10967481 | 3300025940 | Unclassified | 711 |
| 192 | Ga0207711_10022831 | 3300025941 | Bacteria | 5235 |
| 193 | Ga0207711_10128023 | 3300025941 | Bacteria | 2273 |
| 194 | Ga0207689_10009654 | 3300025942 | Bacteria | 8317 |
| 195 | Ga0207689_10722681 | 3300025942 | Unclassified | 840 |
| 196 | Ga0207667_10132788 | 3300025949 | Bacteria | 2564 |
| 197 | Ga0207667_10750635 | 3300025949 | Unclassified | 975 |
| 198 | Ga0207677_10769285 | 3300026023 | Unclassified | 860 |
| 199 | Ga0207703_10072113 | 3300026035 | Bacteria | 2854 |
| 200 | Ga0207678_10096833 | 3300026067 | Bacteria | 2522 |
| 201 | Ga0207708_10477828 | 3300026075 | Bacteria | 1042 |
| 202 | Ga0207702_10205232 | 3300026078 | Bacteria | 1829 |
| 203 | Ga0207641_10062148 | 3300026088 | Bacteria | 3186 |
| 204 | Ga0207641_10330060 | 3300026088 | Bacteria | 1449 |
| 205 | Ga0207648_10022893 | 3300026089 | Bacteria | 5604 |
| 206 | Ga0207648_10113041 | 3300026089 | Unclassified | 2384 |
| 207 | Ga0207674_10061669 | 3300026116 | Bacteria | 3788 |
| 208 | Ga0207674_10086900 | 3300026116 | Bacteria | 3121 |
| 209 | Ga0207674_10279614 | 3300026116 | Bacteria | 1617 |
| 210 | Ga0207674_10666871 | 3300026116 | Bacteria | 1004 |
| 211 | Ga0207683_10032253 | 3300026121 | Bacteria | 4551 |
| 212 | Ga0207683_10083364 | 3300026121 | Bacteria | 2841 |
| 213 | Ga0268266_10001078 | 3300028379 | Bacteria | 34195 |
| 214 | Ga0268266_10028972 | 3300028379 | Bacteria | 4705 |
| 215 | Ga0268266_10084400 | 3300028379 | Bacteria | 2773 |
| 216 | Ga0268266_10108417 | 3300028379 | Bacteria | 2457 |
| 217 | Ga0268266_10154754 | 3300028379 | Bacteria | 2070 |
| 218 | Ga0268266_10833427 | 3300028379 | Unclassified | 891 |
| 219 | Ga0268264_10626917 | 3300028381 | Bacteria | 1062 |
| 220 | Ga0265338_10002483 | 3300028800 | Bacteria | 27550 |
| 221 | Ga0265338_10341526 | 3300028800 | Bacteria | 1079 |
| 222 | Ga0265325_10006304 | 3300031241 | Bacteria | 7216 |
| 223 | Ga0265340_10182852 | 3300031247 | Unclassified | 947 |
| 224 | Ga0265339_10027842 | 3300031249 | Bacteria | 3219 |
| 225 | Ga0265313_10002619 | 3300031595 | Bacteria | 15305 |
| 226 | Ga0265313_10015377 | 3300031595 | Bacteria | 4460 |
| 227 | Ga0265314_10040279 | 3300031711 | Bacteria | 3355 |
| 228 | Ga0265342_10036589 | 3300031712 | Bacteria | 2998 |
| 229 | Ga0307516_10095340 | 3300031730 | Bacteria | 2798 |
| 230 | Ga0373931_0624649 | 3300035691 | Unclassified | 706 |
| 231 | Ga0373935_0159705 | 3300035692 | Unclassified | 1536 |
| 232 | Ga0395900_0034293 | 3300037418 | Bacteria | 5225 |
| 233 | Ga0395898_0330516 | 3300037466 | Bacteria | 1453 |
| 234 | Ga0395901_0372261 | 3300038443 | Bacteria | 1471 |
| 235 | Ga0436360_0502399 | 3300039438 | Bacteria | 1856 |
| 236 | Ga0436361_1222762 | 3300039447 | Unclassified | 952 |
| 237 | Ga0436362_0617007 | 3300039453 | Bacteria | 1000 |
| 238 | Ga0466967_0024034 | 3300045976 | Bacteria | 5004 |
| 239 | Ga0495617_144750 | 3300046452 | Unclassified | 758 |
| 240 | Ga0495592_0380772 | 3300046454 | Unclassified | 898 |
| 241 | Ga0495596_0098183 | 3300046500 | Unclassified | 1137 |
| 242 | Ga0495630_0708674 | 3300046517 | Unclassified | 770 |
| 243 | Ga0495652_0544884 | 3300046529 | Unclassified | 798 |
| 244 | Ga0495609_0041521 | 3300046538 | Bacteria | 2067 |
| 245 | Ga0495656_0046070 | 3300046615 | Bacteria | 1844 |
| 246 | Ga0495599_0453408 | 3300046678 | Unclassified | 759 |
| 247 | Ga0495669_0322805 | 3300046684 | Unclassified | 745 |
| 248 | Ga0495613_0295204 | 3300046689 | Unclassified | 1123 |
| 249 | Ga0495670_0397692 | 3300046691 | Bacteria | 744 |
