F389923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 180 | 290 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0010313|Ga0466967_0010313_5492_6628 |
| Length | 378 |
| Sequence | MTSYRSAGVDIAAGDRAVELMKDSVKRTARPEVIGGLGGFAGLFSLDLVRYPQPVLASSTDGVGTKIAIARAADRHDTIGIDLVAMVVDDLVVVGAEPLFLTDYIATGKVLPERIAAIVSGISEGCVRAGCALVGGETAEHPGLMDPDEYDLSGTGVGVVNADSVLGPDRVGAGDVLIAIGSSGLHSNGYSLVRSVLFDQGGLALDATPDLLDGRALVDELLEPTRIYAKDCLALARDAGAHAFAHVTGGGLAGNLARVLPPGLVARVDRATWSPPAVFVLVARIGSVPQDQLELTFNLGVGMIAVVPRDRVDDALAVLASGQVPAWVAGDVAYPGSTAPVNLPNSAHTDQTPSQRTGHVEMASSYAGNPGFWGLDRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 131 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 162 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 163 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 164 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 165 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.93 |
| Metatranscriptomes | 2.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.72 |
| Rhizosphere | 86.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10002828 | 3300002067 | Bacteria | 5989 |
| 2 | JGI24751J29686_10002316 | 3300002459 | Bacteria | 3849 |
| 3 | Ga0070658_10117781 | 3300005327 | Bacteria | 2205 |
| 4 | Ga0070670_100015180 | 3300005331 | Bacteria | 6611 |
| 5 | Ga0068869_100000606 | 3300005334 | Bacteria | 20205 |
| 6 | Ga0070680_100033113 | 3300005336 | Bacteria | 4163 |
| 7 | Ga0068868_100034498 | 3300005338 | Bacteria | 3906 |
| 8 | Ga0070660_100008478 | 3300005339 | Bacteria | 7193 |
| 9 | Ga0070660_100044841 | 3300005339 | Bacteria | 3383 |
| 10 | Ga0070689_100018052 | 3300005340 | Bacteria | 5190 |
| 11 | Ga0070661_100189230 | 3300005344 | Bacteria | 1569 |
| 12 | Ga0070692_10012696 | 3300005345 | Bacteria | 3910 |
| 13 | Ga0070692_10050611 | 3300005345 | Bacteria | 2158 |
| 14 | Ga0070668_100017940 | 3300005347 | Bacteria | 5309 |
| 15 | Ga0070671_100007992 | 3300005355 | Bacteria | 8466 |
| 16 | Ga0070671_100016400 | 3300005355 | Bacteria | 5991 |
| 17 | Ga0070671_100102824 | 3300005355 | Bacteria | 2397 |
| 18 | Ga0070673_100007062 | 3300005364 | Bacteria | 7368 |
| 19 | Ga0070673_100026247 | 3300005364 | Bacteria | 4301 |
| 20 | Ga0070667_100001770 | 3300005367 | Bacteria | 19230 |
| 21 | Ga0070667_100035109 | 3300005367 | Bacteria | 4200 |
| 22 | Ga0070703_10010790 | 3300005406 | Bacteria | 2577 |
| 23 | Ga0070714_100000126 | 3300005435 | Bacteria | 60425 |
| 24 | Ga0070713_100001156 | 3300005436 | Bacteria | 16920 |
| 25 | Ga0070713_100015431 | 3300005436 | Bacteria | 5711 |
| 26 | Ga0070711_100013864 | 3300005439 | Bacteria | 5071 |
| 27 | Ga0070663_100005595 | 3300005455 | Bacteria | 7480 |
| 28 | Ga0070678_100006122 | 3300005456 | Bacteria | 7024 |
| 29 | Ga0070678_100081657 | 3300005456 | Bacteria | 2451 |
| 30 | Ga0070685_10021370 | 3300005466 | Bacteria | 3517 |
| 31 | Ga0070679_100012776 | 3300005530 | Bacteria | 8034 |
| 32 | Ga0068853_100005838 | 3300005539 | Bacteria | 9695 |
| 33 | Ga0070672_100163905 | 3300005543 | Bacteria | 1846 |
| 34 | Ga0070686_100037792 | 3300005544 | Bacteria | 2997 |
| 35 | Ga0070686_100123004 | 3300005544 | Bacteria | 1784 |
| 36 | Ga0070695_100015782 | 3300005545 | Bacteria | 4563 |
| 37 | Ga0070696_100027194 | 3300005546 | Bacteria | 3895 |
| 38 | Ga0070693_100000246 | 3300005547 | Bacteria | 25400 |
| 39 | Ga0070693_100040727 | 3300005547 | Bacteria | 2610 |
| 40 | Ga0070665_100003390 | 3300005548 | Bacteria | 17043 |
| 41 | Ga0068855_100012420 | 3300005563 | Bacteria | 10285 |
| 42 | Ga0068855_100173901 | 3300005563 | Bacteria | 2438 |
| 43 | Ga0068855_100231169 | 3300005563 | Bacteria | 2070 |
| 44 | Ga0068854_100132367 | 3300005578 | Bacteria | 1905 |
| 45 | Ga0068856_100016265 | 3300005614 | Bacteria | 7197 |
| 46 | Ga0068856_100279464 | 3300005614 | Bacteria | 1686 |
| 47 | Ga0070702_100000087 | 3300005615 | Bacteria | 27223 |
| 48 | Ga0068852_100289423 | 3300005616 | Bacteria | 1582 |
| 49 | Ga0068859_100092319 | 3300005617 | Bacteria | 3079 |
| 50 | Ga0068864_100029155 | 3300005618 | Bacteria | 4669 |
| 51 | Ga0068861_100006590 | 3300005719 | Bacteria | 7926 |
| 52 | Ga0068870_10000054 | 3300005840 | Bacteria | 36323 |
| 53 | Ga0068863_100001108 | 3300005841 | Bacteria | 26941 |
| 54 | Ga0068863_100001135 | 3300005841 | Bacteria | 26616 |
| 55 | Ga0068858_100007344 | 3300005842 | Bacteria | 10665 |
| 56 | Ga0068858_100467290 | 3300005842 | Bacteria | 1217 |
| 57 | Ga0068860_100000261 | 3300005843 | Bacteria | 77163 |
| 58 | Ga0081455_10046416 | 3300005937 | Bacteria | 3769 |
| 59 | Ga0081538_10000139 | 3300005981 | Bacteria | 75075 |
| 60 | Ga0081540_1049444 | 3300005983 | Bacteria | 2097 |
| 61 | Ga0070716_100009957 | 3300006173 | Bacteria | 4754 |
| 62 | Ga0070712_100075133 | 3300006175 | Bacteria | 2430 |
| 63 | Ga0097621_100009324 | 3300006237 | Bacteria | 7124 |
| 64 | Ga0097621_100078152 | 3300006237 | Bacteria | 2749 |
| 65 | Ga0068871_100092241 | 3300006358 | Bacteria | 2526 |
| 66 | Ga0075431_100316440 | 3300006847 | Bacteria | 1574 |
| 67 | Ga0075433_10012177 | 3300006852 | Bacteria | 6936 |
| 68 | Ga0075433_10020089 | 3300006852 | Bacteria | 5578 |
| 69 | Ga0075434_100018305 | 3300006871 | Bacteria | 6765 |
