F389830

General Info

Members Datasets Scaffolds Average Seq Length
290 162 580 217

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10137768|Ga0307517_101377682
Length 242
Sequence LVPGLTRRLLDFRWPRGHTPQPMPTSSTSVAVKICGITSPGAIDAAAGAGAVYGGLVFHPNSPRFVNLEQARALADHMRGRLKIVALIADMDDVRIENLVNTVRPDFLQLHGGESARRSAYIRGKFGLPVIKALPVAEPSDLALAAEYENAADMLMFDARPPKEALRGGGHGAAFDWKILEGRSFTKPWFLAGGLTPENVARAISLSGAKQVDVSSGVESAPRIRDFISAANTPASLSRQSA

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
160 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
161 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 0
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10137768 3300028786 Bacteria 1728
2 JGI25165J46597_1000013 3300003214 Bacteria 402100
3 Ga0070658_10018615 3300005327 Bacteria 5562
4 Ga0070658_10020278 3300005327 Bacteria 5326
5 Ga0070658_10345633 3300005327 Bacteria 1273
6 Ga0070690_100044092 3300005330 Bacteria 2831
7 Ga0068869_100013794 3300005334 Bacteria 5385
8 Ga0068869_100082001 3300005334 Bacteria 2410
9 Ga0070666_10045750 3300005335 Bacteria 2934
10 Ga0070666_10201607 3300005335 Bacteria 1400
11 Ga0068868_100010364 3300005338 Bacteria 6745
12 Ga0068868_100019986 3300005338 Bacteria 5023
13 Ga0068868_100563578 3300005338 Bacteria 1005
14 Ga0070660_100110993 3300005339 Bacteria 2181
15 Ga0070660_100345702 3300005339 Bacteria 1224
16 Ga0070661_100506124 3300005344 Bacteria 967
17 Ga0070668_100223503 3300005347 Bacteria 1554
18 Ga0070675_100507135 3300005354 Bacteria 1088
19 Ga0070675_100647502 3300005354 Bacteria 960
20 Ga0070671_100053907 3300005355 Bacteria 3343
21 Ga0070671_100429565 3300005355 Bacteria 1132
22 Ga0070674_100077846 3300005356 Bacteria 2362
23 Ga0070674_100571972 3300005356 Bacteria 951
24 Ga0070674_100585055 3300005356 Bacteria 941
25 Ga0070673_100022570 3300005364 Bacteria 4584
26 Ga0070673_100080255 3300005364 Bacteria 2643
27 Ga0070673_100756082 3300005364 Bacteria 895
28 Ga0070659_100016420 3300005366 Bacteria 5559
29 Ga0070667_100101064 3300005367 Bacteria 2490
30 Ga0070667_100142015 3300005367 Bacteria 2104
31 Ga0070667_100703424 3300005367 Bacteria 935
32 Ga0070714_100367526 3300005435 Bacteria 1354
33 Ga0070700_100103524 3300005441 Bacteria 1880
34 Ga0070678_100014202 3300005456 Bacteria 5017
35 Ga0070678_100027999 3300005456 Bacteria 3836
36 Ga0070678_100062137 3300005456 Bacteria 2757
37 Ga0070678_100169717 3300005456 Bacteria 1776
38 Ga0070681_10071822 3300005458 Bacteria 3425
39 Ga0070681_10158677 3300005458 Bacteria 2186
40 Ga0070681_10615767 3300005458 Bacteria 1000
41 Ga0068867_100002743 3300005459 Bacteria 12411
42 Ga0068867_100388181 3300005459 Bacteria 1174
43 Ga0070685_10064981 3300005466 Bacteria 2147
44 Ga0070706_100007330 3300005467 Bacteria 10348
45 Ga0070707_100096266 3300005468 Bacteria 2867
46 Ga0070679_100018061 3300005530 Bacteria 6836
47 Ga0070679_100025615 3300005530 Bacteria 5790
48 Ga0070679_100067843 3300005530 Bacteria 3557
49 Ga0070679_100491192 3300005530 Bacteria 1172
50 Ga0070679_100697217 3300005530 Bacteria 958
51 Ga0070684_100169721 3300005535 Bacteria 1981
52 Ga0070684_100203057 3300005535 Bacteria 1806
53 Ga0068853_100323887 3300005539 Bacteria 1429
54 Ga0070665_100000549 3300005548 Bacteria 52501
