F389923

General Info

Members Datasets Scaffolds Average Seq Length
290 180 290 349

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0010313|Ga0466967_0010313_5492_6628
Length 378
Sequence MTSYRSAGVDIAAGDRAVELMKDSVKRTARPEVIGGLGGFAGLFSLDLVRYPQPVLASSTDGVGTKIAIARAADRHDTIGIDLVAMVVDDLVVVGAEPLFLTDYIATGKVLPERIAAIVSGISEGCVRAGCALVGGETAEHPGLMDPDEYDLSGTGVGVVNADSVLGPDRVGAGDVLIAIGSSGLHSNGYSLVRSVLFDQGGLALDATPDLLDGRALVDELLEPTRIYAKDCLALARDAGAHAFAHVTGGGLAGNLARVLPPGLVARVDRATWSPPAVFVLVARIGSVPQDQLELTFNLGVGMIAVVPRDRVDDALAVLASGQVPAWVAGDVAYPGSTAPVNLPNSAHTDQTPSQRTGHVEMASSYAGNPGFWGLDRQ

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 2.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.72
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002828 3300002067 Bacteria 5989
2 JGI24751J29686_10002316 3300002459 Bacteria 3849
3 Ga0070658_10117781 3300005327 Bacteria 2205
4 Ga0070670_100015180 3300005331 Bacteria 6611
5 Ga0068869_100000606 3300005334 Bacteria 20205
6 Ga0070680_100033113 3300005336 Bacteria 4163
7 Ga0068868_100034498 3300005338 Bacteria 3906
8 Ga0070660_100008478 3300005339 Bacteria 7193
9 Ga0070660_100044841 3300005339 Bacteria 3383
10 Ga0070689_100018052 3300005340 Bacteria 5190
11 Ga0070661_100189230 3300005344 Bacteria 1569
12 Ga0070692_10012696 3300005345 Bacteria 3910
13 Ga0070692_10050611 3300005345 Bacteria 2158
14 Ga0070668_100017940 3300005347 Bacteria 5309
15 Ga0070671_100007992 3300005355 Bacteria 8466
16 Ga0070671_100016400 3300005355 Bacteria 5991
17 Ga0070671_100102824 3300005355 Bacteria 2397
18 Ga0070673_100007062 3300005364 Bacteria 7368
19 Ga0070673_100026247 3300005364 Bacteria 4301
20 Ga0070667_100001770 3300005367 Bacteria 19230
21 Ga0070667_100035109 3300005367 Bacteria 4200
22 Ga0070703_10010790 3300005406 Bacteria 2577
23 Ga0070714_100000126 3300005435 Bacteria 60425
24 Ga0070713_100001156 3300005436 Bacteria 16920
25 Ga0070713_100015431 3300005436 Bacteria 5711
26 Ga0070711_100013864 3300005439 Bacteria 5071
27 Ga0070663_100005595 3300005455 Bacteria 7480
28 Ga0070678_100006122 3300005456 Bacteria 7024
29 Ga0070678_100081657 3300005456 Bacteria 2451
30 Ga0070685_10021370 3300005466 Bacteria 3517
31 Ga0070679_100012776 3300005530 Bacteria 8034
32 Ga0068853_100005838 3300005539 Bacteria 9695
33 Ga0070672_100163905 3300005543 Bacteria 1846
34 Ga0070686_100037792 3300005544 Bacteria 2997
35 Ga0070686_100123004 3300005544 Bacteria 1784
36 Ga0070695_100015782 3300005545 Bacteria 4563
37 Ga0070696_100027194 3300005546 Bacteria 3895
38 Ga0070693_100000246 3300005547 Bacteria 25400
39 Ga0070693_100040727 3300005547 Bacteria 2610
40 Ga0070665_100003390 3300005548 Bacteria 17043
41 Ga0068855_100012420 3300005563 Bacteria 10285
42 Ga0068855_100173901 3300005563 Bacteria 2438
43 Ga0068855_100231169 3300005563 Bacteria 2070
44 Ga0068854_100132367 3300005578 Bacteria 1905
45 Ga0068856_100016265 3300005614 Bacteria 7197
46 Ga0068856_100279464 3300005614 Bacteria 1686
47 Ga0070702_100000087 3300005615 Bacteria 27223
48 Ga0068852_100289423 3300005616 Bacteria 1582
49 Ga0068859_100092319 3300005617 Bacteria 3079
50 Ga0068864_100029155 3300005618 Bacteria 4669
51 Ga0068861_100006590 3300005719 Bacteria 7926
52 Ga0068870_10000054 3300005840 Bacteria 36323
53 Ga0068863_100001108 3300005841 Bacteria 26941
54 Ga0068863_100001135 3300005841 Bacteria 26616
55 Ga0068858_100007344 3300005842 Bacteria 10665
56 Ga0068858_100467290 3300005842 Bacteria 1217
57 Ga0068860_100000261 3300005843 Bacteria 77163
58 Ga0081455_10046416 3300005937 Bacteria 3769
59 Ga0081538_10000139 3300005981 Bacteria 75075
60 Ga0081540_1049444 3300005983 Bacteria 2097
61 Ga0070716_100009957 3300006173 Bacteria 4754
62 Ga0070712_100075133 3300006175 Bacteria 2430
63 Ga0097621_100009324 3300006237 Bacteria 7124
64 Ga0097621_100078152 3300006237 Bacteria 2749
65 Ga0068871_100092241 3300006358 Bacteria 2526
66 Ga0075431_100316440 3300006847 Bacteria 1574
67 Ga0075433_10012177 3300006852 Bacteria 6936
68 Ga0075433_10020089 3300006852 Bacteria 5578
69 Ga0075434_100018305 3300006871 Bacteria 6765
70 Ga0075429_100043114 3300006880 Bacteria 3925
71 Ga0075436_100004385 3300006914 Bacteria 9685
72 Ga0097620_100092321 3300006931 Bacteria 3079
73 Ga0075435_100000557 3300007076 Bacteria 22898
74 Ga0105251_10030668 3300009011 Bacteria 2697