| 70 | Ga0075429_100043114 | 3300006880 | Bacteria | 3925 |
| 71 | Ga0075436_100004385 | 3300006914 | Bacteria | 9685 |
| 72 | Ga0097620_100092321 | 3300006931 | Bacteria | 3079 |
| 73 | Ga0075435_100000557 | 3300007076 | Bacteria | 22898 |
| 74 | Ga0105251_10030668 | 3300009011 | Bacteria | 2697 |
| 75 | Ga0105251_10132044 | 3300009011 | Bacteria | 1131 |
| 76 | Ga0105240_10168886 | 3300009093 | Bacteria | 2592 |
| 77 | Ga0105240_10177882 | 3300009093 | Bacteria | 2514 |
| 78 | Ga0105240_10197872 | 3300009093 | Bacteria | 2357 |
| 79 | Ga0105245_10096175 | 3300009098 | Bacteria | 2732 |
| 80 | Ga0105247_10001747 | 3300009101 | Bacteria | 15305 |
| 81 | Ga0105247_10003869 | 3300009101 | Bacteria | 9690 |
| 82 | Ga0105247_10183530 | 3300009101 | Bacteria | 1397 |
| 83 | Ga0114129_10579126 | 3300009147 | Bacteria | 1457 |
| 84 | Ga0105243_10176934 | 3300009148 | Bacteria | 1852 |
| 85 | Ga0105241_10016127 | 3300009174 | Bacteria | 5477 |
| 86 | Ga0105241_10098011 | 3300009174 | Bacteria | 2325 |
| 87 | Ga0105248_10036533 | 3300009177 | Bacteria | 5495 |
| 88 | Ga0105248_10531312 | 3300009177 | Bacteria | 1326 |
| 89 | Ga0105237_10032205 | 3300009545 | Bacteria | 5309 |
| 90 | Ga0105237_10366207 | 3300009545 | Bacteria | 1446 |
| 91 | Ga0105238_10083103 | 3300009551 | Bacteria | 3192 |
| 92 | Ga0105239_10015801 | 3300010375 | Bacteria | 8355 |
| 93 | Ga0105239_10043590 | 3300010375 | Bacteria | 4919 |
| 94 | Ga0105239_10192551 | 3300010375 | Bacteria | 2283 |
| 95 | Ga0105239_10379215 | 3300010375 | Bacteria | 1599 |
| 96 | Ga0105246_10000193 | 3300011119 | Bacteria | 30407 |
| 97 | Ga0105246_10153750 | 3300011119 | Bacteria | 1745 |
| 98 | Ga0157373_10086812 | 3300013100 | Bacteria | 2204 |
| 99 | Ga0157371_10052533 | 3300013102 | Bacteria | 2894 |
| 100 | Ga0157370_10065663 | 3300013104 | Bacteria | 3433 |
| 101 | Ga0157370_10072001 | 3300013104 | Bacteria | 3261 |
| 102 | Ga0157369_10093917 | 3300013105 | Bacteria | 3202 |
| 103 | Ga0157369_10205116 | 3300013105 | Bacteria | 2068 |
| 104 | Ga0157374_10039291 | 3300013296 | Bacteria | 4355 |
| 105 | Ga0157374_10134250 | 3300013296 | Bacteria | 2398 |
| 106 | Ga0157378_10126730 | 3300013297 | Bacteria | 2359 |
| 107 | Ga0163162_10317333 | 3300013306 | Bacteria | 1691 |
| 108 | Ga0157372_10000131 | 3300013307 | Bacteria | 82235 |
| 109 | Ga0157372_10081643 | 3300013307 | Bacteria | 3659 |
| 110 | Ga0157375_10011569 | 3300013308 | Bacteria | 7794 |
| 111 | Ga0163163_10197447 | 3300014325 | Bacteria | 2060 |
| 112 | Ga0157377_10004038 | 3300014745 | Bacteria | 6697 |
| 113 | Ga0157379_10098997 | 3300014968 | Bacteria | 2617 |
| 114 | Ga0157379_10306258 | 3300014968 | Bacteria | 1449 |
| 115 | Ga0157376_10144634 | 3300014969 | Bacteria | 2137 |
| 116 | Ga0163161_10024581 | 3300017792 | Bacteria | 4257 |
| 117 | Ga0197907_10522062 | 3300020069 | Bacteria | 1989 |
| 118 | Ga0206356_11036052 | 3300020070 | Bacteria | 3253 |
| 119 | Ga0206353_10170135 | 3300020082 | Bacteria | 3515 |
| 120 | Ga0206353_10625394 | 3300020082 | Bacteria | 2603 |
| 121 | Ga0206353_11545269 | 3300020082 | Bacteria | 3376 |
| 122 | Ga0224712_10010701 | 3300022467 | Bacteria | 2816 |
| 123 | Ga0207656_10011866 | 3300025321 | Bacteria | 3301 |
| 124 | Ga0207653_10023048 | 3300025885 | Bacteria | 1981 |
| 125 | Ga0207688_10033669 | 3300025901 | Bacteria | 2835 |
| 126 | Ga0207680_10070749 | 3300025903 | Bacteria | 2160 |
| 127 | Ga0207645_10013415 | 3300025907 | Bacteria | 5522 |
| 128 | Ga0207643_10000326 | 3300025908 | Bacteria | 32686 |
| 129 | Ga0207705_10014532 | 3300025909 | Bacteria | 5664 |
| 130 | Ga0207654_10031873 | 3300025911 | Bacteria | 2907 |
| 131 | Ga0207654_10034378 | 3300025911 | Bacteria | 2816 |
| 132 | Ga0207654_10046885 | 3300025911 | Bacteria | 2466 |
| 133 | Ga0207695_10071882 | 3300025913 | Bacteria | 3532 |
| 134 | Ga0207695_10126221 | 3300025913 | Bacteria | 2520 |
| 135 | Ga0207693_10014795 | 3300025915 | Bacteria | 6269 |
| 136 | Ga0207663_10001527 | 3300025916 | Bacteria | 10827 |
| 137 | Ga0207660_10011144 | 3300025917 | Bacteria | 5845 |
| 138 | Ga0207657_10015501 | 3300025919 | Bacteria | 7382 |
| 139 | Ga0207649_10004261 | 3300025920 | Bacteria | 7792 |
| 140 | Ga0207652_10013294 | 3300025921 | Bacteria | 6666 |
| 141 | Ga0207694_10103475 | 3300025924 | Bacteria | 2258 |
| 142 | Ga0207650_10002452 | 3300025925 | Bacteria | 12912 |
| 143 | Ga0207659_10012186 | 3300025926 | Bacteria | 5457 |
| 144 | Ga0207687_10007290 | 3300025927 | Bacteria | 7296 |
| 145 | Ga0207687_10014447 | 3300025927 | Bacteria | 5166 |
| 146 | Ga0207687_10055176 | 3300025927 | Bacteria | 2783 |
| 147 | Ga0207687_10060037 | 3300025927 | Bacteria | 2680 |
| 148 | Ga0207664_10062587 | 3300025929 | Bacteria | 2972 |
| 149 | Ga0207644_10007119 | 3300025931 | Bacteria | 7292 |
| 150 | Ga0207644_10058466 | 3300025931 | Bacteria | 2787 |
| 151 | Ga0207644_10248027 | 3300025931 | Bacteria | 1420 |
| 152 | Ga0207690_10009853 | 3300025932 | Bacteria | 5674 |
| 153 | Ga0207665_10003055 | 3300025939 | Bacteria | 11228 |
| 154 | Ga0207691_10012870 | 3300025940 | Bacteria | 8008 |
| 155 | Ga0207691_10077702 | 3300025940 | Bacteria | 2989 |