55 Ga0070665_100038082 3300005548 Bacteria 4834
56 Ga0070665_100051706 3300005548 Bacteria 4121
57 Ga0070665_100059640 3300005548 Bacteria 3825
58 Ga0070665_100097566 3300005548 Bacteria 2943
59 Ga0070665_100122650 3300005548 Bacteria 2600
60 Ga0070665_100902925 3300005548 Bacteria 896
61 Ga0068855_100067256 3300005563 Bacteria 4175
62 Ga0068855_100083011 3300005563 Bacteria 3713
63 Ga0068855_100409163 3300005563 Bacteria 1485
64 Ga0068855_100470736 3300005563 Bacteria 1369
65 Ga0070664_100937733 3300005564 Unclassified 812
66 Ga0068857_100083261 3300005577 Bacteria 2858
67 Ga0068857_100499790 3300005577 Bacteria 1141
68 Ga0068856_100274861 3300005614 Bacteria 1701
69 Ga0070702_100078285 3300005615 Bacteria 1973
70 Ga0068852_100587762 3300005616 Bacteria 1117
71 Ga0068852_100647970 3300005616 Bacteria 1063
72 Ga0068859_100116133 3300005617 Bacteria 2741
73 Ga0068864_100040119 3300005618 Bacteria 4004
74 Ga0068864_100189032 3300005618 Bacteria 1887
75 Ga0068866_10009890 3300005718 Bacteria 4068
76 Ga0068870_10044792 3300005840 Bacteria 2313
77 Ga0068863_100119997 3300005841 Bacteria 2506
78 Ga0068863_100186431 3300005841 Bacteria 1993
79 Ga0068858_100008016 3300005842 Bacteria 10175
80 Ga0068858_100033990 3300005842 Bacteria 4730
81 Ga0068858_100286324 3300005842 Bacteria 1570
82 Ga0068860_100103645 3300005843 Bacteria 2715
83 Ga0068862_100310632 3300005844 Bacteria 1453
84 Ga0068862_100374732 3300005844 Bacteria 1326
85 Ga0097621_100045392 3300006237 Bacteria 3549
86 Ga0097621_100103483 3300006237 Bacteria 2398
87 Ga0097621_100105387 3300006237 Bacteria 2377
88 Ga0097621_100155559 3300006237 Bacteria 1962
89 Ga0097621_100556068 3300006237 Bacteria 1045
90 Ga0068871_100000433 3300006358 Bacteria 28790
91 Ga0068871_100094592 3300006358 Bacteria 2494
92 Ga0068871_100181356 3300006358 Bacteria 1810
93 Ga0068865_100001668 3300006881 Bacteria 12990
94 Ga0068865_100471895 3300006881 Bacteria 1041
95 Ga0097620_100116131 3300006931 Bacteria 2741
96 Ga0105240_10019625 3300009093 Bacteria 9029
97 Ga0105240_10210054 3300009093 Bacteria 2275
98 Ga0105240_10302835 3300009093 Bacteria 1828
99 Ga0105240_11170287 3300009093 Bacteria 815
100 Ga0105245_10425478 3300009098 Bacteria 1332
101 Ga0105245_10454740 3300009098 Bacteria 1290
102 Ga0105243_10001499 3300009148 Bacteria 20431
103 Ga0105243_10358127 3300009148 Bacteria 1342
104 Ga0105241_10007780 3300009174 Bacteria 7882
105 Ga0105241_10561378 3300009174 Bacteria 1026
106 Ga0105242_10022856 3300009176 Bacteria 4924
107 Ga0105242_10032972 3300009176 Bacteria 4145
108 Ga0105248_10026993 3300009177 Bacteria 6387
109 Ga0105248_10107162 3300009177 Bacteria 3151
110 Ga0105248_11207224 3300009177 Bacteria 855
111 Ga0105238_10197220 3300009551 Bacteria 1989
112 Ga0105238_10208340 3300009551 Bacteria 1931
113 Ga0105238_10231589 3300009551 Bacteria 1824
114 Ga0105238_10386844 3300009551 Bacteria 1391
115 Ga0105238_10687000 3300009551 Bacteria 1035
116 Ga0105249_10079756 3300009553 Bacteria 3039
117 Ga0105249_10677220 3300009553 Bacteria 1090
118 Ga0099796_10110780 3300010159 Bacteria 1044
119 Ga0105239_10051942 3300010375 Bacteria 4494
120 Ga0105239_10763539 3300010375 Bacteria 1107
121 Ga0105239_10898645 3300010375 Bacteria 1016