75 Ga0105251_10132044 3300009011 Bacteria 1131
76 Ga0105240_10168886 3300009093 Bacteria 2592
77 Ga0105240_10177882 3300009093 Bacteria 2514
78 Ga0105240_10197872 3300009093 Bacteria 2357
79 Ga0105245_10096175 3300009098 Bacteria 2732
80 Ga0105247_10001747 3300009101 Bacteria 15305
81 Ga0105247_10003869 3300009101 Bacteria 9690
82 Ga0105247_10183530 3300009101 Bacteria 1397
83 Ga0114129_10579126 3300009147 Bacteria 1457
84 Ga0105243_10176934 3300009148 Bacteria 1852
85 Ga0105241_10016127 3300009174 Bacteria 5477
86 Ga0105241_10098011 3300009174 Bacteria 2325
87 Ga0105248_10036533 3300009177 Bacteria 5495
88 Ga0105248_10531312 3300009177 Bacteria 1326
89 Ga0105237_10032205 3300009545 Bacteria 5309
90 Ga0105237_10366207 3300009545 Bacteria 1446
91 Ga0105238_10083103 3300009551 Bacteria 3192
92 Ga0105239_10015801 3300010375 Bacteria 8355
93 Ga0105239_10043590 3300010375 Bacteria 4919
94 Ga0105239_10192551 3300010375 Bacteria 2283
95 Ga0105239_10379215 3300010375 Bacteria 1599
96 Ga0105246_10000193 3300011119 Bacteria 30407
97 Ga0105246_10153750 3300011119 Bacteria 1745
98 Ga0157373_10086812 3300013100 Bacteria 2204
99 Ga0157371_10052533 3300013102 Bacteria 2894
100 Ga0157370_10065663 3300013104 Bacteria 3433
101 Ga0157370_10072001 3300013104 Bacteria 3261
102 Ga0157369_10093917 3300013105 Bacteria 3202
103 Ga0157369_10205116 3300013105 Bacteria 2068
104 Ga0157374_10039291 3300013296 Bacteria 4355
105 Ga0157374_10134250 3300013296 Bacteria 2398
106 Ga0157378_10126730 3300013297 Bacteria 2359
107 Ga0163162_10317333 3300013306 Bacteria 1691
108 Ga0157372_10000131 3300013307 Bacteria 82235
109 Ga0157372_10081643 3300013307 Bacteria 3659
110 Ga0157375_10011569 3300013308 Bacteria 7794
111 Ga0163163_10197447 3300014325 Bacteria 2060
112 Ga0157377_10004038 3300014745 Bacteria 6697
113 Ga0157379_10098997 3300014968 Bacteria 2617
114 Ga0157379_10306258 3300014968 Bacteria 1449
115 Ga0157376_10144634 3300014969 Bacteria 2137
116 Ga0163161_10024581 3300017792 Bacteria 4257
117 Ga0197907_10522062 3300020069 Bacteria 1989
118 Ga0206356_11036052 3300020070 Bacteria 3253
119 Ga0206353_10170135 3300020082 Bacteria 3515
120 Ga0206353_10625394 3300020082 Bacteria 2603
121 Ga0206353_11545269 3300020082 Bacteria 3376
122 Ga0224712_10010701 3300022467 Bacteria 2816
123 Ga0207656_10011866 3300025321 Bacteria 3301
124 Ga0207653_10023048 3300025885 Bacteria 1981
125 Ga0207688_10033669 3300025901 Bacteria 2835
126 Ga0207680_10070749 3300025903 Bacteria 2160
127 Ga0207645_10013415 3300025907 Bacteria 5522
128 Ga0207643_10000326 3300025908 Bacteria 32686
129 Ga0207705_10014532 3300025909 Bacteria 5664
130 Ga0207654_10031873 3300025911 Bacteria 2907
131 Ga0207654_10034378 3300025911 Bacteria 2816
132 Ga0207654_10046885 3300025911 Bacteria 2466
133 Ga0207695_10071882 3300025913 Bacteria 3532
134 Ga0207695_10126221 3300025913 Bacteria 2520
135 Ga0207693_10014795 3300025915 Bacteria 6269
136 Ga0207663_10001527 3300025916 Bacteria 10827
137 Ga0207660_10011144 3300025917 Bacteria 5845
138 Ga0207657_10015501 3300025919 Bacteria 7382
139 Ga0207649_10004261 3300025920 Bacteria 7792
140 Ga0207652_10013294 3300025921 Bacteria 6666
141 Ga0207694_10103475 3300025924 Bacteria 2258
142 Ga0207650_10002452 3300025925 Bacteria 12912
143 Ga0207659_10012186 3300025926 Bacteria 5457
144 Ga0207687_10007290 3300025927 Bacteria 7296
145 Ga0207687_10014447 3300025927 Bacteria 5166
146 Ga0207687_10055176 3300025927 Bacteria 2783
147 Ga0207687_10060037 3300025927 Bacteria 2680
148 Ga0207664_10062587 3300025929 Bacteria 2972
149 Ga0207644_10007119 3300025931 Bacteria 7292
150 Ga0207644_10058466 3300025931 Bacteria 2787
151 Ga0207644_10248027 3300025931 Bacteria 1420
152 Ga0207690_10009853 3300025932 Bacteria 5674
153 Ga0207665_10003055 3300025939 Bacteria 11228
154 Ga0207691_10012870 3300025940 Bacteria 8008
155 Ga0207691_10077702 3300025940 Bacteria 2989
156 Ga0207711_10036477 3300025941 Bacteria 4172
157 Ga0207689_10000818 3300025942 Bacteria 29960
158 Ga0207661_10022362 3300025944 Bacteria 4760
159 Ga0207667_10042028 3300025949 Bacteria 4862
160 Ga0207667_10072320 3300025949 Bacteria 3585
161 Ga0207667_10151312 3300025949 Bacteria 2388
162 Ga0207651_10072553 3300025960 Bacteria 2444
163 Ga0207640_10131279 3300025981 Bacteria 1811