| 156 | Ga0207711_10036477 | 3300025941 | Bacteria | 4172 |
| 157 | Ga0207689_10000818 | 3300025942 | Bacteria | 29960 |
| 158 | Ga0207661_10022362 | 3300025944 | Bacteria | 4760 |
| 159 | Ga0207667_10042028 | 3300025949 | Bacteria | 4862 |
| 160 | Ga0207667_10072320 | 3300025949 | Bacteria | 3585 |
| 161 | Ga0207667_10151312 | 3300025949 | Bacteria | 2388 |
| 162 | Ga0207651_10072553 | 3300025960 | Bacteria | 2444 |
| 163 | Ga0207640_10131279 | 3300025981 | Bacteria | 1811 |
| 164 | Ga0207658_10007653 | 3300025986 | Bacteria | 7355 |
| 165 | Ga0207658_10024654 | 3300025986 | Bacteria | 4210 |
| 166 | Ga0207677_10009344 | 3300026023 | Bacteria | 5516 |
| 167 | Ga0207678_10000468 | 3300026067 | Bacteria | 36559 |
| 168 | Ga0207678_10003353 | 3300026067 | Bacteria | 14451 |
| 169 | Ga0207708_10007451 | 3300026075 | Bacteria | 8088 |
| 170 | Ga0207708_10022689 | 3300026075 | Bacteria | 4739 |
| 171 | Ga0207702_10000541 | 3300026078 | Bacteria | 42221 |
| 172 | Ga0207702_10007678 | 3300026078 | Bacteria | 9169 |
| 173 | Ga0207702_10104594 | 3300026078 | Bacteria | 2506 |
| 174 | Ga0207702_10225902 | 3300026078 | Bacteria | 1747 |
| 175 | Ga0207641_10002103 | 3300026088 | Bacteria | 18819 |
| 176 | Ga0207641_10006762 | 3300026088 | Bacteria | 9608 |
| 177 | Ga0207676_10127259 | 3300026095 | Bacteria | 2159 |
| 178 | Ga0207674_10001847 | 3300026116 | Bacteria | 26995 |
| 179 | Ga0207675_100005244 | 3300026118 | Bacteria | 12473 |
| 180 | Ga0207683_10000634 | 3300026121 | Bacteria | 32125 |
| 181 | Ga0207683_10007116 | 3300026121 | Bacteria | 9589 |
| 182 | Ga0207698_10039588 | 3300026142 | Bacteria | 3494 |
| 183 | Ga0207428_10010152 | 3300027907 | Bacteria | 8421 |
| 184 | Ga0268264_10000315 | 3300028381 | Bacteria | 77227 |
| 185 | Ga0268264_10018110 | 3300028381 | Bacteria | 5761 |
| 186 | Ga0373938_0006061 | 3300034957 | Bacteria | 2076 |
| 187 | Ga0373931_0092457 | 3300035691 | Bacteria | 1687 |
| 188 | Ga0373927_0055903 | 3300035695 | Bacteria | 2551 |
| 189 | Ga0373925_0016948 | 3300037068 | Bacteria | 5273 |
| 190 | Ga0395900_0266212 | 3300037418 | Bacteria | 1710 |
| 191 | Ga0395901_0201142 | 3300038443 | Bacteria | 2088 |
| 192 | Ga0466966_0003942 | 3300044684 | Bacteria | 9803 |
| 193 | Ga0466966_0027998 | 3300044684 | Bacteria | 3672 |
| 194 | Ga0466961_0006450 | 3300044693 | Bacteria | 7450 |
| 195 | Ga0466961_0024385 | 3300044693 | Bacteria | 3892 |
| 196 | Ga0466961_0101569 | 3300044693 | Bacteria | 1811 |
| 197 | Ga0466961_0105248 | 3300044693 | Bacteria | 1776 |
| 198 | Ga0466961_0136460 | 3300044693 | Bacteria | 1537 |
| 199 | Ga0466963_0030587 | 3300044694 | Bacteria | 3476 |
| 200 | Ga0466963_0206385 | 3300044694 | Bacteria | 1374 |
| 201 | Ga0466963_0221705 | 3300044694 | Bacteria | 1324 |
| 202 | Ga0466963_0225647 | 3300044694 | Bacteria | 1312 |
| 203 | Ga0466963_0244055 | 3300044694 | Bacteria | 1260 |
| 204 | Ga0466964_0001054 | 3300044706 | Bacteria | 9206 |
| 205 | Ga0466964_0024558 | 3300044706 | Bacteria | 2349 |
| 206 | Ga0466971_0004346 | 3300044719 | Bacteria | 6110 |
| 207 | Ga0466970_0032360 | 3300044765 | Bacteria | 2763 |
| 208 | Ga0466970_0041837 | 3300044765 | Bacteria | 2436 |
| 209 | Ga0466957_0014554 | 3300044842 | Bacteria | 4582 |
| 210 | Ga0466957_0174824 | 3300044842 | Bacteria | 1400 |
| 211 | Ga0466960_0022297 | 3300044901 | Bacteria | 2830 |
| 212 | Ga0466959_0017352 | 3300045049 | Bacteria | 5276 |
| 213 | Ga0466959_0034414 | 3300045049 | Bacteria | 3747 |
| 214 | Ga0466959_0077376 | 3300045049 | Bacteria | 2401 |
| 215 | Ga0466959_0096681 | 3300045049 | Bacteria | 2117 |
| 216 | Ga0466958_0003375 | 3300045836 | Bacteria | 8279 |
| 217 | Ga0466958_0004190 | 3300045836 | Bacteria | 7580 |
| 218 | Ga0466958_0023214 | 3300045836 | Bacteria | 3638 |
| 219 | Ga0466958_0029728 | 3300045836 | Bacteria | 3242 |
| 220 | Ga0466967_0000302 | 3300045976 | Bacteria | 22184 |
| 221 | Ga0466967_0010313 | 3300045976 | Bacteria | 6998 |
| 222 | Ga0466967_0020756 | 3300045976 | Bacteria | 5319 |
| 223 | Ga0466967_0024102 | 3300045976 | Bacteria | 4998 |
| 224 | Ga0466967_0078012 | 3300045976 | Bacteria | 2983 |
| 225 | Ga0466967_0198548 | 3300045976 | Bacteria | 1899 |
| 226 | Ga0466967_0324890 | 3300045976 | Bacteria | 1484 |
| 227 | Ga0466967_0337704 | 3300045976 | Bacteria | 1456 |
| 228 | Ga0496100_0035028 | 3300048903 | Bacteria | 3155 |
| 229 | Ga0496101_0008859 | 3300048904 | Bacteria | 6587 |
| 230 | Ga0496101_0022875 | 3300048904 | Bacteria | 4309 |
| 231 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 232 | Ga0496102_0000813 | 3300048905 | Bacteria | 30380 |
| 233 | Ga0496102_0024323 | 3300048905 | Bacteria | 5384 |
| 234 | Ga0496102_0046783 | 3300048905 | Bacteria | 3930 |
| 235 | Ga0496102_0051674 | 3300048905 | Bacteria | 3744 |
| 236 | Ga0496103_0000231 | 3300048906 | Bacteria | 54600 |
| 237 | Ga0496104_0003341 | 3300048907 | Bacteria | 13849 |
| 238 | Ga0496104_0012856 | 3300048907 | Bacteria | 7539 |
| 239 | Ga0496105_0004853 | 3300048908 | Bacteria | 10155 |
| 240 | Ga0496105_0011098 | 3300048908 | Bacteria | 7104 |
| 241 | Ga0496105_0182889 | 3300048908 | Bacteria | 1716 |
| 242 | Ga0496106_0027695 | 3300048909 | Bacteria | 4221 |