122 Ga0105239_11085268 3300010375 Unclassified 921
123 Ga0105246_10021337 3300011119 Bacteria 4167
124 Ga0105246_10285254 3300011119 Bacteria 1326
125 Ga0105246_10638324 3300011119 Bacteria 925
126 Ga0157371_10226445 3300013102 Bacteria 1343
127 Ga0157370_10043658 3300013104 Bacteria 4313
128 Ga0157370_10067421 3300013104 Bacteria 3382
129 Ga0157369_10066427 3300013105 Bacteria 3880
130 Ga0157369_10357549 3300013105 Bacteria 1516
131 Ga0157374_10202008 3300013296 Bacteria 1946
132 Ga0157374_10757385 3300013296 Bacteria 986
133 Ga0157378_10019636 3300013297 Bacteria 5940
134 Ga0157378_10400388 3300013297 Bacteria 1352
135 Ga0157378_11171801 3300013297 Bacteria 807
136 Ga0163162_10047459 3300013306 Bacteria 4304
137 Ga0163162_10069282 3300013306 Bacteria 3579
138 Ga0163162_10122012 3300013306 Bacteria 2711
139 Ga0163163_10000180 3300014325 Bacteria 64938
140 Ga0163163_10073174 3300014325 Bacteria 3417
141 Ga0163163_10093586 3300014325 Bacteria 3022
142 Ga0157380_11214490 3300014326 Bacteria 798
143 Ga0157379_10003250 3300014968 Bacteria 13774
144 Ga0157379_10025684 3300014968 Bacteria 5235
145 Ga0157379_10317063 3300014968 Bacteria 1423
146 Ga0157379_10936743 3300014968 Bacteria 823
147 Ga0157376_10100954 3300014969 Bacteria 2520
148 Ga0157376_10662586 3300014969 Bacteria 1045
149 Ga0209233_1000013 3300025261 Bacteria 1013785
150 Ga0209233_1004288 3300025261 Bacteria 4877
151 Ga0209455_1012129 3300025272 Bacteria 2080
152 Ga0207642_10025344 3300025899 Bacteria 2398
153 Ga0207680_10080015 3300025903 Bacteria 2051
154 Ga0207684_10014900 3300025910 Bacteria 6690
155 Ga0207654_10003266 3300025911 Bacteria 8196
156 Ga0207654_10470946 3300025911 Unclassified 883
157 Ga0207707_10097997 3300025912 Bacteria 2563
158 Ga0207695_10092895 3300025913 Bacteria 3027
159 Ga0207695_10298875 3300025913 Bacteria 1501
160 Ga0207695_10309674 3300025913 Bacteria 1469
161 Ga0207695_10617705 3300025913 Bacteria 965
162 Ga0207657_10099029 3300025919 Bacteria 2422
163 Ga0207652_10237312 3300025921 Bacteria 1643
164 Ga0207694_10063894 3300025924 Bacteria 2868
165 Ga0207694_10168052 3300025924 Bacteria 1774
166 Ga0207694_10176333 3300025924 Bacteria 1732
167 Ga0207694_10283428 3300025924 Bacteria 1361
168 Ga0207694_10411533 3300025924 Bacteria 1125
169 Ga0207650_10680808 3300025925 Bacteria 868
170 Ga0207659_10121958 3300025926 Bacteria 1998
171 Ga0207687_10156732 3300025927 Bacteria 1743
172 Ga0207644_10403748 3300025931 Bacteria 1117
173 Ga0207686_10009183 3300025934 Bacteria 5363
174 Ga0207686_10031877 3300025934 Bacteria 3133
175 Ga0207686_10082038 3300025934 Bacteria 2107
176 Ga0207709_10059718 3300025935 Bacteria 2375
177 Ga0207669_10066250 3300025937 Bacteria 2245
178 Ga0207669_10315977 3300025937 Bacteria 1193
179 Ga0207669_10620791 3300025937 Bacteria 881
180 Ga0207704_10006893 3300025938 Bacteria 5331
181 Ga0207704_10251999 3300025938 Bacteria 1326
182 Ga0207711_10003979 3300025941 Bacteria 12707
183 Ga0207711_10086017 3300025941 Bacteria 2756
184 Ga0207689_10045032 3300025942 Bacteria 3649
185 Ga0207661_10292976 3300025944 Bacteria 1457
186 Ga0207667_10032782 3300025949 Bacteria 5593
187 Ga0207667_10109840 3300025949 Bacteria 2844
188 Ga0207667_10909974 3300025949 Unclassified 871
