F389887

General Info

Members Datasets Scaffolds Average Seq Length
290 167 580 216

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0678006|Ga0395901_0678006_93_758
Length 221
Sequence MSSPSTHADPHASQPIRHAGPAPEHAASTLILVHGRGADAEGMLELFDELKLPDTVAAIAPQAAGHTWYPYSFLEPMELNQPYLDSALRRLGSIVDDLTGRGVPAERIALLGFSQGACLAPEFAARNARRYGAVMGLSGGLIGPPGTPRNYAGSLDGTPVFLGSSDVDPHVPYARVRETADVFQRMNAAVDLRIYPGMPHTINQDEFDACRALLERLAGQT

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 8.28
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 12.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0678006 3300038443 Bacteria 1031
2 Ga0065714_10255686 3300005288 Unclassified 766
3 Ga0065712_10079017 3300005290 Bacteria 3270
4 Ga0065712_10101570 3300005290 Bacteria 2031
5 Ga0065712_10203576 3300005290 Bacteria 1099
6 Ga0065715_10135716 3300005293 Bacteria 1934
7 Ga0070683_100003346 3300005329 Bacteria 12977
8 Ga0070683_100026577 3300005329 Bacteria 5214
9 Ga0070670_100007567 3300005331 Bacteria 9218
10 Ga0070670_100027822 3300005331 Bacteria 4864
11 Ga0070666_10069786 3300005335 Unclassified 2390
12 Ga0068868_100142128 3300005338 Bacteria 1971
13 Ga0068868_100286722 3300005338 Archaea 1395
14 Ga0070660_100503965 3300005339 Bacteria 1007
15 Ga0070661_100045232 3300005344 Bacteria 3218
16 Ga0070668_100485776 3300005347 Bacteria 1067
17 Ga0070669_100000065 3300005353 Bacteria 105999
18 Ga0070675_100021100 3300005354 Bacteria 5202
19 Ga0070671_100173335 3300005355 Bacteria 1825
20 Ga0070674_100230923 3300005356 Bacteria 1444
21 Ga0070688_100022963 3300005365 Bacteria 3663
22 Ga0070688_100548807 3300005365 Unclassified 878
23 Ga0070667_100013901 3300005367 Bacteria 6655
24 Ga0070710_10382911 3300005437 Bacteria 939
25 Ga0070700_100066052 3300005441 Bacteria 2295
26 Ga0070663_100015014 3300005455 Bacteria 4983
27 Ga0070678_100013633 3300005456 Bacteria 5106
28 Ga0070678_100039158 3300005456 Bacteria 3342
29 Ga0070662_100017946 3300005457 Bacteria 4778
30 Ga0068867_100505477 3300005459 Bacteria 1039
31 Ga0070685_10254634 3300005466 Bacteria 1164
32 Ga0070698_100355482 3300005471 Bacteria 1397
33 Ga0070699_100098767 3300005518 Bacteria 2558
34 Ga0070684_100002450 3300005535 Bacteria 13671
35 Ga0070672_100544742 3300005543 Bacteria 1007
36 Ga0070686_100232533 3300005544 Bacteria 1338
37 Ga0070686_100456625 3300005544 Bacteria 983
38 Ga0070665_100001056 3300005548 Bacteria 34472
39 Ga0070665_100004906 3300005548 Bacteria 13873
40 Ga0070665_100050265 3300005548 Bacteria 4183
41 Ga0070665_100404613 3300005548 Bacteria 1373
42 Ga0070664_100001232 3300005564 Bacteria 20476
43 Ga0070664_100534588 3300005564 Bacteria 1083
44 Ga0070664_100724930 3300005564 Bacteria 927
45 Ga0070702_100454878 3300005615 Bacteria 930
46 Ga0068859_100342906 3300005617 Bacteria 1588
47 Ga0068859_100822028 3300005617 Unclassified 1016
48 Ga0068859_100972931 3300005617 Archaea 931
49 Ga0068864_100000473 3300005618 Bacteria 34861
50 Ga0068864_100020287 3300005618 Bacteria 5560
51 Ga0068851_10304999 3300005834 Bacteria 916
52 Ga0068863_100062315 3300005841 Bacteria 3527
53 Ga0068863_100079664 3300005841 Bacteria 3102
54 Ga0068858_100046901 3300005842 Bacteria 4006
55 Ga0068858_100627220 3300005842 Bacteria 1044
56 Ga0068858_100783720 3300005842 Bacteria 930
57 Ga0068862_100066643 3300005844 Bacteria 3103
58 Ga0068862_100090752 3300005844 Unclassified 2660
59 Ga0068862_100687759 3300005844 Bacteria 990
60 Ga0070717_10284877 3300006028 Bacteria 1466
61 Ga0075367_10126210 3300006178 Archaea 1579
62 Ga0075366_10071293 3300006195 Bacteria 2070
63 Ga0068871_100348491 3300006358 Bacteria 1309
64 Ga0075428_100003643 3300006844 Bacteria 16890
65 Ga0075428_100313281 3300006844 Unclassified 1687
66 Ga0075428_100883665 3300006844 Unclassified 948
67 Ga0075430_100006311 3300006846 Bacteria 10000
68 Ga0075431_100001487 3300006847 Bacteria 21652
69 Ga0075431_100341388 3300006847 Bacteria 1507
70 Ga0075433_10004837 3300006852 Bacteria 10528
71 Ga0075433_10004979 3300006852 Bacteria 10402
72 Ga0075433_10034772 3300006852 Bacteria 4330
73 Ga0075433_10120661 3300006852 Bacteria 2328
74 Ga0075433_10398290 3300006852 Unclassified 1215
75 Ga0075434_100031064 3300006871 Bacteria 5264
76 Ga0075429_100002658 3300006880 Bacteria 15038
77 Ga0075429_100800864 3300006880 Bacteria 825
78 Ga0068865_100157491 3300006881 Bacteria 1729
79 Ga0068865_100375007 3300006881 Bacteria 1159
80 Ga0097620_100342925 3300006931 Bacteria 1588
81 Ga0097620_100821880 3300006931 Unclassified 1016
82 Ga0097620_100973215 3300006931 Archaea 931
83 Ga0111539_10045440 3300009094 Bacteria 5257
84 Ga0111539_10153235 3300009094 Bacteria 2697
85 Ga0111539_10261192 3300009094 Bacteria 2016
86 Ga0111539_10376412 3300009094 Bacteria 1653
87 Ga0105245_10252627 3300009098 Bacteria 1713
88 Ga0105245_10470747 3300009098 Unclassified 1268
89 Ga0114129_10367526 3300009147 Bacteria 1902
90 Ga0105242_10362650 3300009176 Bacteria 1342
91 Ga0105248_10015653 3300009177 Bacteria 8358
92 Ga0105248_10079995 3300009177 Bacteria 3673
93 Ga0105248_10199801 3300009177 Bacteria 2253
94 Ga0105248_10408914 3300009177 Bacteria 1528
95 Ga0105248_11515450 3300009177 Unclassified 759
96 Ga0105249_10119082 3300009553 Bacteria 2507
97 Ga0105249_10206613 3300009553 Bacteria 1924
98 Ga0105249_10594288 3300009553 Bacteria 1161
99 Ga0157374_10031631 3300013296 Bacteria 4812
100 Ga0157374_10254276 3300013296 Bacteria 1729
101 Ga0157374_10741198 3300013296 Bacteria 997
102 Ga0157378_10125069 3300013297 Bacteria 2375
103 Ga0163162_10128001 3300013306 Bacteria 2647
104 Ga0157375_10317279 3300013308 Bacteria 1723
105 Ga0163163_10006113 3300014325 Bacteria 10484
106 Ga0157380_10303595 3300014326 Bacteria 1472
107 Ga0157379_10067574 3300014968 Bacteria 3195
108 Ga0157379_10370393 3300014968 Bacteria 1313
109 Ga0157376_10044740 3300014969 Bacteria 3640
110 Ga0207697_10005597 3300025315 Bacteria 5816
111 Ga0207710_10143811 3300025900 Bacteria 1153
112 Ga0207680_10359567 3300025903 Bacteria 1024
113 Ga0207662_10244044 3300025918 Bacteria 1177
114 Ga0207662_10380014 3300025918 Unclassified 954
115 Ga0207649_10101832 3300025920 Bacteria 1902
116 Ga0207681_10000021 3300025923 Bacteria 236982
117 Ga0207681_10081185 3300025923 Bacteria 2289
118 Ga0207650_10009649 3300025925 Bacteria 6598
119 Ga0207650_10116452 3300025925 Bacteria 2075
120 Ga0207659_10242695 3300025926 Bacteria 1458
121 Ga0207659_10672958 3300025926 Unclassified 885
122 Ga0207687_10333710 3300025927 Bacteria 1231
123 Ga0207686_10263971 3300025934 Unclassified 1264
124 Ga0207704_10092230 3300025938 Bacteria 1993
125 Ga0207704_10504025 3300025938 Bacteria 976
126 Ga0207691_10357659 3300025940 Bacteria 1249
127 Ga0207691_10482020 3300025940 Bacteria 1054
128 Ga0207691_10618737 3300025940 Bacteria 916
129 Ga0207711_10019885 3300025941 Bacteria 5596
130 Ga0207711_10101063 3300025941 Bacteria 2552
131 Ga0207711_10365851 3300025941 Bacteria 1337
132 Ga0207679_10068729 3300025945 Bacteria 2662
133 Ga0207679_10076100 3300025945 Unclassified 2549
134 Ga0207679_10755837 3300025945 Bacteria 884
135 Ga0207712_10043708 3300025961 Bacteria 3092
136 Ga0207712_10406045 3300025961 Bacteria 1146
137 Ga0207658_10073907 3300025986 Bacteria 2589
138 Ga0207677_10078397 3300026023 Bacteria 2359
139 Ga0207677_10132840 3300026023 Bacteria 1893
140 Ga0207703_10171570 3300026035 Bacteria 1908
141 Ga0207678_10076098 3300026067 Bacteria 2875
142 Ga0207678_10597788 3300026067 Bacteria 967
143 Ga0207641_10119845 3300026088 Bacteria 2346
144 Ga0207641_10172003 3300026088 Bacteria 1978
145 Ga0207648_10069786 3300026089 Bacteria 3062
146 Ga0207676_10095557 3300026095 Bacteria 2451
147 Ga0207676_10210226 3300026095 Bacteria 1725
148 Ga0207675_100026389 3300026118 Bacteria 5408
149 Ga0207683_10190210 3300026121 Bacteria 1863
150 Ga0207428_10009694 3300027907 Bacteria 8629
151 Ga0268266_10000188 3300028379 Bacteria 109326
152 Ga0268266_10006639 3300028379 Bacteria 10557
153 Ga0268265_10075953 3300028380 Bacteria 2634
154 Ga0268265_10217890 3300028380 Unclassified 1668
155 Ga0268264_10502621 3300028381 Unclassified 1183
156 Ga0268264_10506214 3300028381 Bacteria 1178
157 Ga0265330_10096892 3300031235 Bacteria 1264
158 Ga0307408_100006841 3300031548 Bacteria 7560
159 Ga0307408_100126291 3300031548 Bacteria 1990
160 Ga0307408_100252875 3300031548 Archaea 1454
161 Ga0316579_10094319 3300031691 Unclassified 1430
162 Ga0307405_10621124 3300031731 Unclassified 885
163 Ga0316577_10068486 3300031733 Unclassified 1982
164 Ga0307413_10148777 3300031824 Bacteria 1629
165 Ga0307406_10139883 3300031901 Archaea 1712
166 Ga0307407_10057151 3300031903 Bacteria 2262
167 Ga0307412_10039472 3300031911 Bacteria 3048
168 Ga0307412_10606428 3300031911 Archaea 928
169 Ga0307409_100077363 3300031995 Bacteria 2672
170 Ga0307409_100558835 3300031995 Bacteria 1125
171 Ga0307409_100602671 3300031995 Bacteria 1086
172 Ga0307416_100131598 3300032002 Unclassified 2253
173 Ga0307416_100303415 3300032002 Bacteria 1588
174 Ga0307416_100351259 3300032002 Bacteria 1492
175 Ga0307416_100737839 3300032002 Bacteria 1077
176 Ga0307411_10173209 3300032005 Unclassified 1630
177 Ga0307411_10380875 3300032005 Bacteria 1160
178 Ga0307411_10858865 3300032005 Archaea 803
179 Ga0307415_100443762 3300032126 Archaea 1120
180 Ga0373943_0162208 3300035170 Archaea 1218
181 Ga0373955_0300531 3300035172 Bacteria 968
182 Ga0373937_0099535 3300036401 Bacteria 2697
183 Ga0316582_0072399 3300036647 Bacteria 2234
184 Ga0316584_0019459 3300036712 Bacteria 4909
185 Ga0436362_0630352 3300039453 Bacteria 1589
186 Ga0439436_0046802 3300041404 Bacteria 1229
187 Ga0439446_0009165 3300042156 Bacteria 2644
188 Ga0439446_0028133 3300042156 Unclassified 1617
189 Ga0495608_0438992 3300046511 Unclassified 795
190 Ga0495630_0095151 3300046517 Unclassified 2252
191 Ga0495634_0324217 3300046642 Bacteria 927
192 Ga0495635_0074100 3300046663 Bacteria 2332
193 Ga0495658_0139418 3300046683 Unclassified 1482
194 Ga0496101_0056406 3300048904 Bacteria 2840
195 Ga0496102_0145972 3300048905 Bacteria 2221
196 Ga0496104_0035067 3300048907 Bacteria 4683
197 Ga0496104_0169834 3300048907 Bacteria 2091
198 Ga0496105_0042388 3300048908 Bacteria 3752
199 Ga0496106_0217147 3300048909 Bacteria 1524
200 Ga0496108_0007522 3300048911 Bacteria 8833
201 Ga0496108_0017628 3300048911 Bacteria 5843
202 Ga0496109_0001987 3300048912 Bacteria 16952
203 Ga0496109_0035757 3300048912 Bacteria 4483
204 Ga0496109_0426284 3300048912 Unclassified 1253
205 Ga0496109_0492686 3300048912 Bacteria 1157
206 Ga0496110_0009945 3300048913 Bacteria 7712
207 Ga0496110_0011412 3300048913 Bacteria 7271
208 Ga0496110_0037963 3300048913 Bacteria 4188
209 Ga0496111_0252346 3300048914 Bacteria 1309
210 Ga0496111_0293051 3300048914 Bacteria 1207
211 Ga0496112_0000728 3300048915 Bacteria 22872
212 Ga0496112_0000942 3300048915 Bacteria 21113
213 Ga0496112_0002325 3300048915 Bacteria 15252
214 Ga0496112_0703815 3300048915 Bacteria 938
215 Ga0496113_0021408 3300048916 Bacteria 4561
216 Ga0496113_0223243 3300048916 Bacteria 1502
217 Ga0496114_0679147 3300048917 Bacteria 904
218 Ga0501312_021134 3300049528 Bacteria 968
219 Ga0501033_0140137 3300049570 Bacteria 1748
220 Ga0501033_0157101 3300049570 Bacteria 1638
221 Ga0501034_0036366 3300049571 Bacteria 4988
222 Ga0501034_0055270 3300049571 Bacteria 3995
223 Ga0501034_0145950 3300049571 Bacteria 2343
224 Ga0501034_0197054 3300049571 Bacteria 1973
225 Ga0501036_0273859 3300049572 Bacteria 1413
226 Ga0501036_0530749 3300049572 Bacteria 978
227 Ga0501037_0043729 3300049573 Bacteria 3291
228 Ga0501038_0142121 3300049574 Bacteria 1963
229 Ga0501038_0268995 3300049574 Bacteria 1344
230 Ga0501038_0444081 3300049574 Bacteria 998
231 Ga0501039_0096013 3300049575 Bacteria 2311
232 Ga0501040_0043904 3300049576 Bacteria 3047
233 Ga0501041_0166240 3300049577 Unclassified 1380
234 Ga0501041_0252638 3300049577 Unclassified 1108
235 Ga0501042_0217014 3300049578 Bacteria 1380
236 Ga0501042_0455344 3300049578 Archaea 928
237 Ga0501043_0557691 3300049579 Bacteria 850
238 Ga0501047_0019858 3300049581 Bacteria 6450
239 Ga0501047_0191552 3300049581 Bacteria 1908
240 Ga0501047_0399929 3300049581 Bacteria 1206
241 Ga0501069_0103977 3300049585 Bacteria 1614
242 Ga0501070_0102506 3300049586 Bacteria 2367
243 Ga0501070_0137998 3300049586 Bacteria 2013
244 Ga0501070_0241057 3300049586 Bacteria 1480
245 Ga0501073_0002930 3300049589 Bacteria 12804
246 Ga0501073_0018909 3300049589 Bacteria 4978
247 Ga0501073_0103271 3300049589 Bacteria 1979
248 Ga0501074_0252396 3300049590 Unclassified 1254
249 Ga0501075_0097256 3300049591 Bacteria 2234
250 Ga0501075_0107552 3300049591 Bacteria 2120
251 Ga0501076_0385977 3300049592 Bacteria 1151
252 Ga0501076_0442035 3300049592 Bacteria 1070
253 Ga0501077_0090210 3300049593 Bacteria 1943
254 Ga0501079_0038806 3300049741 Bacteria 3673
255 Ga0501079_0093416 3300049741 Bacteria 2331
256 Ga0501079_0549777 3300049741 Unclassified 908
257 Ga0501080_0032367 3300049742 Bacteria 4876
258 Ga0501080_0095044 3300049742 Bacteria 2768
259 Ga0501080_0122503 3300049742 Bacteria 2409
260 Ga0501080_0177060 3300049742 Bacteria 1964
261 Ga0501080_0263072 3300049742 Bacteria 1571
262 Ga0501081_0119061 3300049743 Unclassified 1879
263 Ga0501081_0182090 3300049743 Bacteria 1520
264 Ga0501083_0166753 3300049744 Bacteria 1440
265 Ga0501035_0024243 3300049822 Bacteria 5565
266 Ga0501035_0755137 3300049822 Archaea 780
267 Ga0501044_0060453 3300049823 Bacteria 3879
268 Ga0501044_0066000 3300049823 Bacteria 3690
269 Ga0501044_0220646 3300049823 Bacteria 1846
270 nmdc:mga0k408_78972_c1 3300050493 Bacteria 1926
271 nmdc:mga05p37_393087_c1 3300050507 Bacteria 1621
272 nmdc:mga09592_565988_c1 3300050508 Unclassified 975
273 nmdc:mga09592_70295_c1 3300050508 Unclassified 2970
274 nmdc:mga0qj67_575335_c1 3300050509 Unclassified 902
275 nmdc:mga06r32_152363_c1 3300050510 Unclassified 2291
276 nmdc:mga06r32_308515_c1 3300050510 Bacteria 1568
277 nmdc:mga08y16_900420_c1 3300050511 Bacteria 871
278 nmdc:mga0n895_691621_c1 3300050512 Bacteria 1016
279 nmdc:mga0a205_3575_c1 3300050515 Bacteria 13910
280 nmdc:mga0a205_9929_c1 3300050515 Bacteria 8730
281 Ga0495619_0032450 3300053085 Bacteria 3389
282 Ga0495619_0176667 3300053085 Bacteria 1477
283 Ga0501084_0049159 3300054114 Bacteria 3530
284 Ga0501084_0056764 3300054114 Bacteria 3276
285 Ga0501082_0038703 3300060353 Bacteria 4113
286 Ga0501082_0166674 3300060353 Bacteria 1915
287 Ga0501082_0316706 3300060353 Archaea 1359
288 Ga0501082_0631301 3300060353 Archaea 937
289 Ga0501082_0917829 3300060353 Bacteria 766
290 2980130051 2980125574 Bacteria 5567337
291 Ga0395901_0678006
292 Ga0065714_10255686
293 Ga0065712_10079017
294 Ga0065712_10101570
295 Ga0065712_10203576
296 Ga0065715_10135716
297 Ga0070683_100003346
298 Ga0070683_100026577
299 Ga0070670_100007567
300 Ga0070670_100027822
301 Ga0070666_10069786
302 Ga0068868_100142128
303 Ga0068868_100286722
304 Ga0070660_100503965
305 Ga0070661_100045232
306 Ga0070668_100485776
307 Ga0070669_100000065
308 Ga0070675_100021100
309 Ga0070671_100173335
310 Ga0070674_100230923
311 Ga0070688_100022963
312 Ga0070688_100548807
313 Ga0070667_100013901
314 Ga0070710_10382911
315 Ga0070700_100066052
316 Ga0070663_100015014
317 Ga0070678_100013633
318 Ga0070678_100039158
319 Ga0070662_100017946
320 Ga0068867_100505477
321 Ga0070685_10254634
322 Ga0070698_100355482
323 Ga0070699_100098767
324 Ga0070684_100002450
325 Ga0070672_100544742
326 Ga0070686_100232533
327 Ga0070686_100456625
328 Ga0070665_100001056
329 Ga0070665_100004906
330 Ga0070665_100050265
331 Ga0070665_100404613
332 Ga0070664_100001232
333 Ga0070664_100534588
334 Ga0070664_100724930
335 Ga0070702_100454878
336 Ga0068859_100342906
337 Ga0068859_100822028
338 Ga0068859_100972931
339 Ga0068864_100000473
340 Ga0068864_100020287
341 Ga0068851_10304999
342 Ga0068863_100062315
343 Ga0068863_100079664
344 Ga0068858_100046901
345 Ga0068858_100627220
346 Ga0068858_100783720
347 Ga0068862_100066643
348 Ga0068862_100090752
349 Ga0068862_100687759
350 Ga0070717_10284877
351 Ga0075367_10126210
352 Ga0075366_10071293
353 Ga0068871_100348491
354 Ga0075428_100003643
355 Ga0075428_100313281
356 Ga0075428_100883665
357 Ga0075430_100006311
358 Ga0075431_100001487
359 Ga0075431_100341388
360 Ga0075433_10004837
361 Ga0075433_10004979
362 Ga0075433_10034772
363 Ga0075433_10120661
364 Ga0075433_10398290
365 Ga0075434_100031064
366 Ga0075429_100002658
367 Ga0075429_100800864
368 Ga0068865_100157491
369 Ga0068865_100375007
370 Ga0097620_100342925
371 Ga0097620_100821880
372 Ga0097620_100973215
373 Ga0111539_10045440
374 Ga0111539_10153235
375 Ga0111539_10261192
376 Ga0111539_10376412
377 Ga0105245_10252627
378 Ga0105245_10470747
379 Ga0114129_10367526
380 Ga0105242_10362650
381 Ga0105248_10015653
382 Ga0105248_10079995
383 Ga0105248_10199801
384 Ga0105248_10408914
385 Ga0105248_11515450
386 Ga0105249_10119082
387 Ga0105249_10206613
388 Ga0105249_10594288
389 Ga0157374_10031631
390 Ga0157374_10254276
391 Ga0157374_10741198
392 Ga0157378_10125069
393 Ga0163162_10128001
394 Ga0157375_10317279
395 Ga0163163_10006113
396 Ga0157380_10303595
397 Ga0157379_10067574
398 Ga0157379_10370393
399 Ga0157376_10044740
400 Ga0207697_10005597
401 Ga0207710_10143811
402 Ga0207680_10359567
403 Ga0207662_10244044
404 Ga0207662_10380014
405 Ga0207649_10101832
406 Ga0207681_10000021
407 Ga0207681_10081185
408 Ga0207650_10009649
409 Ga0207650_10116452
410 Ga0207659_10242695
411 Ga0207659_10672958
412 Ga0207687_10333710
413 Ga0207686_10263971
414 Ga0207704_10092230
415 Ga0207704_10504025
416 Ga0207691_10357659
417 Ga0207691_10482020
418 Ga0207691_10618737
419 Ga0207711_10019885
420 Ga0207711_10101063
421 Ga0207711_10365851
422 Ga0207679_10068729
423 Ga0207679_10076100
424 Ga0207679_10755837
425 Ga0207712_10043708
426 Ga0207712_10406045
427 Ga0207658_10073907
428 Ga0207677_10078397
429 Ga0207677_10132840
430 Ga0207703_10171570
431 Ga0207678_10076098
432 Ga0207678_10597788
433 Ga0207641_10119845
434 Ga0207641_10172003
435 Ga0207648_10069786
436 Ga0207676_10095557
437 Ga0207676_10210226
438 Ga0207675_100026389
439 Ga0207683_10190210
440 Ga0207428_10009694
441 Ga0268266_10000188
442 Ga0268266_10006639
443 Ga0268265_10075953
444 Ga0268265_10217890
445 Ga0268264_10502621
446 Ga0268264_10506214
447 Ga0265330_10096892
448 Ga0307408_100006841
449 Ga0307408_100126291
450 Ga0307408_100252875
451 Ga0316579_10094319
452 Ga0307405_10621124
453 Ga0316577_10068486
454 Ga0307413_10148777
455 Ga0307406_10139883
456 Ga0307407_10057151
457 Ga0307412_10039472
458 Ga0307412_10606428
459 Ga0307409_100077363
460 Ga0307409_100558835
461 Ga0307409_100602671
462 Ga0307416_100131598
463 Ga0307416_100303415
464 Ga0307416_100351259
465 Ga0307416_100737839
466 Ga0307411_10173209
467 Ga0307411_10380875
468 Ga0307411_10858865
469 Ga0307415_100443762
470 Ga0373943_0162208
471 Ga0373955_0300531
472 Ga0373937_0099535
473 Ga0316582_0072399
474 Ga0316584_0019459
475 Ga0436362_0630352
476 Ga0439436_0046802
477 Ga0439446_0009165
478 Ga0439446_0028133
479 Ga0495608_0438992
480 Ga0495630_0095151
481 Ga0495634_0324217
482 Ga0495635_0074100
483 Ga0495658_0139418
484 Ga0496101_0056406
485 Ga0496102_0145972
486 Ga0496104_0035067
487 Ga0496104_0169834
488 Ga0496105_0042388
489 Ga0496106_0217147
490 Ga0496108_0007522
491 Ga0496108_0017628
492 Ga0496109_0001987
493 Ga0496109_0035757
494 Ga0496109_0426284
495 Ga0496109_0492686
496 Ga0496110_0009945
497 Ga0496110_0011412
498 Ga0496110_0037963
499 Ga0496111_0252346
500 Ga0496111_0293051
501 Ga0496112_0000728
502 Ga0496112_0000942
503 Ga0496112_0002325
504 Ga0496112_0703815
505 Ga0496113_0021408
506 Ga0496113_0223243
507 Ga0496114_0679147
508 Ga0501312_021134
509 Ga0501033_0140137
510 Ga0501033_0157101
511 Ga0501034_0036366
512 Ga0501034_0055270
513 Ga0501034_0145950
514 Ga0501034_0197054
515 Ga0501036_0273859
516 Ga0501036_0530749
517 Ga0501037_0043729
518 Ga0501038_0142121
519 Ga0501038_0268995
520 Ga0501038_0444081
521 Ga0501039_0096013
522 Ga0501040_0043904
523 Ga0501041_0166240
524 Ga0501041_0252638
525 Ga0501042_0217014
526 Ga0501042_0455344
527 Ga0501043_0557691
528 Ga0501047_0019858
529 Ga0501047_0191552
530 Ga0501047_0399929
531 Ga0501069_0103977
532 Ga0501070_0102506
533 Ga0501070_0137998
534 Ga0501070_0241057
535 Ga0501073_0002930
536 Ga0501073_0018909
537 Ga0501073_0103271
538 Ga0501074_0252396
539 Ga0501075_0097256
540 Ga0501075_0107552
541 Ga0501076_0385977
542 Ga0501076_0442035
543 Ga0501077_0090210
544 Ga0501079_0038806
545 Ga0501079_0093416
546 Ga0501079_0549777
547 Ga0501080_0032367
548 Ga0501080_0095044
549 Ga0501080_0122503
550 Ga0501080_0177060
551 Ga0501080_0263072
552 Ga0501081_0119061
553 Ga0501081_0182090
554 Ga0501083_0166753
555 Ga0501035_0024243
556 Ga0501035_0755137
557 Ga0501044_0060453
558 Ga0501044_0066000
559 Ga0501044_0220646
560 nmdc:mga0k408_78972_c1
561 nmdc:mga05p37_393087_c1
562 nmdc:mga09592_565988_c1
563 nmdc:mga09592_70295_c1
564 nmdc:mga0qj67_575335_c1
565 nmdc:mga06r32_152363_c1
566 nmdc:mga06r32_308515_c1
567 nmdc:mga08y16_900420_c1
568 nmdc:mga0n895_691621_c1
569 nmdc:mga0a205_3575_c1
570 nmdc:mga0a205_9929_c1
571 Ga0495619_0032450
572 Ga0495619_0176667
573 Ga0501084_0049159
574 Ga0501084_0056764
575 Ga0501082_0038703
576 Ga0501082_0166674
577 Ga0501082_0316706
578 Ga0501082_0631301
579 Ga0501082_0917829
580 2980130051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

19

217

0.9

PF01738

DLH

Dienelactone hydrolase family

74

212

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0c-assembly2.cif.gz_B crystal structure of phospholipase/carboxylesterase from dyadobacter fermentans dsm 18053 0.9646 10 212
4h0c-assembly2.cif.gz_B crystal structure of phospholipase/carboxylesterase from dyadobacter fermentans dsm 18053 0.9332 10 212
6avw-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 l63a 0.8405 23 211
6bje-assembly1.cif.gz_A crystal structure of lysophospholipase a2 conjugated with phenylmethylsulfonyl fluoride 0.8382 11 211
3cn7-assembly3.cif.gz_C crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- monoclinic crystal form 0.8365 13 211
ID Description Score Start End Superfamily
4h0cB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.951 4 212 3.40.50.1820
4h0cB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9465 4 212 3.40.50.1820
af_Q5AGD1_2_230_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8477 12 211 3.40.50.1820
3cn7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8366 13 211 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8366 11 211 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6L3ZX85-F1-model_v4 Phospholipase 0.9965 63 211 GO:0016787
AF-A0A841HZM2-F1-model_v4 Glyoxalase family protein 0.9961 7 211 GO:0016787
AF-A0A3N5PQU4-F1-model_v4 Phospholipase 0.9933 58 211 GO:0016787
AF-A0A535WKK6-F1-model_v4 Phospholipase 0.9929 74 211 GO:0005737
GO:0008474
GO:0052689
AF-A0A2W2BHB2-F1-model_v4 Phospholipase 0.9913 13 210 GO:0016787

Map