| 250 | Ga0495636_0060372 | 3300047318 | Bacteria | 1602 |
| 251 | Ga0495676_0507584 | 3300047321 | Bacteria | 791 |
| 252 | Ga0496101_0677748 | 3300048904 | Unclassified | 814 |
| 253 | Ga0496121_0000447 | 3300048924 | Bacteria | 81300 |
| 254 | Ga0501032_0266594 | 3300049569 | Unclassified | 1110 |
| 255 | Ga0501032_0316761 | 3300049569 | Unclassified | 1007 |
| 256 | Ga0501033_0011651 | 3300049570 | Bacteria | 6724 |
| 257 | Ga0501033_0019808 | 3300049570 | Bacteria | 5085 |
| 258 | Ga0501033_0065343 | 3300049570 | Bacteria | 2677 |
| 259 | Ga0501033_0065871 | 3300049570 | Bacteria | 2664 |
| 260 | Ga0501033_0127807 | 3300049570 | Bacteria | 1842 |
| 261 | Ga0501034_0110220 | 3300049571 | Bacteria | 2744 |
| 262 | Ga0501037_0560724 | 3300049573 | Bacteria | 770 |
| 263 | Ga0501038_0193561 | 3300049574 | Bacteria | 1635 |
| 264 | Ga0501038_0212738 | 3300049574 | Bacteria | 1546 |
| 265 | Ga0501038_0403570 | 3300049574 | Bacteria | 1057 |
| 266 | Ga0501046_0024008 | 3300049580 | Bacteria | 5007 |
| 267 | Ga0501046_0149809 | 3300049580 | Bacteria | 1760 |
| 268 | Ga0501047_0003299 | 3300049581 | Bacteria | 15279 |
| 269 | Ga0501047_0029599 | 3300049581 | Bacteria | 5279 |
| 270 | Ga0501047_0053164 | 3300049581 | Bacteria | 3915 |
| 271 | Ga0501047_0664909 | 3300049581 | Bacteria | 860 |
| 272 | Ga0501048_0273401 | 3300049582 | Bacteria | 1201 |
| 273 | Ga0501224_014394 | 3300049664 | Bacteria | 1170 |
| 274 | Ga0501249_010515 | 3300049679 | Bacteria | 1937 |
| 275 | Ga0501080_0036560 | 3300049742 | Bacteria | 4584 |
| 276 | Ga0501080_0112143 | 3300049742 | Bacteria | 2528 |
| 277 | Ga0501080_0150552 | 3300049742 | Bacteria | 2151 |
| 278 | Ga0501083_0336008 | 3300049744 | Bacteria | 982 |
| 279 | Ga0501035_0017511 | 3300049822 | Bacteria | 6610 |
| 280 | Ga0501035_0101961 | 3300049822 | Bacteria | 2518 |
| 281 | Ga0501035_0115261 | 3300049822 | Bacteria | 2352 |
| 282 | Ga0501044_0005515 | 3300049823 | Bacteria | 14047 |
| 283 | Ga0501044_0029483 | 3300049823 | Bacteria | 5785 |
| 284 | Ga0501044_0051134 | 3300049823 | Bacteria | 4261 |
| 285 | Ga0501044_0090838 | 3300049823 | Bacteria | 3080 |
| 286 | Ga0501044_0423682 | 3300049823 | Unclassified | 1241 |
| 287 | Ga0501044_1246912 | 3300049823 | Bacteria | 611 |
| 288 | Ga0500595_001289 | 3300053119 | Bacteria | 13640 |
| 289 | Ga0500595_011434 | 3300053119 | Bacteria | 3477 |
| 290 | Ga0500573_0000028 | 3300053140 | Bacteria | 142610 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_1246912 | Ga0501044_1246912_38_598 | 184 |
| 2 | 3300049581 | Ga0501047_0664909 | Ga0501047_0664909_260_823 | 185 |
| 3 | 3300053119 | Ga0500595_011434 | Ga0500595_011434_2844_3464 | 190 |
| 4 | 3300046454 | Ga0495592_0380772 | Ga0495592_0380772_45_701 | 191 |
| 5 | 3300046529 | Ga0495652_0544884 | Ga0495652_0544884_31_687 | 191 |
| 6 | 3300046615 | Ga0495656_0046070 | Ga0495656_0046070_785_1360 | 191 |
| 7 | 3300046678 | Ga0495599_0453408 | Ga0495599_0453408_62_718 | 191 |
| 8 | 3300046689 | Ga0495613_0295204 | Ga0495613_0295204_126_782 | 191 |
| 9 | 3300005328 | Ga0070676_10139258 | Ga0070676_101392582 | 193 |
| 10 | 3300005355 | Ga0070671_100434796 | Ga0070671_1004347961 | 193 |
| 11 | 3300006358 | Ga0068871_100093652 | Ga0068871_1000936522 | 193 |
| 12 | 3300009176 | Ga0105242_10411878 | Ga0105242_104118782 | 193 |
| 13 | 3300011119 | Ga0105246_10008459 | Ga0105246_100084593 | 193 |
| 14 | 3300013296 | Ga0157374_10278364 | Ga0157374_102783642 | 193 |
| 15 | 3300025927 | Ga0207687_10110242 | Ga0207687_101102422 | 193 |
| 16 | 3300025934 | Ga0207686_10175048 | Ga0207686_101750482 | 193 |