189 Ga0207651_10060190 3300025960 Bacteria 2635
190 Ga0207651_10119546 3300025960 Bacteria 1995
191 Ga0207712_10077523 3300025961 Bacteria 2409
192 Ga0207658_10186893 3300025986 Bacteria 1719
193 Ga0207677_10007638 3300026023 Bacteria 6000
194 Ga0207677_10127008 3300026023 Bacteria 1929
195 Ga0207639_10106104 3300026041 Bacteria 2280
196 Ga0207708_10236743 3300026075 Bacteria 1467
197 Ga0207641_10202146 3300026088 Bacteria 1832
198 Ga0207648_10007721 3300026089 Bacteria 10514
199 Ga0207648_10035500 3300026089 Bacteria 4392
200 Ga0207674_10071096 3300026116 Bacteria 3497
201 Ga0207674_10075582 3300026116 Bacteria 3378
202 Ga0207674_10381570 3300026116 Bacteria 1362
203 Ga0207683_10008874 3300026121 Bacteria 8572
204 Ga0207683_10168371 3300026121 Bacteria 1984
205 Ga0207683_10176223 3300026121 Bacteria 1938
206 Ga0207683_10325262 3300026121 Bacteria 1409
207 Ga0268266_10001925 3300028379 Bacteria 23355
208 Ga0268266_10030405 3300028379 Bacteria 4588
209 Ga0268266_10036295 3300028379 Bacteria 4195
210 Ga0268266_10040574 3300028379 Bacteria 3967
211 Ga0268266_10057762 3300028379 Bacteria 3339
212 Ga0268266_10079666 3300028379 Bacteria 2852
213 Ga0268265_10089666 3300028380 Bacteria 2454
214 Ga0268264_10207214 3300028381 Bacteria 1798
215 Ga0265325_10015433 3300031241 Bacteria 4294
216 Ga0265339_10052804 3300031249 Bacteria 2212
217 Ga0265316_10045141 3300031344 Bacteria 3501
218 Ga0265313_10043635 3300031595 Bacteria 2194
219 Ga0307516_10142155 3300031730 Bacteria 2168
220 Ga0307405_10314206 3300031731 Bacteria 1194
221 Ga0307510_10261977 3300033180 Bacteria 1210
222 Ga0316584_0111481 3300036712 Bacteria 2047
223 Ga0395901_0105200 3300038443 Bacteria 2962
224 Ga0436365_0054505 3300039437 Bacteria 830
225 Ga0436360_0804077 3300039438 Bacteria 1286
226 Ga0451577_0000018 3300042876 Bacteria 516495
227 Ga0453684_0000166 3300044712 Bacteria 294291
228 Ga0495629_0059375 3300046459 Bacteria 2674
229 Ga0495650_0108594 3300046471 Bacteria 1033
230 Ga0495582_0100973 3300046473 Bacteria 1615
231 Ga0495639_0039267 3300046475 Bacteria 2128
232 Ga0495648_0190501 3300046524 Bacteria 1035
233 Ga0495586_0017420 3300046535 Bacteria 3820
234 Ga0495609_0030363 3300046538 Bacteria 2460
235 Ga0495622_0001008 3300046557 Bacteria 15074
236 Ga0495611_0148336 3300046648 Bacteria 1095
237 Ga0495589_0053445 3300046794 Bacteria 1993
238 Ga0495674_0118156 3300047319 Bacteria 2242
239 Ga0495676_0265600 3300047321 Bacteria 1166
240 Ga0495684_0259906 3300047471 Unclassified 1260
241 Ga0501031_0000905 3300049568 Bacteria 17854
242 Ga0501032_0004137 3300049569 Bacteria 10995
243 Ga0501033_0095213 3300049570 Bacteria 2176
244 Ga0501033_0097517 3300049570 Bacteria 2147
245 Ga0501033_0373453 3300049570 Bacteria 997
246 Ga0501034_0041275 3300049571 Bacteria 4668
247 Ga0501034_0044407 3300049571 Bacteria 4495
248 Ga0501034_0174831 3300049571 Bacteria 2114
249 Ga0501036_0006005 3300049572 Bacteria 9845
250 Ga0501037_0004917 3300049573 Bacteria 9725
251 Ga0501038_0043142 3300049574 Bacteria 3923
252 Ga0501038_0209087 3300049574 Bacteria 1562
253 Ga0501039_0017025 3300049575 Bacteria 5572
254 Ga0501042_0017667 3300049578 Bacteria 4924
255 Ga0501043_0541538 3300049579 Bacteria 866