164 Ga0207658_10007653 3300025986 Bacteria 7355
165 Ga0207658_10024654 3300025986 Bacteria 4210
166 Ga0207677_10009344 3300026023 Bacteria 5516
167 Ga0207678_10000468 3300026067 Bacteria 36559
168 Ga0207678_10003353 3300026067 Bacteria 14451
169 Ga0207708_10007451 3300026075 Bacteria 8088
170 Ga0207708_10022689 3300026075 Bacteria 4739
171 Ga0207702_10000541 3300026078 Bacteria 42221
172 Ga0207702_10007678 3300026078 Bacteria 9169
173 Ga0207702_10104594 3300026078 Bacteria 2506
174 Ga0207702_10225902 3300026078 Bacteria 1747
175 Ga0207641_10002103 3300026088 Bacteria 18819
176 Ga0207641_10006762 3300026088 Bacteria 9608
177 Ga0207676_10127259 3300026095 Bacteria 2159
178 Ga0207674_10001847 3300026116 Bacteria 26995
179 Ga0207675_100005244 3300026118 Bacteria 12473
180 Ga0207683_10000634 3300026121 Bacteria 32125
181 Ga0207683_10007116 3300026121 Bacteria 9589
182 Ga0207698_10039588 3300026142 Bacteria 3494
183 Ga0207428_10010152 3300027907 Bacteria 8421
184 Ga0268264_10000315 3300028381 Bacteria 77227
185 Ga0268264_10018110 3300028381 Bacteria 5761
186 Ga0373938_0006061 3300034957 Bacteria 2076
187 Ga0373931_0092457 3300035691 Bacteria 1687
188 Ga0373927_0055903 3300035695 Bacteria 2551
189 Ga0373925_0016948 3300037068 Bacteria 5273
190 Ga0395900_0266212 3300037418 Bacteria 1710
191 Ga0395901_0201142 3300038443 Bacteria 2088
192 Ga0466966_0003942 3300044684 Bacteria 9803
193 Ga0466966_0027998 3300044684 Bacteria 3672
194 Ga0466961_0006450 3300044693 Bacteria 7450
195 Ga0466961_0024385 3300044693 Bacteria 3892
196 Ga0466961_0101569 3300044693 Bacteria 1811
197 Ga0466961_0105248 3300044693 Bacteria 1776
198 Ga0466961_0136460 3300044693 Bacteria 1537
199 Ga0466963_0030587 3300044694 Bacteria 3476
200 Ga0466963_0206385 3300044694 Bacteria 1374
201 Ga0466963_0221705 3300044694 Bacteria 1324
202 Ga0466963_0225647 3300044694 Bacteria 1312
203 Ga0466963_0244055 3300044694 Bacteria 1260
204 Ga0466964_0001054 3300044706 Bacteria 9206
205 Ga0466964_0024558 3300044706 Bacteria 2349
206 Ga0466971_0004346 3300044719 Bacteria 6110
207 Ga0466970_0032360 3300044765 Bacteria 2763
208 Ga0466970_0041837 3300044765 Bacteria 2436
209 Ga0466957_0014554 3300044842 Bacteria 4582
210 Ga0466957_0174824 3300044842 Bacteria 1400
211 Ga0466960_0022297 3300044901 Bacteria 2830
212 Ga0466959_0017352 3300045049 Bacteria 5276
213 Ga0466959_0034414 3300045049 Bacteria 3747
214 Ga0466959_0077376 3300045049 Bacteria 2401
215 Ga0466959_0096681 3300045049 Bacteria 2117
216 Ga0466958_0003375 3300045836 Bacteria 8279
217 Ga0466958_0004190 3300045836 Bacteria 7580
218 Ga0466958_0023214 3300045836 Bacteria 3638
219 Ga0466958_0029728 3300045836 Bacteria 3242
220 Ga0466967_0000302 3300045976 Bacteria 22184
221 Ga0466967_0010313 3300045976 Bacteria 6998
222 Ga0466967_0020756 3300045976 Bacteria 5319
223 Ga0466967_0024102 3300045976 Bacteria 4998
224 Ga0466967_0078012 3300045976 Bacteria 2983
225 Ga0466967_0198548 3300045976 Bacteria 1899
226 Ga0466967_0324890 3300045976 Bacteria 1484
227 Ga0466967_0337704 3300045976 Bacteria 1456
228 Ga0496100_0035028 3300048903 Bacteria 3155
229 Ga0496101_0008859 3300048904 Bacteria 6587
230 Ga0496101_0022875 3300048904 Bacteria 4309
231 Ga0496102_0000013 3300048905 Bacteria 311668
232 Ga0496102_0000813 3300048905 Bacteria 30380
233 Ga0496102_0024323 3300048905 Bacteria 5384
234 Ga0496102_0046783 3300048905 Bacteria 3930
235 Ga0496102_0051674 3300048905 Bacteria 3744
236 Ga0496103_0000231 3300048906 Bacteria 54600
237 Ga0496104_0003341 3300048907 Bacteria 13849
238 Ga0496104_0012856 3300048907 Bacteria 7539
239 Ga0496105_0004853 3300048908 Bacteria 10155
240 Ga0496105_0011098 3300048908 Bacteria 7104
241 Ga0496105_0182889 3300048908 Bacteria 1716
242 Ga0496106_0027695 3300048909 Bacteria 4221
243 Ga0496106_0032034 3300048909 Bacteria 3919
244 Ga0496107_0005833 3300048910 Bacteria 8432
245 Ga0496108_0007000 3300048911 Bacteria 9132
246 Ga0496108_0012211 3300048911 Bacteria 6987
247 Ga0496108_0038094 3300048911 Bacteria 4005
248 Ga0496108_0112133 3300048911 Bacteria 2333
249 Ga0496109_0010921 3300048912 Bacteria 7780
250 Ga0496109_0015882 3300048912 Bacteria 6573
251 Ga0496109_0028903 3300048912 Bacteria 4963
252 Ga0496109_0039561 3300048912 Bacteria 4268
253 Ga0496110_0026928 3300048913 Bacteria 4924