| 17 | 3300026121 | Ga0207683_10083364 | Ga0207683_100833642 | 193 |
| 18 | 3300035691 | Ga0373931_0624649 | Ga0373931_0624649_101_685 | 194 |
| 19 | 3300046691 | Ga0495670_0397692 | Ga0495670_0397692_16_600 | 194 |
| 20 | 3300049664 | Ga0501224_014394 | Ga0501224_014394_354_941 | 194 |
| 21 | 3300049679 | Ga0501249_010515 | Ga0501249_010515_42_629 | 194 |
| 22 | 3300005334 | Ga0068869_100617883 | Ga0068869_1006178832 | 196 |
| 23 | 3300006175 | Ga0070712_100323925 | Ga0070712_1003239251 | 196 |
| 24 | 3300025915 | Ga0207693_10165685 | Ga0207693_101656852 | 196 |
| 25 | 3300005548 | Ga0070665_100353694 | Ga0070665_1003536942 | 198 |
| 26 | 3300028800 | Ga0265338_10341526 | Ga0265338_103415262 | 199 |
| 27 | 3300031241 | Ga0265325_10006304 | Ga0265325_100063045 | 199 |
| 28 | 3300031249 | Ga0265339_10027842 | Ga0265339_100278422 | 199 |
| 29 | 3300031595 | Ga0265313_10015377 | Ga0265313_100153772 | 199 |
| 30 | 3300031712 | Ga0265342_10036589 | Ga0265342_100365892 | 199 |
| 31 | 3300049570 | Ga0501033_0019808 | Ga0501033_0019808_3342_3941 | 199 |
| 32 | 3300031595 | Ga0265313_10002619 | Ga0265313_100026192 | 201 |
| 33 | 3300049570 | Ga0501033_0065871 | Ga0501033_0065871_696_1307 | 201 |
| 34 | 3300049580 | Ga0501046_0024008 | Ga0501046_0024008_346_957 | 201 |
| 35 | 3300049581 | Ga0501047_0053164 | Ga0501047_0053164_2763_3374 | 201 |
| 36 | 3300049742 | Ga0501080_0036560 | Ga0501080_0036560_2036_2647 | 201 |
| 37 | 3300049742 | Ga0501080_0150552 | Ga0501080_0150552_418_1029 | 201 |
| 38 | 3300049823 | Ga0501044_0051134 | Ga0501044_0051134_2735_3346 | 201 |
| 39 | 3300049570 | Ga0501033_0127807 | Ga0501033_0127807_712_1326 | 202 |
| 40 | 3300049573 | Ga0501037_0560724 | Ga0501037_0560724_132_746 | 202 |
| 41 | 3300049574 | Ga0501038_0212738 | Ga0501038_0212738_158_772 | 202 |
| 42 | 3300049582 | Ga0501048_0273401 | Ga0501048_0273401_354_968 | 202 |
| 43 | 3300049822 | Ga0501035_0101961 | Ga0501035_0101961_923_1537 | 202 |
| 44 | 3300049823 | Ga0501044_0090838 | Ga0501044_0090838_1754_2368 | 202 |
| 45 | 3300005334 | Ga0068869_100255650 | Ga0068869_1002556501 | 204 |
| 46 | 3300005547 | Ga0070693_100362562 | Ga0070693_1003625622 | 204 |
| 47 | 3300005615 | Ga0070702_100652760 | Ga0070702_1006527601 | 204 |
| 48 | 3300006237 | Ga0097621_100110150 | Ga0097621_1001101501 | 204 |
| 49 | 3300009174 | Ga0105241_10326770 | Ga0105241_103267701 | 204 |
| 50 | 3300013297 | Ga0157378_10017445 | Ga0157378_100174452 | 204 |
| 51 | 3300013308 | Ga0157375_10420222 | Ga0157375_104202222 | 204 |
| 52 | 3300014968 | Ga0157379_10032005 | Ga0157379_100320053 | 204 |
| 53 | 3300046517 | Ga0495630_0708674 | Ga0495630_0708674_42_674 | 204 |
| 54 | 3300005435 | Ga0070714_101009715 | Ga0070714_1010097151 | 205 |
| 55 | 3300025929 | Ga0207664_10746475 | Ga0207664_107464751 | 205 |
| 56 | 3300049570 | Ga0501033_0065343 | Ga0501033_0065343_1184_1807 | 205 |
| 57 | 3300049581 | Ga0501047_0029599 | Ga0501047_0029599_4435_5058 | 205 |
| 58 | 3300005327 | Ga0070658_10004056 | Ga0070658_100040564 | 206 |
| 59 | 3300005327 | Ga0070658_10817687 | Ga0070658_108176871 | 206 |
| 60 | 3300005328 | Ga0070676_10379373 | Ga0070676_103793731 | 206 |
| 61 | 3300005329 | Ga0070683_100097852 | Ga0070683_1000978522 | 206 |
| 62 | 3300005329 | Ga0070683_100788028 | Ga0070683_1007880281 | 206 |
| 63 | 3300005330 | Ga0070690_100205405 | Ga0070690_1002054052 | 206 |
| 64 | 3300005331 | Ga0070670_100609229 | Ga0070670_1006092292 | 206 |
| 65 | 3300005334 | Ga0068869_100688763 | Ga0068869_1006887631 | 206 |
| 66 | 3300005335 | Ga0070666_10023144 | Ga0070666_100231442 | 206 |