256 Ga0501046_0004230 3300049580 Bacteria 13058
257 Ga0501047_0008761 3300049581 Bacteria 9547
258 Ga0501047_0032694 3300049581 Bacteria 5023
259 Ga0501047_0084165 3300049581 Bacteria 3057
260 Ga0501047_0088573 3300049581 Bacteria 2972
261 Ga0501047_0105187 3300049581 Bacteria 2703
262 Ga0501047_0143260 3300049581 Bacteria 2267
263 Ga0501047_0220713 3300049581 Bacteria 1752
264 Ga0501067_0001654 3300049583 Bacteria 12246
265 Ga0501070_0036478 3300049586 Bacteria 4105
266 Ga0501070_0344969 3300049586 Bacteria 1209
267 Ga0501072_0021128 3300049588 Bacteria 5050
268 Ga0501073_0002404 3300049589 Bacteria 14010
269 Ga0501074_0015493 3300049590 Bacteria 5541
270 Ga0501076_0230418 3300049592 Bacteria 1514
271 Ga0501079_0087583 3300049741 Bacteria 2410
272 Ga0501080_0127365 3300049742 Bacteria 2357
273 Ga0501083_0002164 3300049744 Bacteria 13477
274 Ga0501035_0065663 3300049822 Bacteria 3221
275 Ga0501035_0157547 3300049822 Bacteria 1967
276 Ga0501035_0405439 3300049822 Bacteria 1134
277 Ga0501044_0083853 3300049823 Bacteria 3221
278 Ga0501044_0097666 3300049823 Bacteria 2958
279 Ga0501044_0550415 3300049823 Bacteria 1051
280 Ga0501045_0009940 3300049824 Bacteria 6656
281 Ga0500643_000021 3300053087 Bacteria 284326
282 Ga0500646_0043646 3300053090 Bacteria 1270
283 Ga0500641_0090007 3300053096 Bacteria 1309
284 Ga0500594_0068873 3300053118 Bacteria 1036
285 Ga0500595_000820 3300053119 Bacteria 17901
286 Ga0500595_055920 3300053119 Bacteria 1207
287 Ga0500597_089262 3300053120 Bacteria 1339
288 Ga0500588_0008924 3300053146 Bacteria 2363
289 Ga0500645_091196 3300053730 Bacteria 864
290 Ga0501082_0027462 3300060353 Bacteria 4899
291 Ga0307517_10137768
292 JGI25165J46597_1000013
293 Ga0070658_10018615
294 Ga0070658_10020278
295 Ga0070658_10345633
296 Ga0070690_100044092
297 Ga0068869_100013794
298 Ga0068869_100082001
299 Ga0070666_10045750
300 Ga0070666_10201607
301 Ga0068868_100010364
302 Ga0068868_100019986
303 Ga0068868_100563578
304 Ga0070660_100110993
305 Ga0070660_100345702
306 Ga0070661_100506124
307 Ga0070668_100223503
308 Ga0070675_100507135
309 Ga0070675_100647502
310 Ga0070671_100053907
311 Ga0070671_100429565
312 Ga0070674_100077846
313 Ga0070674_100571972
314 Ga0070674_100585055
315 Ga0070673_100022570
316 Ga0070673_100080255
317 Ga0070673_100756082
318 Ga0070659_100016420
319 Ga0070667_100101064
320 Ga0070667_100142015
321 Ga0070667_100703424
322 Ga0070714_100367526
323 Ga0070700_100103524
324 Ga0070678_100014202
325 Ga0070678_100027999
326 Ga0070678_100062137
327 Ga0070678_100169717
328 Ga0070681_10071822
329 Ga0070681_10158677
330 Ga0070681_10615767
331 Ga0068867_100002743
332 Ga0068867_100388181
333 Ga0070685_10064981
334 Ga0070706_100007330
335 Ga0070707_100096266
336 Ga0070679_100018061
337 Ga0070679_100025615
338 Ga0070679_100067843
339 Ga0070679_100491192
340 Ga0070679_100697217
341 Ga0070684_100169721
342 Ga0070684_100203057
343 Ga0068853_100323887
344 Ga0070665_100000549
345 Ga0070665_100038082
346 Ga0070665_100051706
347 Ga0070665_100059640
348 Ga0070665_100097566
349 Ga0070665_100122650
350 Ga0070665_100902925
351 Ga0068855_100067256
352 Ga0068855_100083011
353 Ga0068855_100409163
354 Ga0068855_100470736
355 Ga0070664_100937733