254 Ga0496110_0048014 3300048913 Bacteria 3740
255 Ga0496110_0471106 3300048913 Bacteria 1144
256 Ga0496111_0002336 3300048914 Bacteria 11430
257 Ga0496111_0153337 3300048914 Bacteria 1709
258 Ga0496113_0008778 3300048916 Bacteria 6602
259 Ga0496113_0036098 3300048916 Bacteria 3620
260 Ga0496114_0113598 3300048917 Bacteria 2322
261 Ga0496115_0012951 3300048918 Bacteria 6290
262 Ga0496119_0000022 3300048922 Bacteria 269878
263 Ga0496120_0001552 3300048923 Bacteria 26878
264 Ga0496120_0110264 3300048923 Bacteria 1439
265 Ga0496126_0000003 3300048929 Bacteria 961576
266 Ga0496126_0033125 3300048929 Bacteria 4863
267 Ga0501031_0027192 3300049568 Bacteria 3730
268 Ga0501032_0035227 3300049569 Bacteria 3423
269 Ga0501033_0090607 3300049570 Bacteria 2237
270 Ga0501033_0111869 3300049570 Bacteria 1987
271 Ga0501038_0004045 3300049574 Bacteria 13628
272 Ga0501043_0008555 3300049579 Bacteria 8066
273 Ga0501048_0004212 3300049582 Bacteria 10963
274 Ga0501070_0021783 3300049586 Bacteria 5370
275 Ga0501081_0042899 3300049743 Bacteria 3101
276 Ga0501035_0009171 3300049822 Bacteria 9200
277 Ga0501035_0240511 3300049822 Bacteria 1540
278 Ga0501044_0071112 3300049823 Bacteria 3538
279 Ga0501044_0129357 3300049823 Bacteria 2520
280 nmdc:mga05p37_60595_c1 3300050507 Bacteria 4659
281 nmdc:mga05p37_653681_c1 3300050507 Bacteria 1177
282 nmdc:mga08y16_1855_c1 3300050511 Bacteria 21462
283 nmdc:mga0n895_19087_c1 3300050512 Bacteria 6365
284 nmdc:mga0rr50_719_c1 3300050513 Bacteria 17839
285 nmdc:mga0a205_4394_c2 3300050515 Bacteria 10262
286 nmdc:mga0a205_44535_c1 3300050515 Bacteria 4278
287 Ga0466962_0010492 3300061719 Bacteria 4455
288 Ga0466962_0023946 3300061719 Bacteria 2934
289 Ga0466962_0025377 3300061719 Bacteria 2845
290 Ga0466962_0027288 3300061719 Bacteria 2741

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0136460 Ga0466961_0136460_547_1509 316
2 3300009147 Ga0114129_10579126 Ga0114129_105791262 325
3 3300050507 nmdc:mga05p37_653681_c1 nmdc:mga05p37_653681_c1_68_1090 325
4 3300005983 Ga0081540_1049444 Ga0081540_10494442 326
5 3300026067 Ga0207678_10003353 Ga0207678_100033538 326
6 3300037418 Ga0395900_0266212 Ga0395900_0266212_592_1635 328
7 3300038443 Ga0395901_0201142 Ga0395901_0201142_736_1779 328
8 3300045976 Ga0466967_0324890 Ga0466967_0324890_12_1076 329
9 3300009098 Ga0105245_10096175 Ga0105245_100961752 331
10 3300025927 Ga0207687_10055176 Ga0207687_100551764 331
11 3300013105 Ga0157369_10205116 Ga0157369_102051162 332
12 3300005563 Ga0068855_100173901 Ga0068855_1001739013 333
13 3300020082 Ga0206353_11545269 Ga0206353_115452692 333
14 3300009093 Ga0105240_10177882 Ga0105240_101778822 335
15 3300025913 Ga0207695_10126221 Ga0207695_101262212 335
16 3300048908 Ga0496105_0182889 Ga0496105_0182889_489_1574 336
17 3300048911 Ga0496108_0112133 Ga0496108_0112133_685_1770 336
18 3300048912 Ga0496109_0028903 Ga0496109_0028903_1406_2491 336
19 3300048917 Ga0496114_0113598 Ga0496114_0113598_282_1367 336
20 3300048916 Ga0496113_0036098 Ga0496113_0036098_1407_2492 337
21 3300005436 Ga0070713_100001156 Ga0070713_1000011563 338
22 3300005614 Ga0068856_100016265 Ga0068856_1000162652 338
23 3300006175 Ga0070712_100075133 Ga0070712_1000751333 338
24 3300026078 Ga0207702_10007678 Ga0207702_100076782 338
25 3300049823 Ga0501044_0129357 Ga0501044_0129357_1074_2144 338
26 3300045836 Ga0466958_0004190 Ga0466958_0004190_2855_3922 339
27 3300061719 Ga0466962_0023946 Ga0466962_0023946_1514_2581 339
28 3300005937 Ga0081455_10046416 Ga0081455_100464163 340
29 3300037068 Ga0373925_0016948 Ga0373925_0016948_3718_4773 340
30 3300048913 Ga0496110_0471106 Ga0496110_0471106_79_1101 340
31 3300005563 Ga0068855_100231169 Ga0068855_1002311692 341
32 3300025949 Ga0207667_10042028 Ga0207667_100420282 341
33 3300044706 Ga0466964_0001054 Ga0466964_0001054_4734_5804 341
34 3300045836 Ga0466958_0023214 Ga0466958_0023214_743_1813 341
35 3300061719 Ga0466962_0025377 Ga0466962_0025377_711_1781 341
36 3300044719 Ga0466971_0004346 Ga0466971_0004346_3211_4272 342
37 3300061719 Ga0466962_0010492 Ga0466962_0010492_1941_3002 342
38 3300002459 JGI24751J29686_10002316 JGI24751J29686_100023163 343
39 3300005327 Ga0070658_10117781 Ga0070658_101177811 343
40 3300005331 Ga0070670_100015180 Ga0070670_1000151803 343
41 3300005334 Ga0068869_100000606 Ga0068869_1000006062 343
42 3300005336 Ga0070680_100033113 Ga0070680_1000331133 343
43 3300005338 Ga0068868_100034498 Ga0068868_1000344984 343
44 3300005339 Ga0070660_100044841 Ga0070660_1000448413 343
45 3300005340 Ga0070689_100018052 Ga0070689_1000180526 343
46 3300005344 Ga0070661_100189230 Ga0070661_1001892302 343
47 3300005345 Ga0070692_10012696 Ga0070692_100126963 343
48 3300005355 Ga0070671_100007992 Ga0070671_1000079924 343
49 3300005364 Ga0070673_100007062 Ga0070673_1000070626 343
50 3300005455 Ga0070663_100005595 Ga0070663_1000055953 343
51 3300005456 Ga0070678_100006122 Ga0070678_1000061227 343
52 3300005466 Ga0070685_10021370 Ga0070685_100213704 343
53 3300005530 Ga0070679_100012776 Ga0070679_1000127766 343
54 3300005543 Ga0070672_100163905 Ga0070672_1001639052 343
55 3300005544 Ga0070686_100123004 Ga0070686_1001230043 343
56 3300005547 Ga0070693_100000246 Ga0070693_1000002462 343
57 3300005578 Ga0068854_100132367 Ga0068854_1001323672 343
58 3300005615 Ga0070702_100000087 Ga0070702_1000000873 343
59 3300005617 Ga0068859_100092319 Ga0068859_1000923193 343
60 3300005840 Ga0068870_10000054 Ga0068870_1000005412 343
61 3300005841 Ga0068863_100001108 Ga0068863_10000110825 343
62 3300005842 Ga0068858_100007344 Ga0068858_10000734410 343
63 3300006173 Ga0070716_100009957 Ga0070716_1000099575 343
64 3300006237 Ga0097621_100009324 Ga0097621_1000093244 343
65 3300006847 Ga0075431_100316440 Ga0075431_1003164402 343
66 3300006852 Ga0075433_10020089 Ga0075433_100200893 343
67 3300006871 Ga0075434_100018305 Ga0075434_1000183056 343
68 3300006880 Ga0075429_100043114 Ga0075429_1000431144 343
69 3300006914 Ga0075436_100004385 Ga0075436_1000043859 343
70 3300006931 Ga0097620_100092321 Ga0097620_1000923212 343
71 3300007076 Ga0075435_100000557 Ga0075435_10000055712 343
72 3300009011 Ga0105251_10030668 Ga0105251_100306682 343
73 3300009093 Ga0105240_10197872 Ga0105240_101978723 343
74 3300009101 Ga0105247_10003869 Ga0105247_100038693 343
75 3300009174 Ga0105241_10016127 Ga0105241_100161272 343
76 3300009177 Ga0105248_10036533 Ga0105248_100365332 343
77 3300009551 Ga0105238_10083103 Ga0105238_100831034 343
78 3300010375 Ga0105239_10043590 Ga0105239_100435902 343
79 3300011119 Ga0105246_10000193 Ga0105246_100001936 343
80 3300013100 Ga0157373_10086812 Ga0157373_100868123 343
81 3300013102 Ga0157371_10052533 Ga0157371_100525332 343
82 3300013104 Ga0157370_10072001 Ga0157370_100720013 343
83 3300013296 Ga0157374_10134250 Ga0157374_101342502 343
84 3300013307 Ga0157372_10081643 Ga0157372_100816433 343
85 3300013308 Ga0157375_10011569 Ga0157375_100115693 343
86 3300014745 Ga0157377_10004038 Ga0157377_100040382 343
87 3300014968 Ga0157379_10098997 Ga0157379_100989972 343
88 3300014969 Ga0157376_10144634 Ga0157376_101446342 343
89 3300020069 Ga0197907_10522062 Ga0197907_105220623 343
90 3300020070 Ga0206356_11036052 Ga0206356_110360522 343
91 3300020082 Ga0206353_10625394 Ga0206353_106253942 343
92 3300022467 Ga0224712_10010701 Ga0224712_100107013 343
93 3300025321 Ga0207656_10011866 Ga0207656_100118662 343
94 3300025907 Ga0207645_10013415 Ga0207645_100134154 343
95 3300025908 Ga0207643_10000326 Ga0207643_1000032628 343
96 3300025909 Ga0207705_10014532 Ga0207705_100145324 343
97 3300025911 Ga0207654_10034378 Ga0207654_100343782 343
98 3300025913 Ga0207695_10071882 Ga0207695_100718823 343
99 3300025915 Ga0207693_10014795 Ga0207693_100147953 343
100 3300025917 Ga0207660_10011144 Ga0207660_100111444 343
101 3300025920 Ga0207649_10004261 Ga0207649_100042613 343
102 3300025921 Ga0207652_10013294 Ga0207652_100132943 343
103 3300025925 Ga0207650_10002452 Ga0207650_100024526 343
104 3300025926 Ga0207659_10012186 Ga0207659_100121864 343
105 3300025927 Ga0207687_10007290 Ga0207687_100072904 343
106 3300025931 Ga0207644_10007119 Ga0207644_100071196 343
107 3300025932 Ga0207690_10009853 Ga0207690_100098533 343
108 3300025939 Ga0207665_10003055 Ga0207665_1000305510 343
109 3300025940 Ga0207691_10012870 Ga0207691_100128703 343
110 3300025941 Ga0207711_10036477 Ga0207711_100364773 343
111 3300025942 Ga0207689_10000818 Ga0207689_1000081818 343
112 3300025944 Ga0207661_10022362 Ga0207661_100223623 343
113 3300025949 Ga0207667_10151312 Ga0207667_101513122 343
114 3300025960 Ga0207651_10072553 Ga0207651_100725533 343
115 3300025981 Ga0207640_10131279 Ga0207640_101312792 343
116 3300026023 Ga0207677_10009344 Ga0207677_100093443 343
117 3300026067 Ga0207678_10000468 Ga0207678_1000046812 343
118 3300026075 Ga0207708_10007451 Ga0207708_100074516 343
119 3300026078 Ga0207702_10000541 Ga0207702_1000054112 343
120 3300026088 Ga0207641_10006762 Ga0207641_100067622 343
121 3300026116 Ga0207674_10001847 Ga0207674_1000184726 343
122 3300026121 Ga0207683_10000634 Ga0207683_100006342 343
123 3300027907 Ga0207428_10010152 Ga0207428_100101524 343
124 3300028381 Ga0268264_10018110 Ga0268264_100181102 343
125 3300048905 Ga0496102_0051674 Ga0496102_0051674_2619_3656 343
126 3300048907 Ga0496104_0003341 Ga0496104_0003341_2615_3652 343
127 3300048908 Ga0496105_0011098 Ga0496105_0011098_1419_2456 343
128 3300048909 Ga0496106_0032034 Ga0496106_0032034_1874_2911 343
129 3300048911 Ga0496108_0012211 Ga0496108_0012211_363_1400 343
130 3300048912 Ga0496109_0039561 Ga0496109_0039561_2132_3169 343
131 3300048913 Ga0496110_0026928 Ga0496110_0026928_2918_3955 343
132 3300048914 Ga0496111_0002336 Ga0496111_0002336_3852_4889 343
133 3300050507 nmdc:mga05p37_60595_c1 nmdc:mga05p37_60595_c1_3422_4459 343
134 3300050511 nmdc:mga08y16_1855_c1 nmdc:mga08y16_1855_c1_876_1913 343
135 3300050512 nmdc:mga0n895_19087_c1 nmdc:mga0n895_19087_c1_2590_3627 343
136 3300050513 nmdc:mga0rr50_719_c1 nmdc:mga0rr50_719_c1_5141_6178 343
137 3300050515 nmdc:mga0a205_4394_c2 nmdc:mga0a205_4394_c2_4742_5779 343
138 3300044684 Ga0466966_0027998 Ga0466966_0027998_496_1551 344
139 3300005981 Ga0081538_10000139 Ga0081538_1000013926 346
140 3300044694 Ga0466963_0221705 Ga0466963_0221705_27_1088 347
141 3300044842 Ga0466957_0014554 Ga0466957_0014554_2792_3853 347
142 3300045836 Ga0466958_0029728 Ga0466958_0029728_812_1873 347
143 3300045976 Ga0466967_0198548 Ga0466967_0198548_813_1886 347
144 3300045976 Ga0466967_0337704 Ga0466967_0337704_58_1152 347
145 3300048905 Ga0496102_0024323 Ga0496102_0024323_3679_4725 347
146 3300048929 Ga0496126_0000003 Ga0496126_0000003_383812_384867 347
147 3300061719 Ga0466962_0027288 Ga0466962_0027288_1660_2721 347
148 3300005339 Ga0070660_100008478 Ga0070660_1000084787 348
149 3300005345 Ga0070692_10050611 Ga0070692_100506112 348
150 3300005347 Ga0070668_100017940 Ga0070668_1000179406 348
151 3300005355 Ga0070671_100102824 Ga0070671_1001028242 348
152 3300005364 Ga0070673_100026247 Ga0070673_1000262472 348
153 3300005406 Ga0070703_10010790 Ga0070703_100107901 348
154 3300005436 Ga0070713_100015431 Ga0070713_1000154316 348
155 3300005439 Ga0070711_100013864 Ga0070711_1000138646 348
156 3300005456 Ga0070678_100081657 Ga0070678_1000816572 348
157 3300005539 Ga0068853_100005838 Ga0068853_1000058383 348
158 3300005544 Ga0070686_100037792 Ga0070686_1000377923 348
159 3300005545 Ga0070695_100015782 Ga0070695_1000157822 348
160 3300005546 Ga0070696_100027194 Ga0070696_1000271946 348
161 3300005547 Ga0070693_100040727 Ga0070693_1000407272 348
162 3300005563 Ga0068855_100012420 Ga0068855_1000124209 348
163 3300005618 Ga0068864_100029155 Ga0068864_1000291555 348
164 3300005719 Ga0068861_100006590 Ga0068861_1000065906 348
165 3300005842 Ga0068858_100467290 Ga0068858_1004672901 348
166 3300006237 Ga0097621_100078152 Ga0097621_1000781525 348
167 3300006358 Ga0068871_100092241 Ga0068871_1000922415 348
168 3300006852 Ga0075433_10012177 Ga0075433_100121775 348
169 3300009011 Ga0105251_10132044 Ga0105251_101320441 348
170 3300009093 Ga0105240_10168886 Ga0105240_101688862 348
171 3300009101 Ga0105247_10183530 Ga0105247_101835302 348
172 3300009148 Ga0105243_10176934 Ga0105243_101769342 348
173 3300009174 Ga0105241_10098011 Ga0105241_100980112 348
174 3300009177 Ga0105248_10531312 Ga0105248_105313122 348
175 3300009545 Ga0105237_10032205 Ga0105237_100322056 348
176 3300009545 Ga0105237_10366207 Ga0105237_103662072 348
177 3300010375 Ga0105239_10192551 Ga0105239_101925512 348
178 3300011119 Ga0105246_10153750 Ga0105246_101537501 348
179 3300013104 Ga0157370_10065663 Ga0157370_100656634 348
180 3300013296 Ga0157374_10039291 Ga0157374_100392913 348
181 3300013297 Ga0157378_10126730 Ga0157378_101267302 348
182 3300013306 Ga0163162_10317333 Ga0163162_103173332 348
183 3300014325 Ga0163163_10197447 Ga0163163_101974472 348
184 3300014968 Ga0157379_10306258 Ga0157379_103062582 348
185 3300017792 Ga0163161_10024581 Ga0163161_100245815 348
186 3300025885 Ga0207653_10023048 Ga0207653_100230482 348
187 3300025901 Ga0207688_10033669 Ga0207688_100336694 348
188 3300025903 Ga0207680_10070749 Ga0207680_100707491 348
189 3300025911 Ga0207654_10046885 Ga0207654_100468852 348
190 3300025916 Ga0207663_10001527 Ga0207663_100015278 348
191 3300025919 Ga0207657_10015501 Ga0207657_100155016 348
192 3300025927 Ga0207687_10014447 Ga0207687_100144472 348
193 3300025929 Ga0207664_10062587 Ga0207664_100625872 348
194 3300025931 Ga0207644_10248027 Ga0207644_102480272 348
195 3300025940 Ga0207691_10077702 Ga0207691_100777021 348
196 3300025949 Ga0207667_10072320 Ga0207667_100723203 348
197 3300026075 Ga0207708_10022689 Ga0207708_100226893 348
198 3300026078 Ga0207702_10104594 Ga0207702_101045941 348
199 3300026095 Ga0207676_10127259 Ga0207676_101272593 348
200 3300026118 Ga0207675_100005244 Ga0207675_1000052442 348
201 3300026121 Ga0207683_10007116 Ga0207683_100071168 348
202 3300034957 Ga0373938_0006061 Ga0373938_0006061_640_1701 348
203 3300035691 Ga0373931_0092457 Ga0373931_0092457_242_1303 348
204 3300044693 Ga0466961_0101569 Ga0466961_0101569_172_1230 348
205 3300044694 Ga0466963_0030587 Ga0466963_0030587_2050_3108 348
206 3300044694 Ga0466963_0206385 Ga0466963_0206385_284_1354 348
207 3300044694 Ga0466963_0244055 Ga0466963_0244055_61_1119 348
208 3300048903 Ga0496100_0035028 Ga0496100_0035028_1771_2832 348
209 3300048904 Ga0496101_0022875 Ga0496101_0022875_1458_2519 348
210 3300048905 Ga0496102_0046783 Ga0496102_0046783_1282_2343 348
211 3300048907 Ga0496104_0012856 Ga0496104_0012856_1603_2664 348
212 3300048908 Ga0496105_0004853 Ga0496105_0004853_3962_5023 348
213 3300048909 Ga0496106_0027695 Ga0496106_0027695_1387_2448 348
214 3300048910 Ga0496107_0005833 Ga0496107_0005833_5469_6530 348
215 3300048911 Ga0496108_0038094 Ga0496108_0038094_2871_3932 348
216 3300048912 Ga0496109_0015882 Ga0496109_0015882_5240_6301 348
217 3300048913 Ga0496110_0048014 Ga0496110_0048014_249_1310 348
218 3300048914 Ga0496111_0153337 Ga0496111_0153337_195_1256 348
219 3300048916 Ga0496113_0008778 Ga0496113_0008778_2777_3838 348
220 3300048918 Ga0496115_0012951 Ga0496115_0012951_150_1211 348
221 3300050515 nmdc:mga0a205_44535_c1 nmdc:mga0a205_44535_c1_2970_4031 348
222 3300005355 Ga0070671_100016400 Ga0070671_1000164002 349
223 3300005367 Ga0070667_100001770 Ga0070667_1000017709 349
224 3300005367 Ga0070667_100035109 Ga0070667_1000351093 349
225 3300005548 Ga0070665_100003390 Ga0070665_1000033903 349
226 3300005616 Ga0068852_100289423 Ga0068852_1002894232 349
227 3300005841 Ga0068863_100001135 Ga0068863_1000011359 349
228 3300005843 Ga0068860_100000261 Ga0068860_10000026160 349
229 3300009101 Ga0105247_10001747 Ga0105247_1000174717 349
230 3300010375 Ga0105239_10379215 Ga0105239_103792152 349
231 3300013105 Ga0157369_10093917 Ga0157369_100939172 349
232 3300020082 Ga0206353_10170135 Ga0206353_101701354 349
233 3300025911 Ga0207654_10031873 Ga0207654_100318732 349
234 3300025927 Ga0207687_10060037 Ga0207687_100600372 349
235 3300025931 Ga0207644_10058466 Ga0207644_100584661 349
236 3300025986 Ga0207658_10007653 Ga0207658_100076535 349
237 3300025986 Ga0207658_10024654 Ga0207658_100246543 349
238 3300026088 Ga0207641_10002103 Ga0207641_100021035 349
239 3300026142 Ga0207698_10039588 Ga0207698_100395882 349
240 3300028381 Ga0268264_10000315 Ga0268264_1000031561 349
241 3300035695 Ga0373927_0055903 Ga0373927_0055903_357_1427 349
242 3300044684 Ga0466966_0003942 Ga0466966_0003942_3824_4897 349
243 3300044693 Ga0466961_0006450 Ga0466961_0006450_5778_6851 349
244 3300044693 Ga0466961_0024385 Ga0466961_0024385_349_1410 349
245 3300044693 Ga0466961_0105248 Ga0466961_0105248_34_1098 349
246 3300044706 Ga0466964_0024558 Ga0466964_0024558_1094_2155 349
247 3300044765 Ga0466970_0032360 Ga0466970_0032360_881_1951 349
248 3300044765 Ga0466970_0041837 Ga0466970_0041837_260_1333 349
249 3300044842 Ga0466957_0174824 Ga0466957_0174824_116_1189 349
250 3300044901 Ga0466960_0022297 Ga0466960_0022297_1734_2801 349
251 3300045049 Ga0466959_0017352 Ga0466959_0017352_558_1631 349
252 3300045049 Ga0466959_0077376 Ga0466959_0077376_973_2046 349
253 3300045049 Ga0466959_0096681 Ga0466959_0096681_885_1955 349
254 3300045836 Ga0466958_0003375 Ga0466958_0003375_151_1212 349
255 3300045976 Ga0466967_0000302 Ga0466967_0000302_9629_10699 349
256 3300045976 Ga0466967_0010313 Ga0466967_0010313_5492_6628 349
257 3300045976 Ga0466967_0020756 Ga0466967_0020756_359_1426 349
258 3300045976 Ga0466967_0024102 Ga0466967_0024102_2867_3925 349
259 3300045976 Ga0466967_0078012 Ga0466967_0078012_234_1304 349
260 3300048904 Ga0496101_0008859 Ga0496101_0008859_3990_5051 349
261 3300048905 Ga0496102_0000013 Ga0496102_0000013_121261_122322 349
262 3300048905 Ga0496102_0000813 Ga0496102_0000813_4766_5827 349
263 3300048906 Ga0496103_0000231 Ga0496103_0000231_36363_37424 349
264 3300048911 Ga0496108_0007000 Ga0496108_0007000_6952_8088 349
265 3300048912 Ga0496109_0010921 Ga0496109_0010921_5158_6294 349
266 3300048922 Ga0496119_0000022 Ga0496119_0000022_145442_146509 349
267 3300048923 Ga0496120_0001552 Ga0496120_0001552_15254_16321 349
268 3300048923 Ga0496120_0110264 Ga0496120_0110264_252_1313 349
269 3300049568 Ga0501031_0027192 Ga0501031_0027192_800_1861 349
270 3300049569 Ga0501032_0035227 Ga0501032_0035227_578_1639 349
271 3300049570 Ga0501033_0090607 Ga0501033_0090607_310_1371 349
272 3300049574 Ga0501038_0004045 Ga0501038_0004045_8459_9520 349
273 3300049579 Ga0501043_0008555 Ga0501043_0008555_6094_7155 349
274 3300049582 Ga0501048_0004212 Ga0501048_0004212_4540_5601 349
275 3300049586 Ga0501070_0021783 Ga0501070_0021783_3558_4619 349
276 3300049822 Ga0501035_0009171 Ga0501035_0009171_7863_8924 349
277 3300049822 Ga0501035_0240511 Ga0501035_0240511_356_1417 349
278 3300049823 Ga0501044_0071112 Ga0501044_0071112_838_1899 349
279 3300002067 JGI24735J21928_10002828 JGI24735J21928_100028282 351
280 3300005435 Ga0070714_100000126 Ga0070714_10000012620 351
281 3300005614 Ga0068856_100279464 Ga0068856_1002794642 351
282 3300010375 Ga0105239_10015801 Ga0105239_100158014 351
283 3300013307 Ga0157372_10000131 Ga0157372_1000013127 351
284 3300025924 Ga0207694_10103475 Ga0207694_101034752 351
285 3300026078 Ga0207702_10225902 Ga0207702_102259022 351
286 3300044694 Ga0466963_0225647 Ga0466963_0225647_199_1284 351
287 3300045049 Ga0466959_0034414 Ga0466959_0034414_1943_3049 351
288 3300048929 Ga0496126_0033125 Ga0496126_0033125_1544_2614 351
289 3300049570 Ga0501033_0111869 Ga0501033_0111869_362_1480 351
290 3300049743 Ga0501081_0042899 Ga0501081_0042899_1295_2374 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

46

160

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

172

339

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cli-assembly2.cif.gz_C x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution 0.9688 11 344
2z01-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus 0.9626 19 344
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.958 15 343
2btu-assembly1.cif.gz_A crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. 0.958 15 343
3p4e-assembly1.cif.gz_A-2 phosphoribosylformylglycinamidine cyclo-ligase from vibrio cholerae 0.957 15 343
ID Description Score Start End Superfamily
af_I6Y4V6_182_356_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9705 170 339 3.90.650.10
af_P00967_819_956_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9597 30 168 3.30.1330.10
af_Q2FZI8_168_339_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9569 173 341 3.90.650.10
af_P07244_618_801_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9567 170 342 3.90.650.10
2z01A01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9491 19 168 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A1G3CZW9-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (AIRS) 0.986 59 197 GO:0004637
GO:0004641
GO:0005829
GO:0006189
GO:0046084
AF-A0A812IPZ7-F1-model_v4 deleted 0.9839 2 335
AF-A0A6M0ES26-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9826 84 341 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A382DN46-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) 0.9819 92 344 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A2X1KIL7-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (AIRS) 0.9819 51 162 GO:0004637
GO:0004641
GO:0005829
GO:0006189
GO:0046084

Feature Viewer

pLDDT pTM Quality
94.05 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map