| 67 | 3300005335 | Ga0070666_10573941 | Ga0070666_105739411 | 206 |
| 68 | 3300005335 | Ga0070666_10761734 | Ga0070666_107617341 | 206 |
| 69 | 3300005336 | Ga0070680_100049307 | Ga0070680_1000493072 | 206 |
| 70 | 3300005336 | Ga0070680_100529182 | Ga0070680_1005291821 | 206 |
| 71 | 3300005338 | Ga0068868_100359480 | Ga0068868_1003594801 | 206 |
| 72 | 3300005338 | Ga0068868_100409612 | Ga0068868_1004096122 | 206 |
| 73 | 3300005338 | Ga0068868_100620713 | Ga0068868_1006207132 | 206 |
| 74 | 3300005339 | Ga0070660_100005543 | Ga0070660_1000055433 | 206 |
| 75 | 3300005339 | Ga0070660_100058587 | Ga0070660_1000585872 | 206 |
| 76 | 3300005340 | Ga0070689_100585707 | Ga0070689_1005857071 | 206 |
| 77 | 3300005344 | Ga0070661_100197837 | Ga0070661_1001978371 | 206 |
| 78 | 3300005344 | Ga0070661_100301323 | Ga0070661_1003013232 | 206 |
| 79 | 3300005344 | Ga0070661_100316554 | Ga0070661_1003165541 | 206 |
| 80 | 3300005354 | Ga0070675_100304597 | Ga0070675_1003045972 | 206 |
| 81 | 3300005364 | Ga0070673_100664454 | Ga0070673_1006644542 | 206 |
| 82 | 3300005367 | Ga0070667_100045702 | Ga0070667_1000457021 | 206 |
| 83 | 3300005434 | Ga0070709_10629669 | Ga0070709_106296691 | 206 |
| 84 | 3300005436 | Ga0070713_100225755 | Ga0070713_1002257552 | 206 |
| 85 | 3300005436 | Ga0070713_100403595 | Ga0070713_1004035952 | 206 |
| 86 | 3300005438 | Ga0070701_10369031 | Ga0070701_103690311 | 206 |
| 87 | 3300005439 | Ga0070711_100192967 | Ga0070711_1001929671 | 206 |
| 88 | 3300005441 | Ga0070700_100053891 | Ga0070700_1000538912 | 206 |
| 89 | 3300005456 | Ga0070678_100018146 | Ga0070678_1000181463 | 206 |
| 90 | 3300005456 | Ga0070678_100322749 | Ga0070678_1003227492 | 206 |
| 91 | 3300005458 | Ga0070681_10706417 | Ga0070681_107064171 | 206 |
| 92 | 3300005459 | Ga0068867_100016315 | Ga0068867_1000163154 | 206 |
| 93 | 3300005459 | Ga0068867_100147424 | Ga0068867_1001474242 | 206 |
| 94 | 3300005530 | Ga0070679_100015867 | Ga0070679_1000158677 | 206 |
| 95 | 3300005530 | Ga0070679_100164107 | Ga0070679_1001641072 | 206 |
| 96 | 3300005543 | Ga0070672_100654140 | Ga0070672_1006541402 | 206 |
| 97 | 3300005548 | Ga0070665_100005978 | Ga0070665_1000059784 | 206 |
| 98 | 3300005548 | Ga0070665_100006286 | Ga0070665_1000062866 | 206 |
| 99 | 3300005548 | Ga0070665_100009536 | Ga0070665_1000095366 | 206 |
| 100 | 3300005548 | Ga0070665_100173167 | Ga0070665_1001731672 | 206 |
| 101 | 3300005548 | Ga0070665_100625688 | Ga0070665_1006256882 | 206 |
| 102 | 3300005563 | Ga0068855_100078531 | Ga0068855_1000785313 | 206 |
| 103 | 3300005577 | Ga0068857_100099799 | Ga0068857_1000997993 | 206 |
| 104 | 3300005578 | Ga0068854_100484405 | Ga0068854_1004844052 | 206 |
| 105 | 3300005615 | Ga0070702_100554278 | Ga0070702_1005542781 | 206 |
| 106 | 3300005616 | Ga0068852_100136048 | Ga0068852_1001360481 | 206 |
| 107 | 3300005617 | Ga0068859_100629047 | Ga0068859_1006290472 | 206 |
| 108 | 3300005618 | Ga0068864_100194910 | Ga0068864_1001949101 | 206 |
| 109 | 3300005618 | Ga0068864_100794572 | Ga0068864_1007945721 | 206 |
| 110 | 3300005718 | Ga0068866_10078452 | Ga0068866_100784521 | 206 |
| 111 | 3300005718 | Ga0068866_10232338 | Ga0068866_102323382 | 206 |
| 112 | 3300005840 | Ga0068870_10072629 | Ga0068870_100726292 | 206 |
| 113 | 3300005841 | Ga0068863_100085891 | Ga0068863_1000858912 | 206 |
| 114 | 3300005841 | Ga0068863_100348457 | Ga0068863_1003484571 | 206 |
| 115 | 3300005842 | Ga0068858_101207069 | Ga0068858_1012070691 | 206 |
| 116 | 3300005843 | Ga0068860_100182588 | Ga0068860_1001825882 | 206 |
| 117 | 3300006237 | Ga0097621_100000667 | Ga0097621_10000066722 | 206 |
| 118 | 3300006237 | Ga0097621_100126398 | Ga0097621_1001263983 | 206 |
| 119 | 3300006237 | Ga0097621_100157104 | Ga0097621_1001571042 | 206 |
| 120 | 3300006237 | Ga0097621_100451207 | Ga0097621_1004512071 | 206 |
| 121 | 3300006358 | Ga0068871_100000806 | Ga0068871_10000080615 | 206 |
| 122 | 3300006358 | Ga0068871_100073566 | Ga0068871_1000735662 | 206 |
| 123 | 3300006881 | Ga0068865_100006179 | Ga0068865_1000061795 | 206 |
| 124 | 3300006881 | Ga0068865_100517297 | Ga0068865_1005172972 | 206 |
| 125 | 3300006931 | Ga0097620_100629074 | Ga0097620_1006290742 | 206 |
| 126 | 3300009093 | Ga0105240_10042761 | Ga0105240_100427613 | 206 |
| 127 | 3300009093 | Ga0105240_10077043 | Ga0105240_100770432 | 206 |
| 128 | 3300009093 | Ga0105240_10085153 | Ga0105240_100851532 | 206 |
| 129 | 3300009093 | Ga0105240_10246498 | Ga0105240_102464982 | 206 |
| 130 | 3300009093 | Ga0105240_10276510 | Ga0105240_102765102 | 206 |
| 131 | 3300009093 | Ga0105240_10766847 | Ga0105240_107668472 | 206 |
| 132 | 3300009098 | Ga0105245_10283121 | Ga0105245_102831212 | 206 |
| 133 | 3300009148 | Ga0105243_10041679 | Ga0105243_100416793 | 206 |
| 134 | 3300009148 | Ga0105243_10506506 | Ga0105243_105065062 | 206 |
| 135 | 3300009174 | Ga0105241_10066538 | Ga0105241_100665383 | 206 |
| 136 | 3300009174 | Ga0105241_10266699 | Ga0105241_102666991 | 206 |
| 137 | 3300009176 | Ga0105242_10043568 | Ga0105242_100435683 | 206 |
| 138 | 3300009176 | Ga0105242_10204157 | Ga0105242_102041572 | 206 |
| 139 | 3300009176 | Ga0105242_11293125 | Ga0105242_112931251 | 206 |
| 140 | 3300009177 | Ga0105248_10029930 | Ga0105248_100299304 | 206 |
| 141 | 3300009177 | Ga0105248_10422702 | Ga0105248_104227022 | 206 |
| 142 | 3300009177 | Ga0105248_10518360 | Ga0105248_105183602 | 206 |
| 143 | 3300009177 | Ga0105248_11056791 | Ga0105248_110567911 | 206 |
| 144 | 3300009545 | Ga0105237_10021039 | Ga0105237_100210395 | 206 |
| 145 | 3300009545 | Ga0105237_10130629 | Ga0105237_101306292 | 206 |
| 146 | 3300009545 | Ga0105237_10458965 | Ga0105237_104589651 | 206 |
| 147 | 3300009545 | Ga0105237_10758925 | Ga0105237_107589251 | 206 |
| 148 | 3300009551 | Ga0105238_10018243 | Ga0105238_100182433 | 206 |
| 149 | 3300009551 | Ga0105238_10097166 | Ga0105238_100971663 | 206 |
| 150 | 3300009551 | Ga0105238_10315163 | Ga0105238_103151632 | 206 |
| 151 | 3300009551 | Ga0105238_10516727 | Ga0105238_105167272 | 206 |
| 152 | 3300009551 | Ga0105238_10532211 | Ga0105238_105322111 | 206 |
| 153 | 3300009551 | Ga0105238_10803124 | Ga0105238_108031242 | 206 |
| 154 | 3300009553 | Ga0105249_11180855 | Ga0105249_111808551 | 206 |
| 155 | 3300009553 | Ga0105249_11678393 | Ga0105249_116783931 | 206 |
| 156 | 3300010375 | Ga0105239_10070850 | Ga0105239_100708502 | 206 |
| 157 | 3300011119 | Ga0105246_10189731 | Ga0105246_101897311 | 206 |
| 158 | 3300013105 | Ga0157369_10182239 | Ga0157369_101822392 | 206 |
| 159 | 3300013105 | Ga0157369_10924095 | Ga0157369_109240952 | 206 |
| 160 | 3300013105 | Ga0157369_11330163 | Ga0157369_113301631 | 206 |
| 161 | 3300013296 | Ga0157374_10132260 | Ga0157374_101322602 | 206 |
| 162 | 3300013296 | Ga0157374_10434465 | Ga0157374_104344652 | 206 |
| 163 | 3300013296 | Ga0157374_11178819 | Ga0157374_111788191 | 206 |
| 164 | 3300013297 | Ga0157378_10412688 | Ga0157378_104126882 | 206 |
| 165 | 3300013297 | Ga0157378_10695333 | Ga0157378_106953332 | 206 |
| 166 | 3300013306 | Ga0163162_10035832 | Ga0163162_100358323 | 206 |
| 167 | 3300013306 | Ga0163162_10085017 | Ga0163162_100850173 | 206 |