356 Ga0068857_100083261
357 Ga0068857_100499790
358 Ga0068856_100274861
359 Ga0070702_100078285
360 Ga0068852_100587762
361 Ga0068852_100647970
362 Ga0068859_100116133
363 Ga0068864_100040119
364 Ga0068864_100189032
365 Ga0068866_10009890
366 Ga0068870_10044792
367 Ga0068863_100119997
368 Ga0068863_100186431
369 Ga0068858_100008016
370 Ga0068858_100033990
371 Ga0068858_100286324
372 Ga0068860_100103645
373 Ga0068862_100310632
374 Ga0068862_100374732
375 Ga0097621_100045392
376 Ga0097621_100103483
377 Ga0097621_100105387
378 Ga0097621_100155559
379 Ga0097621_100556068
380 Ga0068871_100000433
381 Ga0068871_100094592
382 Ga0068871_100181356
383 Ga0068865_100001668
384 Ga0068865_100471895
385 Ga0097620_100116131
386 Ga0105240_10019625
387 Ga0105240_10210054
388 Ga0105240_10302835
389 Ga0105240_11170287
390 Ga0105245_10425478
391 Ga0105245_10454740
392 Ga0105243_10001499
393 Ga0105243_10358127
394 Ga0105241_10007780
395 Ga0105241_10561378
396 Ga0105242_10022856
397 Ga0105242_10032972
398 Ga0105248_10026993
399 Ga0105248_10107162
400 Ga0105248_11207224
401 Ga0105238_10197220
402 Ga0105238_10208340
403 Ga0105238_10231589
404 Ga0105238_10386844
405 Ga0105238_10687000
406 Ga0105249_10079756
407 Ga0105249_10677220
408 Ga0099796_10110780
409 Ga0105239_10051942
410 Ga0105239_10763539
411 Ga0105239_10898645
412 Ga0105239_11085268
413 Ga0105246_10021337
414 Ga0105246_10285254
415 Ga0105246_10638324
416 Ga0157371_10226445
417 Ga0157370_10043658
418 Ga0157370_10067421
419 Ga0157369_10066427
420 Ga0157369_10357549
421 Ga0157374_10202008
422 Ga0157374_10757385
423 Ga0157378_10019636
424 Ga0157378_10400388
425 Ga0157378_11171801
426 Ga0163162_10047459
427 Ga0163162_10069282
428 Ga0163162_10122012
429 Ga0163163_10000180
430 Ga0163163_10073174
431 Ga0163163_10093586
432 Ga0157380_11214490
433 Ga0157379_10003250
434 Ga0157379_10025684
435 Ga0157379_10317063
436 Ga0157379_10936743
437 Ga0157376_10100954
438 Ga0157376_10662586
439 Ga0209233_1000013
440 Ga0209233_1004288
441 Ga0209455_1012129
442 Ga0207642_10025344
443 Ga0207680_10080015
444 Ga0207684_10014900
445 Ga0207654_10003266
446 Ga0207654_10470946
447 Ga0207707_10097997
448 Ga0207695_10092895
449 Ga0207695_10298875
450 Ga0207695_10309674
451 Ga0207695_10617705
452 Ga0207657_10099029
453 Ga0207652_10237312
454 Ga0207694_10063894
455 Ga0207694_10168052
456 Ga0207694_10176333
457 Ga0207694_10283428
458 Ga0207694_10411533
459 Ga0207650_10680808
460 Ga0207659_10121958
461 Ga0207687_10156732
462 Ga0207644_10403748
463 Ga0207686_10009183
464 Ga0207686_10031877
465 Ga0207686_10082038
466 Ga0207709_10059718
467 Ga0207669_10066250
468 Ga0207669_10315977
469 Ga0207669_10620791
470 Ga0207704_10006893
471 Ga0207704_10251999
472 Ga0207711_10003979
473 Ga0207711_10086017
474 Ga0207689_10045032
475 Ga0207661_10292976
476 Ga0207667_10032782
477 Ga0207667_10109840
478 Ga0207667_10909974
479 Ga0207651_10060190
480 Ga0207651_10119546
481 Ga0207712_10077523
482 Ga0207658_10186893
483 Ga0207677_10007638
484 Ga0207677_10127008
485 Ga0207639_10106104
486 Ga0207708_10236743
487 Ga0207641_10202146
488 Ga0207648_10007721
489 Ga0207648_10035500
490 Ga0207674_10071096
491 Ga0207674_10075582
492 Ga0207674_10381570
493 Ga0207683_10008874
494 Ga0207683_10168371