| 243 | Ga0496106_0032034 | 3300048909 | Bacteria | 3919 |
| 244 | Ga0496107_0005833 | 3300048910 | Bacteria | 8432 |
| 245 | Ga0496108_0007000 | 3300048911 | Bacteria | 9132 |
| 246 | Ga0496108_0012211 | 3300048911 | Bacteria | 6987 |
| 247 | Ga0496108_0038094 | 3300048911 | Bacteria | 4005 |
| 248 | Ga0496108_0112133 | 3300048911 | Bacteria | 2333 |
| 249 | Ga0496109_0010921 | 3300048912 | Bacteria | 7780 |
| 250 | Ga0496109_0015882 | 3300048912 | Bacteria | 6573 |
| 251 | Ga0496109_0028903 | 3300048912 | Bacteria | 4963 |
| 252 | Ga0496109_0039561 | 3300048912 | Bacteria | 4268 |
| 253 | Ga0496110_0026928 | 3300048913 | Bacteria | 4924 |
| 254 | Ga0496110_0048014 | 3300048913 | Bacteria | 3740 |
| 255 | Ga0496110_0471106 | 3300048913 | Bacteria | 1144 |
| 256 | Ga0496111_0002336 | 3300048914 | Bacteria | 11430 |
| 257 | Ga0496111_0153337 | 3300048914 | Bacteria | 1709 |
| 258 | Ga0496113_0008778 | 3300048916 | Bacteria | 6602 |
| 259 | Ga0496113_0036098 | 3300048916 | Bacteria | 3620 |
| 260 | Ga0496114_0113598 | 3300048917 | Bacteria | 2322 |
| 261 | Ga0496115_0012951 | 3300048918 | Bacteria | 6290 |
| 262 | Ga0496119_0000022 | 3300048922 | Bacteria | 269878 |
| 263 | Ga0496120_0001552 | 3300048923 | Bacteria | 26878 |
| 264 | Ga0496120_0110264 | 3300048923 | Bacteria | 1439 |
| 265 | Ga0496126_0000003 | 3300048929 | Bacteria | 961576 |
| 266 | Ga0496126_0033125 | 3300048929 | Bacteria | 4863 |
| 267 | Ga0501031_0027192 | 3300049568 | Bacteria | 3730 |
| 268 | Ga0501032_0035227 | 3300049569 | Bacteria | 3423 |
| 269 | Ga0501033_0090607 | 3300049570 | Bacteria | 2237 |
| 270 | Ga0501033_0111869 | 3300049570 | Bacteria | 1987 |
| 271 | Ga0501038_0004045 | 3300049574 | Bacteria | 13628 |
| 272 | Ga0501043_0008555 | 3300049579 | Bacteria | 8066 |
| 273 | Ga0501048_0004212 | 3300049582 | Bacteria | 10963 |
| 274 | Ga0501070_0021783 | 3300049586 | Bacteria | 5370 |
| 275 | Ga0501081_0042899 | 3300049743 | Bacteria | 3101 |
| 276 | Ga0501035_0009171 | 3300049822 | Bacteria | 9200 |
| 277 | Ga0501035_0240511 | 3300049822 | Bacteria | 1540 |
| 278 | Ga0501044_0071112 | 3300049823 | Bacteria | 3538 |
| 279 | Ga0501044_0129357 | 3300049823 | Bacteria | 2520 |
| 280 | nmdc:mga05p37_60595_c1 | 3300050507 | Bacteria | 4659 |
| 281 | nmdc:mga05p37_653681_c1 | 3300050507 | Bacteria | 1177 |
| 282 | nmdc:mga08y16_1855_c1 | 3300050511 | Bacteria | 21462 |
| 283 | nmdc:mga0n895_19087_c1 | 3300050512 | Bacteria | 6365 |
| 284 | nmdc:mga0rr50_719_c1 | 3300050513 | Bacteria | 17839 |
| 285 | nmdc:mga0a205_4394_c2 | 3300050515 | Bacteria | 10262 |
| 286 | nmdc:mga0a205_44535_c1 | 3300050515 | Bacteria | 4278 |
| 287 | Ga0466962_0010492 | 3300061719 | Bacteria | 4455 |
| 288 | Ga0466962_0023946 | 3300061719 | Bacteria | 2934 |
| 289 | Ga0466962_0025377 | 3300061719 | Bacteria | 2845 |
| 290 | Ga0466962_0027288 | 3300061719 | Bacteria | 2741 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0136460 | Ga0466961_0136460_547_1509 | 316 |
| 2 | 3300009147 | Ga0114129_10579126 | Ga0114129_105791262 | 325 |
| 3 | 3300050507 | nmdc:mga05p37_653681_c1 | nmdc:mga05p37_653681_c1_68_1090 | 325 |
| 4 | 3300005983 | Ga0081540_1049444 | Ga0081540_10494442 | 326 |
| 5 | 3300026067 | Ga0207678_10003353 | Ga0207678_100033538 | 326 |
| 6 | 3300037418 | Ga0395900_0266212 | Ga0395900_0266212_592_1635 | 328 |
| 7 | 3300038443 | Ga0395901_0201142 | Ga0395901_0201142_736_1779 | 328 |
| 8 | 3300045976 | Ga0466967_0324890 | Ga0466967_0324890_12_1076 | 329 |
| 9 | 3300009098 | Ga0105245_10096175 | Ga0105245_100961752 | 331 |
| 10 | 3300025927 | Ga0207687_10055176 | Ga0207687_100551764 | 331 |
| 11 | 3300013105 | Ga0157369_10205116 | Ga0157369_102051162 | 332 |
| 12 | 3300005563 | Ga0068855_100173901 | Ga0068855_1001739013 | 333 |
| 13 | 3300020082 | Ga0206353_11545269 | Ga0206353_115452692 | 333 |
| 14 | 3300009093 | Ga0105240_10177882 | Ga0105240_101778822 | 335 |
| 15 | 3300025913 | Ga0207695_10126221 | Ga0207695_101262212 | 335 |
| 16 | 3300048908 | Ga0496105_0182889 | Ga0496105_0182889_489_1574 | 336 |
| 17 | 3300048911 | Ga0496108_0112133 | Ga0496108_0112133_685_1770 | 336 |
| 18 | 3300048912 | Ga0496109_0028903 | Ga0496109_0028903_1406_2491 | 336 |
| 19 | 3300048917 | Ga0496114_0113598 | Ga0496114_0113598_282_1367 | 336 |
| 20 | 3300048916 | Ga0496113_0036098 | Ga0496113_0036098_1407_2492 | 337 |
| 21 | 3300005436 | Ga0070713_100001156 | Ga0070713_1000011563 | 338 |
| 22 | 3300005614 | Ga0068856_100016265 | Ga0068856_1000162652 | 338 |
| 23 | 3300006175 | Ga0070712_100075133 | Ga0070712_1000751333 | 338 |
| 24 | 3300026078 | Ga0207702_10007678 | Ga0207702_100076782 | 338 |
| 25 | 3300049823 | Ga0501044_0129357 | Ga0501044_0129357_1074_2144 | 338 |
| 26 | 3300045836 | Ga0466958_0004190 | Ga0466958_0004190_2855_3922 | 339 |
| 27 | 3300061719 | Ga0466962_0023946 | Ga0466962_0023946_1514_2581 | 339 |
| 28 | 3300005937 | Ga0081455_10046416 | Ga0081455_100464163 | 340 |
| 29 | 3300037068 | Ga0373925_0016948 | Ga0373925_0016948_3718_4773 | 340 |
| 30 | 3300048913 | Ga0496110_0471106 | Ga0496110_0471106_79_1101 | 340 |
| 31 | 3300005563 | Ga0068855_100231169 | Ga0068855_1002311692 | 341 |
| 32 | 3300025949 | Ga0207667_10042028 | Ga0207667_100420282 | 341 |
| 33 | 3300044706 | Ga0466964_0001054 | Ga0466964_0001054_4734_5804 | 341 |
| 34 | 3300045836 | Ga0466958_0023214 | Ga0466958_0023214_743_1813 | 341 |
| 35 | 3300061719 | Ga0466962_0025377 | Ga0466962_0025377_711_1781 | 341 |
| 36 | 3300044719 | Ga0466971_0004346 | Ga0466971_0004346_3211_4272 | 342 |
| 37 | 3300061719 | Ga0466962_0010492 | Ga0466962_0010492_1941_3002 | 342 |
| 38 | 3300002459 | JGI24751J29686_10002316 | JGI24751J29686_100023163 | 343 |
| 39 | 3300005327 | Ga0070658_10117781 | Ga0070658_101177811 | 343 |
| 40 | 3300005331 | Ga0070670_100015180 | Ga0070670_1000151803 | 343 |
| 41 | 3300005334 | Ga0068869_100000606 | Ga0068869_1000006062 | 343 |
| 42 | 3300005336 | Ga0070680_100033113 | Ga0070680_1000331133 | 343 |
| 43 | 3300005338 | Ga0068868_100034498 | Ga0068868_1000344984 | 343 |
| 44 | 3300005339 | Ga0070660_100044841 | Ga0070660_1000448413 | 343 |
| 45 | 3300005340 | Ga0070689_100018052 | Ga0070689_1000180526 | 343 |
| 46 | 3300005344 | Ga0070661_100189230 | Ga0070661_1001892302 | 343 |
| 47 | 3300005345 | Ga0070692_10012696 | Ga0070692_100126963 | 343 |
| 48 | 3300005355 | Ga0070671_100007992 | Ga0070671_1000079924 | 343 |
| 49 | 3300005364 | Ga0070673_100007062 | Ga0070673_1000070626 | 343 |
| 50 | 3300005455 | Ga0070663_100005595 | Ga0070663_1000055953 | 343 |
| 51 | 3300005456 | Ga0070678_100006122 | Ga0070678_1000061227 | 343 |
| 52 | 3300005466 | Ga0070685_10021370 | Ga0070685_100213704 | 343 |
| 53 | 3300005530 | Ga0070679_100012776 | Ga0070679_1000127766 | 343 |
| 54 | 3300005543 | Ga0070672_100163905 | Ga0070672_1001639052 | 343 |
| 55 | 3300005544 | Ga0070686_100123004 | Ga0070686_1001230043 | 343 |
| 56 | 3300005547 | Ga0070693_100000246 | Ga0070693_1000002462 | 343 |
| 57 | 3300005578 | Ga0068854_100132367 | Ga0068854_1001323672 | 343 |
| 58 | 3300005615 | Ga0070702_100000087 | Ga0070702_1000000873 | 343 |
| 59 | 3300005617 | Ga0068859_100092319 | Ga0068859_1000923193 | 343 |
| 60 | 3300005840 | Ga0068870_10000054 | Ga0068870_1000005412 | 343 |
| 61 | 3300005841 | Ga0068863_100001108 | Ga0068863_10000110825 | 343 |
| 62 | 3300005842 | Ga0068858_100007344 | Ga0068858_10000734410 | 343 |
| 63 | 3300006173 | Ga0070716_100009957 | Ga0070716_1000099575 | 343 |
| 64 | 3300006237 | Ga0097621_100009324 | Ga0097621_1000093244 | 343 |
| 65 | 3300006847 | Ga0075431_100316440 | Ga0075431_1003164402 | 343 |
| 66 | 3300006852 | Ga0075433_10020089 | Ga0075433_100200893 | 343 |
| 67 | 3300006871 | Ga0075434_100018305 | Ga0075434_1000183056 | 343 |
| 68 | 3300006880 | Ga0075429_100043114 | Ga0075429_1000431144 | 343 |
| 69 | 3300006914 | Ga0075436_100004385 | Ga0075436_1000043859 | 343 |
| 70 | 3300006931 | Ga0097620_100092321 | Ga0097620_1000923212 | 343 |
| 71 | 3300007076 | Ga0075435_100000557 | Ga0075435_10000055712 | 343 |
| 72 | 3300009011 | Ga0105251_10030668 | Ga0105251_100306682 | 343 |
| 73 | 3300009093 | Ga0105240_10197872 | Ga0105240_101978723 | 343 |
| 74 | 3300009101 | Ga0105247_10003869 | Ga0105247_100038693 | 343 |
| 75 | 3300009174 | Ga0105241_10016127 | Ga0105241_100161272 | 343 |
| 76 | 3300009177 | Ga0105248_10036533 | Ga0105248_100365332 | 343 |
| 77 | 3300009551 | Ga0105238_10083103 | Ga0105238_100831034 | 343 |
| 78 | 3300010375 | Ga0105239_10043590 | Ga0105239_100435902 | 343 |
| 79 | 3300011119 | Ga0105246_10000193 | Ga0105246_100001936 | 343 |
| 80 | 3300013100 | Ga0157373_10086812 | Ga0157373_100868123 | 343 |
| 81 | 3300013102 | Ga0157371_10052533 | Ga0157371_100525332 | 343 |
| 82 | 3300013104 | Ga0157370_10072001 | Ga0157370_100720013 | 343 |
| 83 | 3300013296 | Ga0157374_10134250 | Ga0157374_101342502 | 343 |
| 84 | 3300013307 | Ga0157372_10081643 | Ga0157372_100816433 | 343 |
| 85 | 3300013308 | Ga0157375_10011569 | Ga0157375_100115693 | 343 |
| 86 | 3300014745 | Ga0157377_10004038 | Ga0157377_100040382 | 343 |
| 87 | 3300014968 | Ga0157379_10098997 | Ga0157379_100989972 | 343 |
| 88 | 3300014969 | Ga0157376_10144634 | Ga0157376_101446342 | 343 |
| 89 | 3300020069 | Ga0197907_10522062 | Ga0197907_105220623 | 343 |
| 90 | 3300020070 | Ga0206356_11036052 | Ga0206356_110360522 | 343 |
| 91 | 3300020082 | Ga0206353_10625394 | Ga0206353_106253942 | 343 |
| 92 | 3300022467 | Ga0224712_10010701 | Ga0224712_100107013 | 343 |
| 93 | 3300025321 | Ga0207656_10011866 | Ga0207656_100118662 | 343 |
| 94 | 3300025907 | Ga0207645_10013415 | Ga0207645_100134154 | 343 |
| 95 | 3300025908 | Ga0207643_10000326 | Ga0207643_1000032628 | 343 |
| 96 | 3300025909 | Ga0207705_10014532 | Ga0207705_100145324 | 343 |
| 97 | 3300025911 | Ga0207654_10034378 | Ga0207654_100343782 | 343 |
| 98 | 3300025913 | Ga0207695_10071882 | Ga0207695_100718823 | 343 |
| 99 | 3300025915 | Ga0207693_10014795 | Ga0207693_100147953 | 343 |
| 100 | 3300025917 | Ga0207660_10011144 | Ga0207660_100111444 | 343 |
| 101 | 3300025920 | Ga0207649_10004261 | Ga0207649_100042613 | 343 |
| 102 | 3300025921 | Ga0207652_10013294 | Ga0207652_100132943 | 343 |
| 103 | 3300025925 | Ga0207650_10002452 | Ga0207650_100024526 | 343 |
| 104 | 3300025926 | Ga0207659_10012186 | Ga0207659_100121864 | 343 |
| 105 | 3300025927 | Ga0207687_10007290 | Ga0207687_100072904 | 343 |
| 106 | 3300025931 | Ga0207644_10007119 | Ga0207644_100071196 | 343 |
| 107 | 3300025932 | Ga0207690_10009853 | Ga0207690_100098533 | 343 |
| 108 | 3300025939 | Ga0207665_10003055 | Ga0207665_1000305510 | 343 |
| 109 | 3300025940 | Ga0207691_10012870 | Ga0207691_100128703 | 343 |
| 110 | 3300025941 | Ga0207711_10036477 | Ga0207711_100364773 | 343 |
| 111 | 3300025942 | Ga0207689_10000818 | Ga0207689_1000081818 | 343 |
| 112 | 3300025944 | Ga0207661_10022362 | Ga0207661_100223623 | 343 |
| 113 | 3300025949 | Ga0207667_10151312 | Ga0207667_101513122 | 343 |
| 114 | 3300025960 | Ga0207651_10072553 | Ga0207651_100725533 | 343 |
| 115 | 3300025981 | Ga0207640_10131279 | Ga0207640_101312792 | 343 |
| 116 | 3300026023 | Ga0207677_10009344 | Ga0207677_100093443 | 343 |
| 117 | 3300026067 | Ga0207678_10000468 | Ga0207678_1000046812 | 343 |
| 118 | 3300026075 | Ga0207708_10007451 | Ga0207708_100074516 | 343 |
| 119 | 3300026078 | Ga0207702_10000541 | Ga0207702_1000054112 | 343 |
| 120 | 3300026088 | Ga0207641_10006762 | Ga0207641_100067622 | 343 |
| 121 | 3300026116 | Ga0207674_10001847 | Ga0207674_1000184726 | 343 |
| 122 | 3300026121 | Ga0207683_10000634 | Ga0207683_100006342 | 343 |
| 123 | 3300027907 | Ga0207428_10010152 | Ga0207428_100101524 | 343 |
| 124 | 3300028381 | Ga0268264_10018110 | Ga0268264_100181102 | 343 |
| 125 | 3300048905 | Ga0496102_0051674 | Ga0496102_0051674_2619_3656 | 343 |
| 126 | 3300048907 | Ga0496104_0003341 | Ga0496104_0003341_2615_3652 | 343 |
| 127 | 3300048908 | Ga0496105_0011098 | Ga0496105_0011098_1419_2456 | 343 |
| 128 | 3300048909 | Ga0496106_0032034 | Ga0496106_0032034_1874_2911 | 343 |
| 129 | 3300048911 | Ga0496108_0012211 | Ga0496108_0012211_363_1400 | 343 |
| 130 | 3300048912 | Ga0496109_0039561 | Ga0496109_0039561_2132_3169 | 343 |
| 131 | 3300048913 | Ga0496110_0026928 | Ga0496110_0026928_2918_3955 | 343 |
| 132 | 3300048914 | Ga0496111_0002336 | Ga0496111_0002336_3852_4889 | 343 |
| 133 | 3300050507 | nmdc:mga05p37_60595_c1 | nmdc:mga05p37_60595_c1_3422_4459 | 343 |
| 134 | 3300050511 | nmdc:mga08y16_1855_c1 | nmdc:mga08y16_1855_c1_876_1913 | 343 |
| 135 | 3300050512 | nmdc:mga0n895_19087_c1 | nmdc:mga0n895_19087_c1_2590_3627 | 343 |
| 136 | 3300050513 | nmdc:mga0rr50_719_c1 | nmdc:mga0rr50_719_c1_5141_6178 | 343 |
| 137 | 3300050515 | nmdc:mga0a205_4394_c2 | nmdc:mga0a205_4394_c2_4742_5779 | 343 |
| 138 | 3300044684 | Ga0466966_0027998 | Ga0466966_0027998_496_1551 | 344 |
| 139 | 3300005981 | Ga0081538_10000139 | Ga0081538_1000013926 | 346 |
| 140 | 3300044694 | Ga0466963_0221705 | Ga0466963_0221705_27_1088 | 347 |
| 141 | 3300044842 | Ga0466957_0014554 | Ga0466957_0014554_2792_3853 | 347 |
| 142 | 3300045836 | Ga0466958_0029728 | Ga0466958_0029728_812_1873 | 347 |
| 143 | 3300045976 | Ga0466967_0198548 | Ga0466967_0198548_813_1886 | 347 |
| 144 | 3300045976 | Ga0466967_0337704 | Ga0466967_0337704_58_1152 | 347 |
| 145 | 3300048905 | Ga0496102_0024323 | Ga0496102_0024323_3679_4725 | 347 |
| 146 | 3300048929 | Ga0496126_0000003 | Ga0496126_0000003_383812_384867 | 347 |
| 147 | 3300061719 | Ga0466962_0027288 | Ga0466962_0027288_1660_2721 | 347 |
| 148 | 3300005339 | Ga0070660_100008478 | Ga0070660_1000084787 | 348 |
| 149 | 3300005345 | Ga0070692_10050611 | Ga0070692_100506112 | 348 |
| 150 | 3300005347 | Ga0070668_100017940 | Ga0070668_1000179406 | 348 |
| 151 | 3300005355 | Ga0070671_100102824 | Ga0070671_1001028242 | 348 |
| 152 | 3300005364 | Ga0070673_100026247 | Ga0070673_1000262472 | 348 |
| 153 | 3300005406 | Ga0070703_10010790 | Ga0070703_100107901 | 348 |
| 154 | 3300005436 | Ga0070713_100015431 | Ga0070713_1000154316 | 348 |
| 155 | 3300005439 | Ga0070711_100013864 | Ga0070711_1000138646 | 348 |
| 156 | 3300005456 | Ga0070678_100081657 | Ga0070678_1000816572 | 348 |
| 157 | 3300005539 | Ga0068853_100005838 | Ga0068853_1000058383 | 348 |
| 158 | 3300005544 | Ga0070686_100037792 | Ga0070686_1000377923 | 348 |
| 159 | 3300005545 | Ga0070695_100015782 | Ga0070695_1000157822 | 348 |
| 160 | 3300005546 | Ga0070696_100027194 | Ga0070696_1000271946 | 348 |
| 161 | 3300005547 | Ga0070693_100040727 | Ga0070693_1000407272 | 348 |
| 162 | 3300005563 | Ga0068855_100012420 | Ga0068855_1000124209 | 348 |
| 163 | 3300005618 | Ga0068864_100029155 | Ga0068864_1000291555 | 348 |
| 164 | 3300005719 | Ga0068861_100006590 | Ga0068861_1000065906 | 348 |
| 165 | 3300005842 | Ga0068858_100467290 | Ga0068858_1004672901 | 348 |
| 166 | 3300006237 | Ga0097621_100078152 | Ga0097621_1000781525 | 348 |
| 167 | 3300006358 | Ga0068871_100092241 | Ga0068871_1000922415 | 348 |
| 168 | 3300006852 | Ga0075433_10012177 | Ga0075433_100121775 | 348 |
| 169 | 3300009011 | Ga0105251_10132044 | Ga0105251_101320441 | 348 |
| 170 | 3300009093 | Ga0105240_10168886 | Ga0105240_101688862 | 348 |
| 171 | 3300009101 | Ga0105247_10183530 | Ga0105247_101835302 | 348 |
| 172 | 3300009148 | Ga0105243_10176934 | Ga0105243_101769342 | 348 |
| 173 | 3300009174 | Ga0105241_10098011 | Ga0105241_100980112 | 348 |
| 174 | 3300009177 | Ga0105248_10531312 | Ga0105248_105313122 | 348 |
| 175 | 3300009545 | Ga0105237_10032205 | Ga0105237_100322056 | 348 |
| 176 | 3300009545 | Ga0105237_10366207 | Ga0105237_103662072 | 348 |
| 177 | 3300010375 | Ga0105239_10192551 | Ga0105239_101925512 | 348 |
| 178 | 3300011119 | Ga0105246_10153750 | Ga0105246_101537501 | 348 |
| 179 | 3300013104 | Ga0157370_10065663 | Ga0157370_100656634 | 348 |
| 180 | 3300013296 | Ga0157374_10039291 | Ga0157374_100392913 | 348 |
| 181 | 3300013297 | Ga0157378_10126730 | Ga0157378_101267302 | 348 |
| 182 | 3300013306 | Ga0163162_10317333 | Ga0163162_103173332 | 348 |
| 183 | 3300014325 | Ga0163163_10197447 | Ga0163163_101974472 | 348 |
| 184 | 3300014968 | Ga0157379_10306258 | Ga0157379_103062582 | 348 |
| 185 | 3300017792 | Ga0163161_10024581 | Ga0163161_100245815 | 348 |
| 186 | 3300025885 | Ga0207653_10023048 | Ga0207653_100230482 | 348 |
| 187 | 3300025901 | Ga0207688_10033669 | Ga0207688_100336694 | 348 |
| 188 | 3300025903 | Ga0207680_10070749 | Ga0207680_100707491 | 348 |
| 189 | 3300025911 | Ga0207654_10046885 | Ga0207654_100468852 | 348 |
| 190 | 3300025916 | Ga0207663_10001527 | Ga0207663_100015278 | 348 |
| 191 | 3300025919 | Ga0207657_10015501 | Ga0207657_100155016 | 348 |
| 192 | 3300025927 | Ga0207687_10014447 | Ga0207687_100144472 | 348 |
| 193 | 3300025929 | Ga0207664_10062587 | Ga0207664_100625872 | 348 |
| 194 | 3300025931 | Ga0207644_10248027 | Ga0207644_102480272 | 348 |
| 195 | 3300025940 | Ga0207691_10077702 | Ga0207691_100777021 | 348 |
| 196 | 3300025949 | Ga0207667_10072320 | Ga0207667_100723203 | 348 |
| 197 | 3300026075 | Ga0207708_10022689 | Ga0207708_100226893 | 348 |
| 198 | 3300026078 | Ga0207702_10104594 | Ga0207702_101045941 | 348 |
| 199 | 3300026095 | Ga0207676_10127259 | Ga0207676_101272593 | 348 |
| 200 | 3300026118 | Ga0207675_100005244 | Ga0207675_1000052442 | 348 |
| 201 | 3300026121 | Ga0207683_10007116 | Ga0207683_100071168 | 348 |
| 202 | 3300034957 | Ga0373938_0006061 | Ga0373938_0006061_640_1701 | 348 |
| 203 | 3300035691 | Ga0373931_0092457 | Ga0373931_0092457_242_1303 | 348 |
| 204 | 3300044693 | Ga0466961_0101569 | Ga0466961_0101569_172_1230 | 348 |
| 205 | 3300044694 | Ga0466963_0030587 | Ga0466963_0030587_2050_3108 | 348 |
| 206 | 3300044694 | Ga0466963_0206385 | Ga0466963_0206385_284_1354 | 348 |
| 207 | 3300044694 | Ga0466963_0244055 | Ga0466963_0244055_61_1119 | 348 |
| 208 | 3300048903 | Ga0496100_0035028 | Ga0496100_0035028_1771_2832 | 348 |
| 209 | 3300048904 | Ga0496101_0022875 | Ga0496101_0022875_1458_2519 | 348 |
| 210 | 3300048905 | Ga0496102_0046783 | Ga0496102_0046783_1282_2343 | 348 |
| 211 | 3300048907 | Ga0496104_0012856 | Ga0496104_0012856_1603_2664 | 348 |
| 212 | 3300048908 | Ga0496105_0004853 | Ga0496105_0004853_3962_5023 | 348 |
| 213 | 3300048909 | Ga0496106_0027695 | Ga0496106_0027695_1387_2448 | 348 |
| 214 | 3300048910 | Ga0496107_0005833 | Ga0496107_0005833_5469_6530 | 348 |
| 215 | 3300048911 | Ga0496108_0038094 | Ga0496108_0038094_2871_3932 | 348 |
| 216 | 3300048912 | Ga0496109_0015882 | Ga0496109_0015882_5240_6301 | 348 |
| 217 | 3300048913 | Ga0496110_0048014 | Ga0496110_0048014_249_1310 | 348 |
| 218 | 3300048914 | Ga0496111_0153337 | Ga0496111_0153337_195_1256 | 348 |
| 219 | 3300048916 | Ga0496113_0008778 | Ga0496113_0008778_2777_3838 | 348 |
| 220 | 3300048918 | Ga0496115_0012951 | Ga0496115_0012951_150_1211 | 348 |
| 221 | 3300050515 | nmdc:mga0a205_44535_c1 | nmdc:mga0a205_44535_c1_2970_4031 | 348 |
| 222 | 3300005355 | Ga0070671_100016400 | Ga0070671_1000164002 | 349 |
| 223 | 3300005367 | Ga0070667_100001770 | Ga0070667_1000017709 | 349 |
| 224 | 3300005367 | Ga0070667_100035109 | Ga0070667_1000351093 | 349 |
| 225 | 3300005548 | Ga0070665_100003390 | Ga0070665_1000033903 | 349 |
| 226 | 3300005616 | Ga0068852_100289423 | Ga0068852_1002894232 | 349 |
| 227 | 3300005841 | Ga0068863_100001135 | Ga0068863_1000011359 | 349 |
| 228 | 3300005843 | Ga0068860_100000261 | Ga0068860_10000026160 | 349 |
| 229 | 3300009101 | Ga0105247_10001747 | Ga0105247_1000174717 | 349 |
| 230 | 3300010375 | Ga0105239_10379215 | Ga0105239_103792152 | 349 |
| 231 | 3300013105 | Ga0157369_10093917 | Ga0157369_100939172 | 349 |
| 232 | 3300020082 | Ga0206353_10170135 | Ga0206353_101701354 | 349 |
| 233 | 3300025911 | Ga0207654_10031873 | Ga0207654_100318732 | 349 |
| 234 | 3300025927 | Ga0207687_10060037 | Ga0207687_100600372 | 349 |
| 235 | 3300025931 | Ga0207644_10058466 | Ga0207644_100584661 | 349 |
| 236 | 3300025986 | Ga0207658_10007653 | Ga0207658_100076535 | 349 |
| 237 | 3300025986 | Ga0207658_10024654 | Ga0207658_100246543 | 349 |
| 238 | 3300026088 | Ga0207641_10002103 | Ga0207641_100021035 | 349 |
| 239 | 3300026142 | Ga0207698_10039588 | Ga0207698_100395882 | 349 |
| 240 | 3300028381 | Ga0268264_10000315 | Ga0268264_1000031561 | 349 |
| 241 | 3300035695 | Ga0373927_0055903 | Ga0373927_0055903_357_1427 | 349 |
| 242 | 3300044684 | Ga0466966_0003942 | Ga0466966_0003942_3824_4897 | 349 |
| 243 | 3300044693 | Ga0466961_0006450 | Ga0466961_0006450_5778_6851 | 349 |
| 244 | 3300044693 | Ga0466961_0024385 | Ga0466961_0024385_349_1410 | 349 |
| 245 | 3300044693 | Ga0466961_0105248 | Ga0466961_0105248_34_1098 | 349 |
| 246 | 3300044706 | Ga0466964_0024558 | Ga0466964_0024558_1094_2155 | 349 |
| 247 | 3300044765 | Ga0466970_0032360 | Ga0466970_0032360_881_1951 | 349 |
| 248 | 3300044765 | Ga0466970_0041837 | Ga0466970_0041837_260_1333 | 349 |
| 249 | 3300044842 | Ga0466957_0174824 | Ga0466957_0174824_116_1189 | 349 |
| 250 | 3300044901 | Ga0466960_0022297 | Ga0466960_0022297_1734_2801 | 349 |
| 251 | 3300045049 | Ga0466959_0017352 | Ga0466959_0017352_558_1631 | 349 |
| 252 | 3300045049 | Ga0466959_0077376 | Ga0466959_0077376_973_2046 | 349 |
| 253 | 3300045049 | Ga0466959_0096681 | Ga0466959_0096681_885_1955 | 349 |
| 254 | 3300045836 | Ga0466958_0003375 | Ga0466958_0003375_151_1212 | 349 |
| 255 | 3300045976 | Ga0466967_0000302 | Ga0466967_0000302_9629_10699 | 349 |
| 256 | 3300045976 | Ga0466967_0010313 | Ga0466967_0010313_5492_6628 | 349 |
| 257 | 3300045976 | Ga0466967_0020756 | Ga0466967_0020756_359_1426 | 349 |
| 258 | 3300045976 | Ga0466967_0024102 | Ga0466967_0024102_2867_3925 | 349 |
| 259 | 3300045976 | Ga0466967_0078012 | Ga0466967_0078012_234_1304 | 349 |
| 260 | 3300048904 | Ga0496101_0008859 | Ga0496101_0008859_3990_5051 | 349 |
| 261 | 3300048905 | Ga0496102_0000013 | Ga0496102_0000013_121261_122322 | 349 |
| 262 | 3300048905 | Ga0496102_0000813 | Ga0496102_0000813_4766_5827 | 349 |
| 263 | 3300048906 | Ga0496103_0000231 | Ga0496103_0000231_36363_37424 | 349 |
| 264 | 3300048911 | Ga0496108_0007000 | Ga0496108_0007000_6952_8088 | 349 |
| 265 | 3300048912 | Ga0496109_0010921 | Ga0496109_0010921_5158_6294 | 349 |
| 266 | 3300048922 | Ga0496119_0000022 | Ga0496119_0000022_145442_146509 | 349 |
| 267 | 3300048923 | Ga0496120_0001552 | Ga0496120_0001552_15254_16321 | 349 |
| 268 | 3300048923 | Ga0496120_0110264 | Ga0496120_0110264_252_1313 | 349 |
| 269 | 3300049568 | Ga0501031_0027192 | Ga0501031_0027192_800_1861 | 349 |
| 270 | 3300049569 | Ga0501032_0035227 | Ga0501032_0035227_578_1639 | 349 |
| 271 | 3300049570 | Ga0501033_0090607 | Ga0501033_0090607_310_1371 | 349 |
| 272 | 3300049574 | Ga0501038_0004045 | Ga0501038_0004045_8459_9520 | 349 |
| 273 | 3300049579 | Ga0501043_0008555 | Ga0501043_0008555_6094_7155 | 349 |
| 274 | 3300049582 | Ga0501048_0004212 | Ga0501048_0004212_4540_5601 | 349 |
| 275 | 3300049586 | Ga0501070_0021783 | Ga0501070_0021783_3558_4619 | 349 |
| 276 | 3300049822 | Ga0501035_0009171 | Ga0501035_0009171_7863_8924 | 349 |
| 277 | 3300049822 | Ga0501035_0240511 | Ga0501035_0240511_356_1417 | 349 |
| 278 | 3300049823 | Ga0501044_0071112 | Ga0501044_0071112_838_1899 | 349 |
| 279 | 3300002067 | JGI24735J21928_10002828 | JGI24735J21928_100028282 | 351 |
| 280 | 3300005435 | Ga0070714_100000126 | Ga0070714_10000012620 | 351 |
| 281 | 3300005614 | Ga0068856_100279464 | Ga0068856_1002794642 | 351 |
| 282 | 3300010375 | Ga0105239_10015801 | Ga0105239_100158014 | 351 |
| 283 | 3300013307 | Ga0157372_10000131 | Ga0157372_1000013127 | 351 |
| 284 | 3300025924 | Ga0207694_10103475 | Ga0207694_101034752 | 351 |
| 285 | 3300026078 | Ga0207702_10225902 | Ga0207702_102259022 | 351 |
| 286 | 3300044694 | Ga0466963_0225647 | Ga0466963_0225647_199_1284 | 351 |
| 287 | 3300045049 | Ga0466959_0034414 | Ga0466959_0034414_1943_3049 | 351 |
| 288 | 3300048929 | Ga0496126_0033125 | Ga0496126_0033125_1544_2614 | 351 |
| 289 | 3300049570 | Ga0501033_0111869 | Ga0501033_0111869_362_1480 | 351 |
| 290 | 3300049743 | Ga0501081_0042899 | Ga0501081_0042899_1295_2374 | 351 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1cli-assembly2.cif.gz_C | x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution | 0.9688 | 11 | 344 |
| 2z01-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus | 0.9626 | 19 | 344 |
| 5vk4-assembly1.cif.gz_A | crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium | 0.958 | 15 | 343 |
| 2btu-assembly1.cif.gz_A | crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. | 0.958 | 15 | 343 |
| 3p4e-assembly1.cif.gz_A-2 | phosphoribosylformylglycinamidine cyclo-ligase from vibrio cholerae | 0.957 | 15 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y4V6_182_356_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9705 | 170 | 339 | 3.90.650.10 |
| af_P00967_819_956_3.30.1330.10 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9597 | 30 | 168 | 3.30.1330.10 |
| af_Q2FZI8_168_339_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9569 | 173 | 341 | 3.90.650.10 |
| af_P07244_618_801_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9567 | 170 | 342 | 3.90.650.10 |
| 2z01A01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9491 | 19 | 168 | 3.30.1330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3CZW9-F1-model_v4 | Phosphoribosylformylglycinamidine cyclo-ligase (AIRS) | 0.986 | 59 | 197 |
GO:0004637
GO:0004641 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A812IPZ7-F1-model_v4 | deleted | 0.9839 | 2 | 335 |
|
| AF-A0A6M0ES26-F1-model_v4 | Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) | 0.9826 | 84 | 341 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A382DN46-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) | 0.9819 | 92 | 344 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A2X1KIL7-F1-model_v4 | Phosphoribosylformylglycinamidine cyclo-ligase (AIRS) | 0.9819 | 51 | 162 |
GO:0004637
GO:0004641 GO:0005829 GO:0006189 GO:0046084 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar