F389888

General Info

Members Datasets Scaffolds Average Seq Length
290 217 580 144

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0114283|Ga0436365_0114283_318_848
Length 176
Sequence MRNPAIATSALRPVRGARAAGFTLIEIMVVXXXXGLLAAVIVPNIVGRVDDARVAKARQDIQALQTALTMYRLDNFKYPTTDQGLLALVQQPADPTIRNWRPGGYVQRGSTKDPWGNDYQYVYPGTHGAEYDLYSFGADGQEGGEGVNADIGNWNLDTNPNAPTGGANGTNGVPNR

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
216 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0
Rhizoplane 8.62
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0114283 3300039437 Bacteria 898
2 SwRhRL2b_contig_2655575 2162886007 Bacteria 3142
3 JGI25406J46586_10025585 3300003203 Bacteria 2289
4 Ga0065714_10386804 3300005288 Bacteria 602
5 Ga0065712_10307072 3300005290 Bacteria 850
6 Ga0065712_10781893 3300005290 Bacteria 512
7 Ga0065707_10082492 3300005295 Bacteria 14544
8 Ga0070658_11854447 3300005327 Bacteria 521
9 Ga0070690_100027545 3300005330 Bacteria 3513
10 Ga0068869_100124747 3300005334 Bacteria 1974
11 Ga0070666_10027956 3300005335 Bacteria 3698
12 Ga0070666_10029158 3300005335 Unclassified 3626
13 Ga0068868_100010120 3300005338 Bacteria 6813
14 Ga0068868_100196730 3300005338 Bacteria 1679
15 Ga0070660_101390600 3300005339 Bacteria 596
16 Ga0070689_101041428 3300005340 Bacteria 729
17 Ga0070692_10908560 3300005345 Bacteria 609
18 Ga0070668_100236933 3300005347 Bacteria 1510
19 Ga0070669_100131851 3300005353 Bacteria 1918
20 Ga0070669_100283927 3300005353 Bacteria 1327
21 Ga0070674_100256266 3300005356 Bacteria 1376
22 Ga0070673_100106615 3300005364 Bacteria 2317
23 Ga0070673_100272559 3300005364 Bacteria 1482
24 Ga0070673_100492599 3300005364 Bacteria 1108
25 Ga0070659_101051054 3300005366 Bacteria 716
26 Ga0070659_101398293 3300005366 Bacteria 622
27 Ga0070667_100000028 3300005367 Bacteria 180376
28 Ga0070667_100002327 3300005367 Bacteria 16631
29 Ga0070667_100068628 3300005367 Bacteria 3017
30 Ga0070709_10082863 3300005434 Bacteria 2097
31 Ga0070714_100021508 3300005435 Bacteria 5279
32 Ga0070713_100035634 3300005436 Bacteria 4008
33 Ga0070711_100011148 3300005439 Bacteria 5575
34 Ga0070711_100500594 3300005439 Bacteria 1002
35 Ga0070678_100126817 3300005456 Bacteria 2022
36 Ga0070678_100411317 3300005456 Bacteria 1177
37 Ga0068867_100058939 3300005459 Bacteria 2845
38 Ga0070672_100194568 3300005543 Bacteria 1694
39 Ga0070695_100419811 3300005545 Bacteria 1018
40 Ga0070693_100023036 3300005547 Bacteria 3322
41 Ga0070665_100034454 3300005548 Bacteria 5091
42 Ga0070665_100343881 3300005548 Bacteria 1497
43 Ga0070704_100297571 3300005549 Bacteria 1343
44 Ga0068854_100209395 3300005578 Bacteria 1537
45 Ga0068854_100932517 3300005578 Bacteria 765
46 Ga0068856_100010087 3300005614 Bacteria 9181
47 Ga0068859_100212481 3300005617 Bacteria 2021
48 Ga0068866_10296483 3300005718 Bacteria 1008
49 Ga0068861_100037036 3300005719 Bacteria 3625
50 Ga0068863_100048264 3300005841 Bacteria 4037
51 Ga0068863_100499491 3300005841 Bacteria 1198
52 Ga0068858_100046996 3300005842 Bacteria 4002
53 Ga0068860_100010949 3300005843 Bacteria 8939
54 Ga0068860_100011728 3300005843 Bacteria 8637
55 Ga0068862_100453313 3300005844 Bacteria 1210
56 Ga0068862_100466626 3300005844 Unclassified 1193
57 Ga0081539_10000060 3300005985 Bacteria 252799
58 Ga0070715_10000980 3300006163 Bacteria 7980
59 Ga0070716_100054222 3300006173 Bacteria 2289
60 Ga0070712_100106149 3300006175 Bacteria 2087
61 Ga0070712_100232690 3300006175 Bacteria 1464
62 Ga0097621_100061293 3300006237 Bacteria 3085
63 Ga0068871_100155843 3300006358 Bacteria 1950
64 Ga0068865_100041104 3300006881 Bacteria 3145
65 Ga0068865_100227971 3300006881 Bacteria 1460
66 Ga0097620_100212477 3300006931 Bacteria 2021
67 Ga0099795_10000014 3300007788 Bacteria 67566
68 Ga0105250_10096226 3300009092 Unclassified 1207
69 Ga0105240_11033491 3300009093 Bacteria 877
70 Ga0111539_11013424 3300009094 Bacteria 965
71 Ga0111539_11275623 3300009094 Bacteria 853
72 Ga0105245_10017070 3300009098 Bacteria 6334
73 Ga0105245_10039365 3300009098 Bacteria 4207
74 Ga0105247_10030266 3300009101 Bacteria 3281
75 Ga0105247_10494839 3300009101 Bacteria 890
76 Ga0105241_10183588 3300009174 Bacteria 1737
77 Ga0105242_10063678 3300009176 Bacteria 3037
78 Ga0105242_10206032 3300009176 Bacteria 1749
79 Ga0105248_10024532 3300009177 Bacteria 6705
80 Ga0105248_10476363 3300009177 Bacteria 1407
81 Ga0105238_10150428 3300009551 Bacteria 2303
82 Ga0105238_10446970 3300009551 Bacteria 1289
83 Ga0105249_10072991 3300009553 Bacteria 3173
84 Ga0099796_10000054 3300010159 Bacteria 20546
85 Ga0105239_10441271 3300010375 Bacteria 1476
86 Ga0105246_11146186 3300011119 Bacteria 713
87 Ga0157374_10011423 3300013296 Bacteria 7688
88 Ga0157374_10270082 3300013296 Bacteria 1677
89 Ga0157378_10100192 3300013297 Bacteria 2644
90 Ga0157378_10140237 3300013297 Bacteria 2244
91 Ga0157378_10142745 3300013297 Bacteria 2225
92 Ga0163162_10004661 3300013306 Bacteria 13218
93 Ga0163162_10042037 3300013306 Bacteria 4573
94 Ga0157375_10007303 3300013308 Bacteria 9670
95 Ga0157375_10080369 3300013308 Bacteria 3298
96 Ga0157375_11578522 3300013308 Bacteria 776
97 Ga0163163_10085051 3300014325 Bacteria 3171
98 Ga0163163_10401573 3300014325 Bacteria 1429
99 Ga0163163_10657215 3300014325 Bacteria 1112
100 Ga0157380_10003317 3300014326 Bacteria 11043
101 Ga0157379_10010122 3300014968 Bacteria 8220
102 Ga0157379_10126952 3300014968 Bacteria 2295
103 Ga0157379_10145335 3300014968 Bacteria 2138
104 Ga0157379_10329658 3300014968 Bacteria 1395
105 Ga0157376_10001973 3300014969 Bacteria 13726
106 Ga0157376_10534944 3300014969 Bacteria 1157
107 Ga0213873_10039631 3300021358 Bacteria 1208
108 Ga0213876_10156147 3300021384 Bacteria 1214
109 Ga0207692_10096848 3300025898 Bacteria 1612
110 Ga0207642_10061437 3300025899 Bacteria 1747
111 Ga0207710_10612617 3300025900 Bacteria 569
112 Ga0207680_10211331 3300025903 Bacteria 1326
113 Ga0207680_10664748 3300025903 Bacteria 746
114 Ga0207685_10157902 3300025905 Bacteria 1033
115 Ga0207645_10069458 3300025907 Bacteria 2253
116 Ga0207645_11111546 3300025907 Bacteria 533
117 Ga0207705_11373996 3300025909 Bacteria 538
118 Ga0207654_10080775 3300025911 Bacteria 1956
119 Ga0207695_10471256 3300025913 Bacteria 1138
120 Ga0207693_10000300 3300025915 Bacteria 46109
121 Ga0207663_10395099 3300025916 Bacteria 1056
122 Ga0207657_10665849 3300025919 Bacteria 810
123 Ga0207650_10095821 3300025925 Bacteria 2275
124 Ga0207687_10029800 3300025927 Bacteria 3673
125 Ga0207700_10251103 3300025928 Bacteria 1511
126 Ga0207664_10305605 3300025929 Bacteria 1400
127 Ga0207644_10726991 3300025931 Bacteria 828
128 Ga0207686_10139547 3300025934 Bacteria 1673
129 Ga0207686_11599812 3300025934 Bacteria 538
130 Ga0207704_10127962 3300025938 Bacteria 1753
131 Ga0207704_10490980 3300025938 Bacteria 988
132 Ga0207665_10006408 3300025939 Bacteria 7808
133 Ga0207691_10013881 3300025940 Bacteria 7688
134 Ga0207711_10019422 3300025941 Bacteria 5659
135 Ga0207711_10162413 3300025941 Bacteria 2023
136 Ga0207689_10456731 3300025942 Bacteria 1068
137 Ga0207712_10043342 3300025961 Bacteria 3103
138 Ga0207658_10050062 3300025986 Bacteria 3072
139 Ga0207677_10198546 3300026023 Bacteria 1592
140 Ga0207703_10012585 3300026035 Bacteria 6595
141 Ga0207702_11334741 3300026078 Bacteria 711
142 Ga0207641_10018146 3300026088 Bacteria 5766
143 Ga0207641_10238482 3300026088 Bacteria 1693
144 Ga0207641_10497217 3300026088 Bacteria 1184
145 Ga0207648_10052332 3300026089 Bacteria 3570
146 Ga0207676_10132898 3300026095 Bacteria 2119
147 Ga0207676_10298357 3300026095 Bacteria 1470
148 Ga0207675_100048320 3300026118 Bacteria 3972
149 Ga0207683_10082598 3300026121 Bacteria 2854
150 Ga0207683_10435095 3300026121 Bacteria 1209
151 Ga0209179_1000013 3300027512 Bacteria 62144
152 Ga0268266_10068777 3300028379 Bacteria 3067
153 Ga0268265_10011346 3300028380 Bacteria 6027
154 Ga0268265_10421555 3300028380 Bacteria 1239
155 Ga0268264_10047526 3300028381 Bacteria 3568
156 Ga0268264_10184133 3300028381 Bacteria 1899
157 Ga0265326_10043460 3300028558 Bacteria 1275
158 Ga0265334_10000127 3300028573 Bacteria 48527
159 Ga0265318_10000024 3300028577 Bacteria 159801
160 Ga0307515_10016258 3300028794 Bacteria 13637
161 Ga0265338_10028206 3300028800 Bacteria 5605
162 Ga0265338_10069775 3300028800 Bacteria 3017
163 Ga0265338_10098521 3300028800 Bacteria 2391
164 Ga0265324_10219356 3300029957 Bacteria 646
165 Ga0265330_10026304 3300031235 Bacteria 2632
166 Ga0265332_10005167 3300031238 Bacteria 6041
167 Ga0265328_10010066 3300031239 Bacteria 3822
168 Ga0265320_10005045 3300031240 Bacteria 8549
169 Ga0265325_10005133 3300031241 Bacteria 8144
170 Ga0265329_10005521 3300031242 Bacteria 5101
171 Ga0265339_10023115 3300031249 Bacteria 3596
172 Ga0265331_10005948 3300031250 Bacteria 7282
173 Ga0307513_10799509 3300031456 Bacteria 649
174 Ga0265313_10004752 3300031595 Bacteria 10242
175 Ga0265314_10001695 3300031711 Bacteria 23953
176 Ga0265342_10002999 3300031712 Bacteria 14168
177 Ga0307516_10590101 3300031730 Bacteria 765
178 Ga0307413_11157161 3300031824 Bacteria 671
179 Ga0307410_10875325 3300031852 Bacteria 768
180 Ga0307407_10202409 3300031903 Unclassified 1331
181 Ga0307407_10240373 3300031903 Bacteria 1235
182 Ga0307412_10291860 3300031911 Bacteria 1285
183 Ga0307415_102160707 3300032126 Bacteria 544
184 Ga0307507_10432744 3300033179 Bacteria 734
185 Ga0373934_0199419 3300035086 Bacteria 824
186 Ga0373945_0356336 3300035116 Bacteria 635
187 Ga0373956_0111031 3300035119 Bacteria 1276
188 Ga0373956_0396088 3300035119 Bacteria 659
189 Ga0373946_0296060 3300035171 Bacteria 799
190 Ga0316574_0142769 3300035398 Bacteria 1543
191 Ga0316574_0224824 3300035398 Bacteria 1202
192 Ga0373927_0231747 3300035695 Bacteria 1213
193 Ga0373947_0024152 3300035725 Bacteria 3540
194 Ga0373937_0050888 3300036401 Bacteria 3796
195 Ga0373937_0175888 3300036401 Bacteria 2009
196 Ga0316584_0102873 3300036712 Bacteria 2139
197 Ga0316584_0295702 3300036712 Bacteria 1174
198 Ga0373925_0072161 3300037068 Bacteria 2612
199 Ga0395905_0364616 3300037471 Bacteria 1338
200 Ga0436365_0174528 3300039437 Bacteria 2868
201 Ga0436360_0476262 3300039438 Bacteria 3469
202 Ga0436360_0772510 3300039438 Bacteria 755
203 Ga0436363_0307133 3300039450 Bacteria 565
204 Ga0436363_1087853 3300039450 Bacteria 2618
205 Ga0436363_1196777 3300039450 Bacteria 721
206 Ga0451793_0602092 3300041452 Bacteria 537
207 Ga0451807_2116114 3300041486 Bacteria 1059
208 Ga0451839_0832714 3300041496 Bacteria 566
209 Ga0450895_013014 3300042132 Bacteria 728
210 Ga0466972_0035443 3300044658 Bacteria 2442
211 Ga0466960_0643690 3300044901 Bacteria 632
212 Ga0495653_0785976 3300046463 Bacteria 573
213 Ga0495580_0055514 3300046472 Bacteria 2791
214 Ga0495580_0085095 3300046472 Bacteria 2203
215 Ga0495594_0091519 3300046499 Bacteria 1705
216 Ga0495583_0042670 3300046506 Bacteria 2117
217 Ga0495618_0122196 3300046514 Bacteria 1668
218 Ga0495628_0233315 3300046516 Bacteria 1379
219 Ga0495644_0096715 3300046523 Bacteria 1116
220 Ga0495665_0049443 3300046531 Bacteria 2230
221 Ga0495587_0225976 3300046536 Bacteria 1055
222 Ga0495621_0002379 3300046539 Bacteria 5059
223 Ga0495645_0591503 3300046543 Bacteria 683
224 Ga0495611_0166036 3300046648 Unclassified 1032
225 Ga0495623_0302861 3300046679 Bacteria 883
226 Ga0495647_0017469 3300046681 Unclassified 2539
227 Ga0495658_0053681 3300046683 Bacteria 2290
228 Ga0495658_0224035 3300046683 Bacteria 1178
229 Ga0495670_0253771 3300046691 Bacteria 938
230 Ga0495600_0527141 3300046809 Bacteria 724
231 Ga0495581_0898363 3300047315 Bacteria 506
232 Ga0495604_0039540 3300047317 Bacteria 3707
233 Ga0495675_0120484 3300047444 Bacteria 1634
234 Ga0495677_0307320 3300047445 Bacteria 624
235 Ga0495673_0269073 3300047469 Bacteria 618
236 Ga0495602_0131408 3300048088 Bacteria 1996
237 Ga0496100_0067703 3300048903 Bacteria 2372
238 Ga0496100_0638358 3300048903 Bacteria 828
239 Ga0496101_0123853 3300048904 Bacteria 1957
240 Ga0496102_0010612 3300048905 Bacteria 7935
241 Ga0496103_0178664 3300048906 Bacteria 1364
242 Ga0496104_0008009 3300048907 Bacteria 9369
243 Ga0496104_0086011 3300048907 Bacteria 3001
244 Ga0496105_0024568 3300048908 Bacteria 4897
245 Ga0496105_0115645 3300048908 Bacteria 2212
246 Ga0496106_0149044 3300048909 Bacteria 1844
247 Ga0496106_0197091 3300048909 Bacteria 1602
248 Ga0496107_0007412 3300048910 Bacteria 7562
249 Ga0496107_0728603 3300048910 Bacteria 728
250 Ga0496108_0002025 3300048911 Bacteria 16226
251 Ga0496109_0024614 3300048912 Bacteria 5353
252 Ga0496110_0022856 3300048913 Bacteria 5313
253 Ga0496110_0042400 3300048913 Bacteria 3971
254 Ga0496111_0014103 3300048914 Bacteria 5451
255 Ga0496111_0027869 3300048914 Bacteria 4000
256 Ga0496112_0650789 3300048915 Bacteria 983
257 Ga0496113_0072279 3300048916 Bacteria 2625
258 Ga0496114_0054419 3300048917 Bacteria 3337
259 Ga0496115_0048044 3300048918 Bacteria 3413
260 Ga0501041_0214438 3300049577 Bacteria 1208
261 Ga0501042_0333045 3300049578 Bacteria 1097
262 Ga0501042_0541176 3300049578 Bacteria 846
263 Ga0501047_0103956 3300049581 Bacteria 2721
264 Ga0501081_0476554 3300049743 Bacteria 929
265 Ga0501083_0479165 3300049744 Unclassified 810
266 nmdc:mga0k408_783371_c1 3300050493 Bacteria 556
267 nmdc:mga0rr50_621540_c1 3300050513 Bacteria 921
268 Ga0495601_0713004 3300053077 Bacteria 640
269 Ga0500646_0023170 3300053090 Bacteria 1664
270 Ga0500583_0001580 3300053092 Bacteria 6603
271 Ga0500583_0015022 3300053092 Bacteria 3052
272 Ga0500641_0048371 3300053096 Bacteria 1742
273 Ga0500641_0211998 3300053096 Bacteria 824
274 Ga0500556_0000374 3300053104 Bacteria 32602
275 Ga0500562_011524 3300053108 Bacteria 2245
276 Ga0500569_340409 3300053109 Bacteria 500
277 Ga0500594_0084914 3300053118 Bacteria 953
278 Ga0500617_086802 3300053124 Bacteria 1346
279 Ga0500642_0064008 3300053130 Bacteria 1659
280 Ga0500658_0022271 3300053134 Bacteria 2407
281 Ga0500658_0423419 3300053134 Bacteria 608
282 Ga0500568_0086776 3300053139 Bacteria 1183
283 Ga0500568_0243359 3300053139 Bacteria 655
284 Ga0500588_0000365 3300053146 Bacteria 6959
285 Ga0500588_0422438 3300053146 Bacteria 508
286 Ga0500616_0000016 3300053153 Bacteria 627087
287 Ga0500622_0023198 3300053156 Bacteria 3287
288 Ga0500633_0165527 3300053160 Bacteria 830
289 Ga0500611_000403 3300053727 Bacteria 4394
290 Ga0501084_0845056 3300054114 Bacteria 770
291 Ga0436365_0114283
292 SwRhRL2b_contig_2655575
293 JGI25406J46586_10025585
294 Ga0065714_10386804
295 Ga0065712_10307072
296 Ga0065712_10781893
297 Ga0065707_10082492
298 Ga0070658_11854447
299 Ga0070690_100027545
300 Ga0068869_100124747
301 Ga0070666_10027956
302 Ga0070666_10029158
303 Ga0068868_100010120
304 Ga0068868_100196730
305 Ga0070660_101390600
306 Ga0070689_101041428
307 Ga0070692_10908560
308 Ga0070668_100236933
309 Ga0070669_100131851
310 Ga0070669_100283927
311 Ga0070674_100256266
312 Ga0070673_100106615
313 Ga0070673_100272559
314 Ga0070673_100492599
315 Ga0070659_101051054
316 Ga0070659_101398293
317 Ga0070667_100000028
318 Ga0070667_100002327
319 Ga0070667_100068628
320 Ga0070709_10082863
321 Ga0070714_100021508
322 Ga0070713_100035634
323 Ga0070711_100011148
324 Ga0070711_100500594
325 Ga0070678_100126817
326 Ga0070678_100411317
327 Ga0068867_100058939
328 Ga0070672_100194568
329 Ga0070695_100419811
330 Ga0070693_100023036
331 Ga0070665_100034454
332 Ga0070665_100343881
333 Ga0070704_100297571
334 Ga0068854_100209395
335 Ga0068854_100932517
336 Ga0068856_100010087
337 Ga0068859_100212481
338 Ga0068866_10296483
339 Ga0068861_100037036
340 Ga0068863_100048264
341 Ga0068863_100499491
342 Ga0068858_100046996
343 Ga0068860_100010949
344 Ga0068860_100011728
345 Ga0068862_100453313
346 Ga0068862_100466626
347 Ga0081539_10000060
348 Ga0070715_10000980
349 Ga0070716_100054222
350 Ga0070712_100106149
351 Ga0070712_100232690
352 Ga0097621_100061293
353 Ga0068871_100155843
354 Ga0068865_100041104
355 Ga0068865_100227971
356 Ga0097620_100212477
357 Ga0099795_10000014
358 Ga0105250_10096226
359 Ga0105240_11033491
360 Ga0111539_11013424
361 Ga0111539_11275623
362 Ga0105245_10017070
363 Ga0105245_10039365
364 Ga0105247_10030266
365 Ga0105247_10494839
366 Ga0105241_10183588
367 Ga0105242_10063678
368 Ga0105242_10206032
369 Ga0105248_10024532
370 Ga0105248_10476363
371 Ga0105238_10150428
372 Ga0105238_10446970
373 Ga0105249_10072991
374 Ga0099796_10000054
375 Ga0105239_10441271
376 Ga0105246_11146186
377 Ga0157374_10011423
378 Ga0157374_10270082
379 Ga0157378_10100192
380 Ga0157378_10140237
381 Ga0157378_10142745
382 Ga0163162_10004661
383 Ga0163162_10042037
384 Ga0157375_10007303
385 Ga0157375_10080369
386 Ga0157375_11578522
387 Ga0163163_10085051
388 Ga0163163_10401573
389 Ga0163163_10657215
390 Ga0157380_10003317
391 Ga0157379_10010122
392 Ga0157379_10126952
393 Ga0157379_10145335
394 Ga0157379_10329658
395 Ga0157376_10001973
396 Ga0157376_10534944
397 Ga0213873_10039631
398 Ga0213876_10156147
399 Ga0207692_10096848
400 Ga0207642_10061437
401 Ga0207710_10612617
402 Ga0207680_10211331
403 Ga0207680_10664748
404 Ga0207685_10157902
405 Ga0207645_10069458
406 Ga0207645_11111546
407 Ga0207705_11373996
408 Ga0207654_10080775
409 Ga0207695_10471256
410 Ga0207693_10000300
411 Ga0207663_10395099
412 Ga0207657_10665849
413 Ga0207650_10095821
414 Ga0207687_10029800
415 Ga0207700_10251103
416 Ga0207664_10305605
417 Ga0207644_10726991
418 Ga0207686_10139547
419 Ga0207686_11599812
420 Ga0207704_10127962
421 Ga0207704_10490980
422 Ga0207665_10006408
423 Ga0207691_10013881
424 Ga0207711_10019422
425 Ga0207711_10162413
426 Ga0207689_10456731
427 Ga0207712_10043342
428 Ga0207658_10050062
429 Ga0207677_10198546
430 Ga0207703_10012585
431 Ga0207702_11334741
432 Ga0207641_10018146
433 Ga0207641_10238482
434 Ga0207641_10497217
435 Ga0207648_10052332
436 Ga0207676_10132898
437 Ga0207676_10298357
438 Ga0207675_100048320
439 Ga0207683_10082598
440 Ga0207683_10435095
441 Ga0209179_1000013
442 Ga0268266_10068777
443 Ga0268265_10011346
444 Ga0268265_10421555
445 Ga0268264_10047526
446 Ga0268264_10184133
447 Ga0265326_10043460
448 Ga0265334_10000127
449 Ga0265318_10000024
450 Ga0307515_10016258
451 Ga0265338_10028206
452 Ga0265338_10069775
453 Ga0265338_10098521
454 Ga0265324_10219356
455 Ga0265330_10026304
456 Ga0265332_10005167
457 Ga0265328_10010066
458 Ga0265320_10005045
459 Ga0265325_10005133
460 Ga0265329_10005521
461 Ga0265339_10023115
462 Ga0265331_10005948
463 Ga0307513_10799509
464 Ga0265313_10004752
465 Ga0265314_10001695
466 Ga0265342_10002999
467 Ga0307516_10590101
468 Ga0307413_11157161
469 Ga0307410_10875325
470 Ga0307407_10202409
471 Ga0307407_10240373
472 Ga0307412_10291860
473 Ga0307415_102160707
474 Ga0307507_10432744
475 Ga0373934_0199419
476 Ga0373945_0356336
477 Ga0373956_0111031
478 Ga0373956_0396088
479 Ga0373946_0296060
480 Ga0316574_0142769
481 Ga0316574_0224824
482 Ga0373927_0231747
483 Ga0373947_0024152
484 Ga0373937_0050888
485 Ga0373937_0175888
486 Ga0316584_0102873
487 Ga0316584_0295702
488 Ga0373925_0072161
489 Ga0395905_0364616
490 Ga0436365_0174528
491 Ga0436360_0476262
492 Ga0436360_0772510
493 Ga0436363_0307133
494 Ga0436363_1087853
495 Ga0436363_1196777
496 Ga0451793_0602092
497 Ga0451807_2116114
498 Ga0451839_0832714
499 Ga0450895_013014
500 Ga0466972_0035443
501 Ga0466960_0643690
502 Ga0495653_0785976
503 Ga0495580_0055514
504 Ga0495580_0085095
505 Ga0495594_0091519
506 Ga0495583_0042670
507 Ga0495618_0122196
508 Ga0495628_0233315
509 Ga0495644_0096715
510 Ga0495665_0049443
511 Ga0495587_0225976
512 Ga0495621_0002379
513 Ga0495645_0591503
514 Ga0495611_0166036
515 Ga0495623_0302861
516 Ga0495647_0017469
517 Ga0495658_0053681
518 Ga0495658_0224035
519 Ga0495670_0253771
520 Ga0495600_0527141
521 Ga0495581_0898363
522 Ga0495604_0039540
523 Ga0495675_0120484
524 Ga0495677_0307320
525 Ga0495673_0269073
526 Ga0495602_0131408
527 Ga0496100_0067703
528 Ga0496100_0638358
529 Ga0496101_0123853
530 Ga0496102_0010612
531 Ga0496103_0178664
532 Ga0496104_0008009
533 Ga0496104_0086011
534 Ga0496105_0024568
535 Ga0496105_0115645
536 Ga0496106_0149044
537 Ga0496106_0197091
538 Ga0496107_0007412
539 Ga0496107_0728603
540 Ga0496108_0002025
541 Ga0496109_0024614
542 Ga0496110_0022856
543 Ga0496110_0042400
544 Ga0496111_0014103
545 Ga0496111_0027869
546 Ga0496112_0650789
547 Ga0496113_0072279
548 Ga0496114_0054419
549 Ga0496115_0048044
550 Ga0501041_0214438
551 Ga0501042_0333045
552 Ga0501042_0541176
553 Ga0501047_0103956
554 Ga0501081_0476554
555 Ga0501083_0479165
556 nmdc:mga0k408_783371_c1
557 nmdc:mga0rr50_621540_c1
558 Ga0495601_0713004
559 Ga0500646_0023170
560 Ga0500583_0001580
561 Ga0500583_0015022
562 Ga0500641_0048371
563 Ga0500641_0211998
564 Ga0500556_0000374
565 Ga0500562_011524
566 Ga0500569_340409
567 Ga0500594_0084914
568 Ga0500617_086802
569 Ga0500642_0064008
570 Ga0500658_0022271
571 Ga0500658_0423419
572 Ga0500568_0086776
573 Ga0500568_0243359
574 Ga0500588_0000365
575 Ga0500588_0422438
576 Ga0500616_0000016
577 Ga0500622_0023198
578 Ga0500633_0165527
579 Ga0500611_000403
580 Ga0501084_0845056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08334

T2SSG

Type II secretion system (T2SS), protein G

44

154

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lw9-assembly1.cif.gz_A crystal structure of vibrio cholera major pseudopilin epsg 0.978 69 174
3fu1-assembly1.cif.gz_B crystal structure of the major pseudopilin from the type 2 secretion system of vibrio cholerae 0.976 69 175
3gn9-assembly3.cif.gz_C crystal structure of the major pseudopilin from the type 2 secretion system of vibrio vulnificus 0.9735 69 175
4lw9-assembly6.cif.gz_F crystal structure of vibrio cholera major pseudopilin epsg 0.9714 72 174
3gn9-assembly3.cif.gz_C crystal structure of the major pseudopilin from the type 2 secretion system of vibrio vulnificus 0.9222 69 175
ID Description Score Start End Superfamily
3fu1A01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.977 69 172 3.30.700.10
1t92B01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.9164 67 171 3.30.700.10
3fu1A01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.9158 69 172 3.30.700.10
1t92B01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8901 67 171 3.30.700.10
2kepA01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.7524 69 172 3.30.700.10
ID Description Score Start End GO Terms
AF-A0A7V5XEJ9-F1-model_v4 Type II secretion system protein GspG 0.9789 73 173 GO:0005886
GO:0015627
GO:0015628
AF-A0A808JYE1-F1-model_v4 deleted 0.9754 66 173
AF-A0A1N7ST88-F1-model_v4 Pseudopilin, cryptic, general secretion pathway 0.9719 67 173 GO:0005886
GO:0015627
GO:0015628
AF-A0A356HIY8-F1-model_v4 deleted 0.9704 69 171
AF-A0A7I8C259-F1-model_v4 Type II secretion system protein GspG 0.9703 69 173 GO:0005886
GO:0015627
GO:0015628

Map