495 Ga0207683_10176223
496 Ga0207683_10325262
497 Ga0268266_10001925
498 Ga0268266_10030405
499 Ga0268266_10036295
500 Ga0268266_10040574
501 Ga0268266_10057762
502 Ga0268266_10079666
503 Ga0268265_10089666
504 Ga0268264_10207214
505 Ga0265325_10015433
506 Ga0265339_10052804
507 Ga0265316_10045141
508 Ga0265313_10043635
509 Ga0307516_10142155
510 Ga0307405_10314206
511 Ga0307510_10261977
512 Ga0316584_0111481
513 Ga0395901_0105200
514 Ga0436365_0054505
515 Ga0436360_0804077
516 Ga0451577_0000018
517 Ga0453684_0000166
518 Ga0495629_0059375
519 Ga0495650_0108594
520 Ga0495582_0100973
521 Ga0495639_0039267
522 Ga0495648_0190501
523 Ga0495586_0017420
524 Ga0495609_0030363
525 Ga0495622_0001008
526 Ga0495611_0148336
527 Ga0495589_0053445
528 Ga0495674_0118156
529 Ga0495676_0265600
530 Ga0495684_0259906
531 Ga0501031_0000905
532 Ga0501032_0004137
533 Ga0501033_0095213
534 Ga0501033_0097517
535 Ga0501033_0373453
536 Ga0501034_0041275
537 Ga0501034_0044407
538 Ga0501034_0174831
539 Ga0501036_0006005
540 Ga0501037_0004917
541 Ga0501038_0043142
542 Ga0501038_0209087
543 Ga0501039_0017025
544 Ga0501042_0017667
545 Ga0501043_0541538
546 Ga0501046_0004230
547 Ga0501047_0008761
548 Ga0501047_0032694
549 Ga0501047_0084165
550 Ga0501047_0088573
551 Ga0501047_0105187
552 Ga0501047_0143260
553 Ga0501047_0220713
554 Ga0501067_0001654
555 Ga0501070_0036478
556 Ga0501070_0344969
557 Ga0501072_0021128
558 Ga0501073_0002404
559 Ga0501074_0015493
560 Ga0501076_0230418
561 Ga0501079_0087583
562 Ga0501080_0127365
563 Ga0501083_0002164
564 Ga0501035_0065663
565 Ga0501035_0157547
566 Ga0501035_0405439
567 Ga0501044_0083853
568 Ga0501044_0097666
569 Ga0501044_0550415
570 Ga0501045_0009940
571 Ga0500643_000021
572 Ga0500646_0043646
573 Ga0500641_0090007
574 Ga0500594_0068873
575 Ga0500595_000820
576 Ga0500595_055920
577 Ga0500597_089262
578 Ga0500588_0008924
579 Ga0500645_091196
580 Ga0501082_0027462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

32

228

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9447 3 211
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9406 3 211
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9338 3 211
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.926 3 211
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.9255 3 211
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9338 3 211 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9165 3 207 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9149 3 211 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8891 8 206 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8871 3 207 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6M1TU38-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9903 2 210 GO:0000162
GO:0004640
GO:0006568
AF-A0A368EBW1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9896 2 209 GO:0000162
GO:0004640
GO:0006568
AF-A0A102DBE4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9891 2 211 GO:0000162
GO:0004640
GO:0006568
AF-A0A2D7AAV1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9881 1 211 GO:0000162
GO:0004640
GO:0006568
AF-A0A519IYN8-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9872 1 210 GO:0000162
GO:0004640
GO:0006568

Map