| 168 | 3300013306 | Ga0163162_10090934 | Ga0163162_100909342 | 206 |
| 169 | 3300013306 | Ga0163162_10395424 | Ga0163162_103954242 | 206 |
| 170 | 3300013307 | Ga0157372_10250348 | Ga0157372_102503482 | 206 |
| 171 | 3300013307 | Ga0157372_10496698 | Ga0157372_104966982 | 206 |
| 172 | 3300013308 | Ga0157375_11355138 | Ga0157375_113551381 | 206 |
| 173 | 3300014325 | Ga0163163_10000016 | Ga0163163_1000001678 | 206 |
| 174 | 3300014325 | Ga0163163_10015252 | Ga0163163_100152522 | 206 |
| 175 | 3300014325 | Ga0163163_11345427 | Ga0163163_113454271 | 206 |
| 176 | 3300014968 | Ga0157379_10001653 | Ga0157379_1000165316 | 206 |
| 177 | 3300014969 | Ga0157376_10008091 | Ga0157376_100080914 | 206 |
| 178 | 3300014969 | Ga0157376_10412660 | Ga0157376_104126602 | 206 |
| 179 | 3300017792 | Ga0163161_10042985 | Ga0163161_100429852 | 206 |
| 180 | 3300025261 | Ga0209233_1000006 | Ga0209233_10000061202 | 206 |
| 181 | 3300025261 | Ga0209233_1007760 | Ga0209233_10077603 | 206 |
| 182 | 3300025893 | Ga0207682_10115335 | Ga0207682_101153351 | 206 |
| 183 | 3300025903 | Ga0207680_10110894 | Ga0207680_101108941 | 206 |
| 184 | 3300025903 | Ga0207680_10217203 | Ga0207680_102172031 | 206 |
| 185 | 3300025907 | Ga0207645_10026531 | Ga0207645_100265311 | 206 |
| 186 | 3300025908 | Ga0207643_10078863 | Ga0207643_100788632 | 206 |
| 187 | 3300025909 | Ga0207705_10002317 | Ga0207705_100023172 | 206 |
| 188 | 3300025909 | Ga0207705_10221744 | Ga0207705_102217442 | 206 |
| 189 | 3300025911 | Ga0207654_10460805 | Ga0207654_104608052 | 206 |
| 190 | 3300025912 | Ga0207707_10420543 | Ga0207707_104205431 | 206 |
| 191 | 3300025913 | Ga0207695_10031933 | Ga0207695_100319333 | 206 |
| 192 | 3300025913 | Ga0207695_10064633 | Ga0207695_100646333 | 206 |
| 193 | 3300025913 | Ga0207695_10075233 | Ga0207695_100752334 | 206 |
| 194 | 3300025913 | Ga0207695_10226662 | Ga0207695_102266621 | 206 |
| 195 | 3300025913 | Ga0207695_10875943 | Ga0207695_108759431 | 206 |
| 196 | 3300025914 | Ga0207671_10086641 | Ga0207671_100866412 | 206 |
| 197 | 3300025914 | Ga0207671_10312850 | Ga0207671_103128501 | 206 |
| 198 | 3300025914 | Ga0207671_10493352 | Ga0207671_104933522 | 206 |
| 199 | 3300025916 | Ga0207663_10115700 | Ga0207663_101157001 | 206 |
| 200 | 3300025917 | Ga0207660_10069993 | Ga0207660_100699932 | 206 |
| 201 | 3300025917 | Ga0207660_10365890 | Ga0207660_103658902 | 206 |
| 202 | 3300025919 | Ga0207657_10004742 | Ga0207657_1000474212 | 206 |
| 203 | 3300025919 | Ga0207657_10049125 | Ga0207657_100491252 | 206 |
| 204 | 3300025920 | Ga0207649_10388554 | Ga0207649_103885542 | 206 |
| 205 | 3300025920 | Ga0207649_10517745 | Ga0207649_105177451 | 206 |
| 206 | 3300025921 | Ga0207652_10024717 | Ga0207652_100247171 | 206 |
| 207 | 3300025921 | Ga0207652_10103525 | Ga0207652_101035252 | 206 |
| 208 | 3300025924 | Ga0207694_10004917 | Ga0207694_100049175 | 206 |
| 209 | 3300025924 | Ga0207694_10077073 | Ga0207694_100770732 | 206 |
| 210 | 3300025924 | Ga0207694_10216905 | Ga0207694_102169052 | 206 |
| 211 | 3300025926 | Ga0207659_10247134 | Ga0207659_102471341 | 206 |
| 212 | 3300025926 | Ga0207659_10625302 | Ga0207659_106253021 | 206 |
| 213 | 3300025927 | Ga0207687_10399677 | Ga0207687_103996771 | 206 |
| 214 | 3300025928 | Ga0207700_10039966 | Ga0207700_100399664 | 206 |
| 215 | 3300025928 | Ga0207700_10525599 | Ga0207700_105255992 | 206 |
| 216 | 3300025928 | Ga0207700_10665782 | Ga0207700_106657821 | 206 |
| 217 | 3300025931 | Ga0207644_10204084 | Ga0207644_102040841 | 206 |
| 218 | 3300025934 | Ga0207686_10022268 | Ga0207686_100222682 | 206 |
| 219 | 3300025934 | Ga0207686_10044827 | Ga0207686_100448272 | 206 |
| 220 | 3300025934 | Ga0207686_10166858 | Ga0207686_101668582 | 206 |
| 221 | 3300025935 | Ga0207709_10896035 | Ga0207709_108960351 | 206 |
| 222 | 3300025936 | Ga0207670_10267742 | Ga0207670_102677421 | 206 |
| 223 | 3300025938 | Ga0207704_10022115 | Ga0207704_100221153 | 206 |
| 224 | 3300025938 | Ga0207704_10536434 | Ga0207704_105364341 | 206 |
| 225 | 3300025940 | Ga0207691_10318459 | Ga0207691_103184592 | 206 |
| 226 | 3300025940 | Ga0207691_10967481 | Ga0207691_109674811 | 206 |
| 227 | 3300025941 | Ga0207711_10022831 | Ga0207711_100228312 | 206 |
| 228 | 3300025941 | Ga0207711_10128023 | Ga0207711_101280232 | 206 |
| 229 | 3300025942 | Ga0207689_10009654 | Ga0207689_100096542 | 206 |
| 230 | 3300025942 | Ga0207689_10722681 | Ga0207689_107226811 | 206 |
| 231 | 3300025949 | Ga0207667_10132788 | Ga0207667_101327881 | 206 |
| 232 | 3300025949 | Ga0207667_10750635 | Ga0207667_107506352 | 206 |
| 233 | 3300026023 | Ga0207677_10769285 | Ga0207677_107692852 | 206 |
| 234 | 3300026035 | Ga0207703_10072113 | Ga0207703_100721132 | 206 |
| 235 | 3300026067 | Ga0207678_10096833 | Ga0207678_100968332 | 206 |
| 236 | 3300026075 | Ga0207708_10477828 | Ga0207708_104778281 | 206 |
| 237 | 3300026078 | Ga0207702_10205232 | Ga0207702_102052321 | 206 |
| 238 | 3300026088 | Ga0207641_10062148 | Ga0207641_100621482 | 206 |
| 239 | 3300026088 | Ga0207641_10330060 | Ga0207641_103300602 | 206 |
| 240 | 3300026089 | Ga0207648_10022893 | Ga0207648_100228936 | 206 |
| 241 | 3300026089 | Ga0207648_10113041 | Ga0207648_101130411 | 206 |
| 242 | 3300026116 | Ga0207674_10061669 | Ga0207674_100616693 | 206 |
| 243 | 3300026116 | Ga0207674_10086900 | Ga0207674_100869002 | 206 |
| 244 | 3300026116 | Ga0207674_10279614 | Ga0207674_102796142 | 206 |
| 245 | 3300026116 | Ga0207674_10666871 | Ga0207674_106668712 | 206 |
| 246 | 3300026121 | Ga0207683_10032253 | Ga0207683_100322532 | 206 |
| 247 | 3300028379 | Ga0268266_10001078 | Ga0268266_1000107831 | 206 |
| 248 | 3300028379 | Ga0268266_10028972 | Ga0268266_100289723 | 206 |
| 249 | 3300028379 | Ga0268266_10084400 | Ga0268266_100844002 | 206 |
| 250 | 3300028379 | Ga0268266_10108417 | Ga0268266_101084172 | 206 |
| 251 | 3300028379 | Ga0268266_10154754 | Ga0268266_101547542 | 206 |
| 252 | 3300028379 | Ga0268266_10833427 | Ga0268266_108334271 | 206 |
| 253 | 3300028381 | Ga0268264_10626917 | Ga0268264_106269171 | 206 |
| 254 | 3300028800 | Ga0265338_10002483 | Ga0265338_100024836 | 206 |
| 255 | 3300031247 | Ga0265340_10182852 | Ga0265340_101828521 | 206 |
| 256 | 3300031711 | Ga0265314_10040279 | Ga0265314_100402792 | 206 |
| 257 | 3300031730 | Ga0307516_10095340 | Ga0307516_100953401 | 206 |
| 258 | 3300035692 | Ga0373935_0159705 | Ga0373935_0159705_340_960 | 206 |
| 259 | 3300037418 | Ga0395900_0034293 | Ga0395900_0034293_2678_3298 | 206 |
| 260 | 3300037466 | Ga0395898_0330516 | Ga0395898_0330516_102_722 | 206 |
| 261 | 3300038443 | Ga0395901_0372261 | Ga0395901_0372261_825_1445 | 206 |
| 262 | 3300039438 | Ga0436360_0502399 | Ga0436360_0502399_550_1170 | 206 |
| 263 | 3300039447 | Ga0436361_1222762 | Ga0436361_1222762_67_687 | 206 |
| 264 | 3300039453 | Ga0436362_0617007 | Ga0436362_0617007_314_934 | 206 |
| 265 | 3300045976 | Ga0466967_0024034 | Ga0466967_0024034_82_702 | 206 |
| 266 | 3300046452 | Ga0495617_144750 | Ga0495617_144750_116_736 | 206 |
| 267 | 3300046500 | Ga0495596_0098183 | Ga0495596_0098183_175_870 | 206 |
| 268 | 3300046538 | Ga0495609_0041521 | Ga0495609_0041521_649_1269 | 206 |
| 269 | 3300046684 | Ga0495669_0322805 | Ga0495669_0322805_21_641 | 206 |
| 270 | 3300047318 | Ga0495636_0060372 | Ga0495636_0060372_94_714 | 206 |
| 271 | 3300047321 | Ga0495676_0507584 | Ga0495676_0507584_97_717 | 206 |
| 272 | 3300048904 | Ga0496101_0677748 | Ga0496101_0677748_42_716 | 206 |
| 273 | 3300048924 | Ga0496121_0000447 | Ga0496121_0000447_14169_14789 | 206 |
| 274 | 3300049569 | Ga0501032_0266594 | Ga0501032_0266594_18_656 | 206 |
| 275 | 3300049569 | Ga0501032_0316761 | Ga0501032_0316761_179_889 | 206 |
| 276 | 3300049570 | Ga0501033_0011651 | Ga0501033_0011651_349_1059 | 206 |
| 277 | 3300049571 | Ga0501034_0110220 | Ga0501034_0110220_535_1245 | 206 |
| 278 | 3300049574 | Ga0501038_0193561 | Ga0501038_0193561_137_847 | 206 |
| 279 | 3300049574 | Ga0501038_0403570 | Ga0501038_0403570_320_955 | 206 |
| 280 | 3300049580 | Ga0501046_0149809 | Ga0501046_0149809_874_1584 | 206 |
| 281 | 3300049581 | Ga0501047_0003299 | Ga0501047_0003299_2099_2809 | 206 |
| 282 | 3300049742 | Ga0501080_0112143 | Ga0501080_0112143_255_875 | 206 |
| 283 | 3300049744 | Ga0501083_0336008 | Ga0501083_0336008_337_957 | 206 |
| 284 | 3300049822 | Ga0501035_0017511 | Ga0501035_0017511_4515_5225 | 206 |
| 285 | 3300049822 | Ga0501035_0115261 | Ga0501035_0115261_1451_2077 | 206 |
| 286 | 3300049823 | Ga0501044_0005515 | Ga0501044_0005515_847_1557 | 206 |
| 287 | 3300049823 | Ga0501044_0029483 | Ga0501044_0029483_1992_2618 | 206 |
| 288 | 3300049823 | Ga0501044_0423682 | Ga0501044_0423682_416_1036 | 206 |
| 289 | 3300053119 | Ga0500595_001289 | Ga0500595_001289_1739_2359 | 206 |
| 290 | 3300053140 | Ga0500573_0000028 | Ga0500573_0000028_127644_128264 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kph-assembly1.cif.gz_A | solution nmr structure of denovo beta sheet design protein, northeast structural genomics consortium (nesg) target or485 | 0.8595 | 119 | 168 |
| 2qgu-assembly1.cif.gz_A | three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 | 0.8555 | 34 | 206 |
| 8dte-assembly1.cif.gz_A | crystal structure of a toluene tolerance periplasmic transport protein from neisseria gonorrhoeae | 0.8524 | 34 | 201 |
| 5uwa-assembly2.cif.gz_B | structure of e. coli phospholipid binding protein mlac | 0.8486 | 33 | 206 |
| 8dte-assembly1.cif.gz_A | crystal structure of a toluene tolerance periplasmic transport protein from neisseria gonorrhoeae | 0.83 | 34 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86H45_737_901_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.89 | 120 | 152 | 2.130.10.10 |
| af_P0ADV7_24_204_3.10.450.710 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC | 0.8588 | 33 | 203 | 3.10.450.710 |
| af_P34324_2_129_2.60.210.10 | Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | 0.8525 | 120 | 152 | 2.60.210.10 |
| af_H2KYK6_7_131_2.60.210.10 | Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | 0.8234 | 116 | 157 | 2.60.210.10 |
| af_A1ZAW0_1657_1719_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8177 | 116 | 152 | 3.30.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3IXG1-F1-model_v4 | Hopanoid biosynthesis protein HpnM | 0.9786 | 68 | 206 |
|
| AF-A0A1Q3IXG1-F1-model_v4 | Hopanoid biosynthesis protein HpnM | 0.9649 | 68 | 206 |
|
| AF-A0A353YCJ5-F1-model_v4 | Hopanoid biosynthesis protein HpnM | 0.9616 | 34 | 205 |
|
| AF-A0A1G3IPQ4-F1-model_v4 | Toluene tolerance protein | 0.9475 | 31 | 206 |
|
| AF-A0A1Q2SN27-F1-model_v4 | Hopanoid biosynthesis associated membrane protein HpnM | 0.9472 | 57 | 206 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar