F389678

General Info

Members Datasets Scaffolds Average Seq Length
290 219 580 267

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10168532|Ga0081455_101685321
Length 297
Sequence MRLAFSTLGVPGLPVTDVINLAATHGYHGVELRAHPEEPVHPGLDLNQRADVAAEFKAGGIELLGLAGYARVAAPGDDGPVIDEIRDLLDLARDLGAPYVRVFPGAGSEQTRERADAAAARRLGTAAEYAADLGVRILLETHDSHRTGADAIRVLGLVGHRHVGALWDVMHTWLGGEQPSESYAALSPYLGYVQVKDIASADDTTPLALGAGVLPLTECVEVLSRHGWDGWLCWEYEKRWYEDAAPLQERAGDQHHHDIEHRDGHSEWRHGVEHEYADRERAGRHEKGQRIGASRRT

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
4 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
5 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
8 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
18 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
19 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
21 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
22 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
23 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
24 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
32 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
33 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
34 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
35 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
36 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
37 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
38 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
42 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
43 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
44 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
45 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
46 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
47 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
48 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
61 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
73 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
95 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
117 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
146 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
147 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
148 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
149 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
152 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
157 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
163 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
164 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
165 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
166 2643221647 Streptomyces sp. Root369 Isolate Unclassified
167 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
168 2643221714 Streptomyces sp. Root264 Isolate Unclassified
169 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
170 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
171 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
172 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
173 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
174 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
175 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
176 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
177 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
178 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
179 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
180 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
181 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
182 2862574272 Streptomyces sp. AcE210 Isolate Nodule
183 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
184 2867369537 Streptomyces sp. Z26 Isolate Unclassified
185 2867428634 Streptomyces sp. RP5T Isolate Unclassified
186 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
187 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
188 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
189 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
190 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
191 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
192 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
193 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
194 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
195 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
196 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
197 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
198 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
199 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
200 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
201 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
202 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
203 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
204 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
205 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
206 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
207 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
208 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
209 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
210 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
211 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
212 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
213 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
214 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
215 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
216 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
217 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
218 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
219 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.31
Metatranscriptomes 0.69
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.66
Nodule 1.38
Rhizoplane 0.34
Rhizosphere 69.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10168532 3300005937 Bacteria 1671
2 Ga0006562J51391_1027449 3300003578 Bacteria 3000
3 Ga0006562J51391_1027450 3300003578 Bacteria 5940
4 Ga0070665_100027240 3300005548 Bacteria 5756
5 Ga0068856_100079446 3300005614 Bacteria 3253
6 Ga0075365_10060059 3300006038 Bacteria 2536
7 Ga0075363_100008583 3300006048 Bacteria 4766
8 Ga0075363_100065216 3300006048 Bacteria 1969
9 Ga0099826_10221614 3300006948 Bacteria 1018
10 Ga0105243_10100299 3300009148 Bacteria 2402
11 Ga0105246_10005287 3300011119 Bacteria 7855
12 Ga0105246_10181709 3300011119 Bacteria 1620
13 Ga0157372_10062316 3300013307 Bacteria 4178
14 Ga0182008_10001694 3300014497 Bacteria 14488
15 Ga0183367_1006 3300015688 Bacteria 648044
16 Ga0209758_1031337 3300025297 Bacteria 2182
17 Ga0207426_1006287 3300025302 Bacteria 5193
18 Ga0207647_10180089 3300025904 Bacteria 1228
19 Ga0207639_10051141 3300026041 Bacteria 3142
20 Ga0209371_1026350 3300027312 Bacteria 1324
21 Ga0209813_10032493 3300027866 Bacteria 1547
22 Ga0268266_10059129 3300028379 Bacteria 3302
23 Ga0307517_10006019 3300028786 Bacteria 18073
24 Ga0307517_10007126 3300028786 Bacteria 16395
25 Ga0307515_10000541 3300028794 Bacteria 88944
26 Ga0307515_10071365 3300028794 Bacteria 4707
27 Ga0268256_1029987 3300030500 Bacteria 1324
28 Ga0307511_10136376 3300030521 Bacteria 1459
29 Ga0307512_10009937 3300030522 Bacteria 9124
30 Ga0307512_10013559 3300030522 Bacteria 7632
31 Ga0307513_10028093 3300031456 Bacteria 6441
32 Ga0307513_10036414 3300031456 Bacteria 5489
33 Ga0307513_10214843 3300031456 Bacteria 1751
34 Ga0307509_10027249 3300031507 Bacteria 6360
35 Ga0307509_10132379 3300031507 Bacteria 2446
36 Ga0307508_10004446 3300031616 Bacteria 13701
37 Ga0307508_10007789 3300031616 Bacteria 9947
38 Ga0307508_10063533 3300031616 Bacteria 3257
39 Ga0307508_10100443 3300031616 Bacteria 2488
40 Ga0307508_10119577 3300031616 Bacteria 2236
41 Ga0307514_10021266 3300031649 Bacteria 5289
42 Ga0307514_10108479 3300031649 Bacteria 1974
43 Ga0307514_10124576 3300031649 Bacteria 1788
44 Ga0307514_10193085 3300031649 Bacteria 1293
45 Ga0307514_10278472 3300031649 Bacteria 960
46 Ga0307516_10003518 3300031730 Bacteria 20043
47 Ga0307516_10026944 3300031730 Bacteria 5833
48 Ga0307516_10029793 3300031730 Bacteria 5514
49 Ga0307518_10254109 3300031838 Bacteria 1114
50 Ga0307507_10016741 3300033179 Bacteria 8493
51 Ga0307507_10023497 3300033179 Bacteria 6765
52 Ga0307510_10012566 3300033180 Bacteria 10040
53 Ga0307510_10038237 3300033180 Bacteria 5308
54 Ga0307510_10102876 3300033180 Bacteria 2636
55 Ga0395901_0502074 3300038443 Bacteria 1235
56 Ga0439436_0000246 3300041404 Bacteria 13060
57 Ga0439436_0002239 3300041404 Bacteria 5786
58 Ga0439439_0014855 3300041406 Bacteria 1898
59 Ga0451837_0549339 3300041494 Bacteria 2369
60 Ga0439433_0005584 3300041999 Bacteria 2700
61 Ga0439449_0049830 3300042007 Bacteria 1549
62 Ga0439457_002765 3300042014 Bacteria 4918
63 Ga0439457_015596 3300042014 Bacteria 1696
64 Ga0450894_000255 3300042131 Bacteria 9558
65 Ga0450896_002783 3300042133 Bacteria 2281
66 Ga0450898_003767 3300042134 Bacteria 2198
67 Ga0450899_000819 3300042135 Bacteria 3545
68 Ga0450900_011369 3300042136 Bacteria 1156
69 Ga0450903_000350 3300042138 Bacteria 10149
70 Ga0450906_000820 3300042145 Bacteria 6849
71 Ga0439458_0000062 3300042157 Bacteria 18864
72 Ga0450908_014135 3300042184 Bacteria 1438
73 Ga0466972_0023145 3300044658 Bacteria 3091
74 Ga0466972_0026243 3300044658 Bacteria 2887
75 Ga0466972_0049657 3300044658 Bacteria 2026
76 Ga0466966_0004356 3300044684 Bacteria 9340
77 Ga0466961_0004861 3300044693 Bacteria 8454
78 Ga0466971_0035849 3300044719 Bacteria 2225
79 Ga0466968_0038486 3300044735 Bacteria 2010
80 Ga0466970_0007503 3300044765 Bacteria 5469
81 Ga0466970_0110906 3300044765 Bacteria 1498
82 Ga0466957_0165973 3300044842 Bacteria 1436
83 Ga0466960_0008452 3300044901 Bacteria 4216
84 Ga0466967_0026166 3300045976 Bacteria 4827
85 Ga0495617_008293 3300046452 Bacteria 3584
86 Ga0495592_0009845 3300046454 Bacteria 7196
87 Ga0495592_0161975 3300046454 Bacteria 1538
88 Ga0495603_0086350 3300046455 Bacteria 1836
89 Ga0495590_0042883 3300046457 Bacteria 1578
90 Ga0495629_0001089 3300046459 Bacteria 21534
91 Ga0495629_0022446 3300046459 Bacteria 4499
92 Ga0495629_0156488 3300046459 Bacteria 1583
93 Ga0495629_0207974 3300046459 Bacteria 1352
94 Ga0495638_0020614 3300046460 Bacteria 4354
95 Ga0495638_0039607 3300046460 Bacteria 2991
96 Ga0495638_0175415 3300046460 Bacteria 1227
97 Ga0495651_0007504 3300046462 Bacteria 8340
98 Ga0495653_0105401 3300046463 Bacteria 2036
99 Ga0495580_0162712 3300046472 Bacteria 1544
100 Ga0495582_0011130 3300046473 Bacteria 4954
101 Ga0495605_0006868 3300046474 Bacteria 6499
102 Ga0495662_0010622 3300046476 Bacteria 4503
103 Ga0495662_0094587 3300046476 Bacteria 1459
104 Ga0495664_0000616 3300046477 Bacteria 18085
105 Ga0495664_0044961 3300046477 Bacteria 2618
106 Ga0495594_0022436 3300046499 Bacteria 3377
107 Ga0495607_0228051 3300046501 Bacteria 907
108 Ga0495583_0027311 3300046506 Bacteria 2818
109 Ga0495606_0027238 3300046507 Bacteria 4057
110 Ga0495608_0058572 3300046511 Bacteria 2539
111 Ga0495616_0010834 3300046513 Bacteria 5255
112 Ga0495618_0024733 3300046514 Bacteria 3722
113 Ga0495620_0005765 3300046515 Bacteria 6879
114 Ga0495628_0033031 3300046516 Bacteria 4173
115 Ga0495630_0082278 3300046517 Bacteria 2430
116 Ga0495630_0419570 3300046517 Bacteria 1025
117 Ga0495631_0078096 3300046518 Bacteria 1429
118 Ga0495643_0023477 3300046522 Bacteria 3506
119 Ga0495643_0078591 3300046522 Bacteria 1721
120 Ga0495648_0031909 3300046524 Bacteria 3465
121 Ga0495652_0020430 3300046529 Bacteria 5887
122 Ga0495652_0068171 3300046529 Bacteria 2981
123 Ga0495652_0470353 3300046529 Bacteria 877
124 Ga0495640_0038662 3300046533 Bacteria 3355
125 Ga0495640_0058228 3300046533 Bacteria 2635
126 Ga0495609_0053147 3300046538 Bacteria 1801
127 Ga0495597_0043948 3300046542 Bacteria 1988
128 Ga0495645_0020223 3300046543 Bacteria 4800
129 Ga0495622_0037310 3300046557 Bacteria 2264
130 Ga0495668_0042318 3300046616 Bacteria 2536
131 Ga0495634_0001005 3300046642 Bacteria 26553
132 Ga0495634_0196218 3300046642 Bacteria 1256
133 Ga0495625_0005251 3300046660 Bacteria 11905
134 Ga0495625_0131665 3300046660 Bacteria 1694
135 Ga0495625_0289417 3300046660 Bacteria 1052
136 Ga0495635_0001170 3300046663 Bacteria 17491
137 Ga0495661_0026483 3300046665 Bacteria 3735
138 Ga0495588_0026426 3300046674 Bacteria 2897
139 Ga0495588_0197355 3300046674 Bacteria 1063
140 Ga0495657_0001985 3300046675 Bacteria 17443
141 Ga0495657_0037682 3300046675 Bacteria 3330
142 Ga0495599_0139650 3300046678 Bacteria 1503
143 Ga0495623_0034631 3300046679 Bacteria 3238
144 Ga0495646_0003220 3300046680 Bacteria 10149
145 Ga0495658_0019995 3300046683 Bacteria 3505
146 Ga0495613_0002233 3300046689 Bacteria 14652
147 Ga0495613_0004270 3300046689 Bacteria 10701
148 Ga0495624_0318086 3300046690 Bacteria 937
149 Ga0495670_0024834 3300046691 Bacteria 2962
150 Ga0495670_0233784 3300046691 Bacteria 978
151 Ga0495671_0002438 3300046692 Bacteria 11748
152 Ga0495671_0042228 3300046692 Bacteria 2293
153 Ga0495649_0018945 3300046694 Bacteria 3867
154 Ga0495649_0032625 3300046694 Bacteria 2867
155 Ga0495589_0009987 3300046794 Bacteria 4932
156 Ga0495589_0020412 3300046794 Bacteria 3388
157 Ga0495600_0159712 3300046809 Bacteria 1457
158 Ga0495660_0047569 3300046810 Bacteria 2348
159 Ga0495581_0004422 3300047315 Bacteria 8126
160 Ga0495604_0000237 3300047317 Bacteria 49264
161 Ga0495604_0074495 3300047317 Bacteria 2558
162 Ga0495636_0000447 3300047318 Bacteria 15227
163 Ga0495636_0044944 3300047318 Bacteria 1840
164 Ga0495636_0079618 3300047318 Bacteria 1409
165 Ga0495674_0091252 3300047319 Bacteria 2602
166 Ga0495674_0237412 3300047319 Bacteria 1503
167 Ga0495672_0095661 3300047320 Bacteria 1621
168 Ga0495676_0016481 3300047321 Bacteria 6556
169 Ga0495676_0040350 3300047321 Bacteria 3852
170 Ga0495680_0019877 3300047322 Bacteria 5661
171 Ga0495683_0015578 3300047323 Bacteria 3953
172 Ga0495687_000551 3300047443 Bacteria 44454
173 Ga0495687_015732 3300047443 Bacteria 3834
174 Ga0495687_020456 3300047443 Bacteria 3224
175 Ga0495675_0035709 3300047444 Bacteria 3174
176 Ga0495685_000880 3300047447 Bacteria 9169
177 Ga0495685_001572 3300047447 Bacteria 7027
178 Ga0495685_006258 3300047447 Bacteria 3891
179 Ga0495685_009895 3300047447 Bacteria 3192
180 Ga0495681_0000405 3300047470 Bacteria 33516
181 Ga0495681_0000617 3300047470 Bacteria 27221
182 Ga0495681_0042979 3300047470 Bacteria 2183
183 Ga0495684_0123812 3300047471 Bacteria 1946
184 Ga0495686_0022663 3300047472 Bacteria 4153
185 Ga0495686_0048098 3300047472 Bacteria 2690
186 Ga0495686_0104230 3300047472 Bacteria 1708
187 Ga0495593_0033495 3300047673 Bacteria 2797
188 Ga0495602_0137455 3300048088 Bacteria 1939
189 Ga0495614_0003140 3300048089 Bacteria 7366
190 Ga0495614_0026597 3300048089 Bacteria 2494
191 Ga0495626_0012766 3300048091 Bacteria 4387
192 Ga0495678_010135 3300049459 Bacteria 4597
193 Ga0501031_0021837 3300049568 Bacteria 4170
194 Ga0501032_0205427 3300049569 Bacteria 1285
195 Ga0501037_0116888 3300049573 Bacteria 1919
196 Ga0501038_0003491 3300049574 Bacteria 14650
197 Ga0501042_0040434 3300049578 Bacteria 3315
198 Ga0501046_0054012 3300049580 Bacteria 3162
199 Ga0501047_0000025 3300049581 Bacteria 225560
200 Ga0501047_0031786 3300049581 Bacteria 5092
201 Ga0501047_0037548 3300049581 Bacteria 4683
202 Ga0501047_0556223 3300049581 Bacteria 971
203 Ga0501070_0353866 3300049586 Bacteria 1192
204 Ga0501072_0497142 3300049588 Bacteria 965
205 Ga0501080_0330986 3300049742 Bacteria 1377
206 Ga0501035_0039551 3300049822 Bacteria 4267
207 Ga0501035_0050105 3300049822 Bacteria 3743
208 Ga0501044_0028161 3300049823 Bacteria 5930
209 Ga0501044_0319112 3300049823 Bacteria 1478
210 nmdc:mga03n38_5690_c1 3300050490 Bacteria 4267
211 nmdc:mga06z11_31041_c1 3300050494 Bacteria 2592
212 nmdc:mga04h51_32868_c1 3300050495 Bacteria 1648
213 Ga0500578_0118813 3300053086 Bacteria 1662
214 Ga0500644_0053569 3300053088 Bacteria 1393
215 Ga0500566_0023436 3300053094 Bacteria 3624
216 Ga0500640_001141 3300053095 Bacteria 7729
217 Ga0500654_038388 3300053099 Bacteria 2757
218 Ga0500660_041313 3300053100 Bacteria 2345
219 Ga0500553_117572 3300053101 Bacteria 1103
220 Ga0500569_036072 3300053109 Bacteria 1421
221 Ga0500614_011208 3300053123 Bacteria 1937
222 Ga0500628_052083 3300053129 Bacteria 974
223 Ga0500652_044264 3300053131 Bacteria 1801
224 Ga0500658_0113127 3300053134 Bacteria 1196
225 Ga0500561_0000796 3300053137 Bacteria 5018
226 Ga0500573_0231157 3300053140 Bacteria 964
227 Ga0500600_0003865 3300053149 Bacteria 8718
228 Ga0500600_0212328 3300053149 Bacteria 901
229 Ga0500616_0012075 3300053153 Bacteria 5068
230 Ga0500633_0015890 3300053160 Bacteria 2170
231 Ga0500634_0017484 3300053161 Bacteria 3838
232 Ga0466962_0063030 3300061719 Bacteria 1770
233 2547406967 2547132111 Bacteria 8013147
234 2585309228 2582581313 Bacteria 10042643
235 2585319786 2582581314 Bacteria 11452267
236 2616697678 2616644814 Bacteria 11555299
237 2644263242 2643221647 Bacteria 10741251
238 2644436545 2643221678 Bacteria 9540101
239 2644625610 2643221714 Bacteria 9015452
240 2785344105 2784746763 Bacteria 9783172
241 2785368768 2784746768 Bacteria 10036182
242 2786669874 2786546132 Bacteria 10419719
243 2793980714 2791355406 Bacteria 11364898
244 2808841437 2808606359 Bacteria 9866990
245 2808920003 2808606375 Bacteria 9466072
246 2811848393 2808606982 Bacteria 7791042
247 2812358809 2811994879 Bacteria 9313447
248 2852641905 2852635781 Bacteria 8251373
249 2862184770 2862178590 Bacteria 8583590
250 2862287945 2862281513 Bacteria 9621493
251 2862383067 2862382967 Bacteria 10317375
252 2862512974 2862507626 Bacteria 9425308
253 2862579845 2862574272 Bacteria 10567477
254 2863405368 2863404153 Bacteria 9672205
255 2867371297 2867369537 Bacteria 6501581
256 2867433728 2867428634 Bacteria 9590268
257 2873156445 2873151551 Bacteria 8625867
258 2877681747 2877676314 Bacteria 9512378
259 2912720717 2912715099 Bacteria 9460473
260 2912724865 2912723979 Bacteria 8557534
261 2912760061 2912757875 Bacteria 7940295
262 2919473555 2919468124 Bacteria 9133025
263 2946067063 2946064051 Bacteria 8957905
264 2946075365 2946072368 Bacteria 8999607
265 2947230172 2947224130 Bacteria 9938529
266 2954003381 2954002825 Bacteria 9173742
267 2954386888 2954380949 Bacteria 10050426
268 2954676303 2954673503 Bacteria 9685905
269 2954687866 2954682443 Bacteria 9862841
270 2954697706 2954691527 Bacteria 10720516
271 2954704510 2954701450 Bacteria 10834262
272 2954716843 2954711539 Bacteria 10867210
273 2954726791 2954721474 Bacteria 10456478
274 2954735005 2954731030 Bacteria 10243860
275 2954745714 2954740390 Bacteria 10229294
276 2954753876 2954749733 Bacteria 10366972
277 2954764687 2954759201 Bacteria 9358192
278 2990067204 2990059506 Bacteria 9321252
279 2997608038 2997600082 Bacteria 9896405
280 3006321747 3006321560 Bacteria 8247479
281 3006501503 3006493962 Bacteria 8825450
282 8008559717 8008558824 Bacteria 10610750
283 8033691064 8033684223 Bacteria 6906479
284 8047898736 8047893842 Bacteria 11723082
285 8048131532 8048127548 Bacteria 11053136
286 8048360182 8048356638 Bacteria 11044339
287 8048375698 8048369669 Bacteria 11666822
288 8048382507 8048379754 Bacteria 11877923
289 8048413360 8048406513 Bacteria 8936924
290 8056672415 8056667051 Bacteria 6953971
291 Ga0081455_10168532
292 Ga0006562J51391_1027449
293 Ga0006562J51391_1027450
294 Ga0070665_100027240
295 Ga0068856_100079446
296 Ga0075365_10060059
297 Ga0075363_100008583
298 Ga0075363_100065216
299 Ga0099826_10221614
300 Ga0105243_10100299
301 Ga0105246_10005287
302 Ga0105246_10181709
303 Ga0157372_10062316
304 Ga0182008_10001694
305 Ga0183367_1006
306 Ga0209758_1031337
307 Ga0207426_1006287
308 Ga0207647_10180089
309 Ga0207639_10051141
310 Ga0209371_1026350
311 Ga0209813_10032493
312 Ga0268266_10059129
313 Ga0307517_10006019
314 Ga0307517_10007126
315 Ga0307515_10000541
316 Ga0307515_10071365
317 Ga0268256_1029987
318 Ga0307511_10136376
319 Ga0307512_10009937
320 Ga0307512_10013559
321 Ga0307513_10028093
322 Ga0307513_10036414
323 Ga0307513_10214843
324 Ga0307509_10027249
325 Ga0307509_10132379
326 Ga0307508_10004446
327 Ga0307508_10007789
328 Ga0307508_10063533
329 Ga0307508_10100443
330 Ga0307508_10119577
331 Ga0307514_10021266
332 Ga0307514_10108479
333 Ga0307514_10124576
334 Ga0307514_10193085
335 Ga0307514_10278472
336 Ga0307516_10003518
337 Ga0307516_10026944
338 Ga0307516_10029793
339 Ga0307518_10254109
340 Ga0307507_10016741
341 Ga0307507_10023497
342 Ga0307510_10012566
343 Ga0307510_10038237
344 Ga0307510_10102876
345 Ga0395901_0502074
346 Ga0439436_0000246
347 Ga0439436_0002239
348 Ga0439439_0014855
349 Ga0451837_0549339
350 Ga0439433_0005584
351 Ga0439449_0049830
352 Ga0439457_002765
353 Ga0439457_015596
354 Ga0450894_000255
355 Ga0450896_002783
356 Ga0450898_003767
357 Ga0450899_000819
358 Ga0450900_011369
359 Ga0450903_000350
360 Ga0450906_000820
361 Ga0439458_0000062
362 Ga0450908_014135
363 Ga0466972_0023145
364 Ga0466972_0026243
365 Ga0466972_0049657
366 Ga0466966_0004356
367 Ga0466961_0004861
368 Ga0466971_0035849
369 Ga0466968_0038486
370 Ga0466970_0007503
371 Ga0466970_0110906
372 Ga0466957_0165973
373 Ga0466960_0008452
374 Ga0466967_0026166
375 Ga0495617_008293
376 Ga0495592_0009845
377 Ga0495592_0161975
378 Ga0495603_0086350
379 Ga0495590_0042883
380 Ga0495629_0001089
381 Ga0495629_0022446
382 Ga0495629_0156488
383 Ga0495629_0207974
384 Ga0495638_0020614
385 Ga0495638_0039607
386 Ga0495638_0175415
387 Ga0495651_0007504
388 Ga0495653_0105401
389 Ga0495580_0162712
390 Ga0495582_0011130
391 Ga0495605_0006868
392 Ga0495662_0010622
393 Ga0495662_0094587
394 Ga0495664_0000616
395 Ga0495664_0044961
396 Ga0495594_0022436
397 Ga0495607_0228051
398 Ga0495583_0027311
399 Ga0495606_0027238
400 Ga0495608_0058572
401 Ga0495616_0010834
402 Ga0495618_0024733
403 Ga0495620_0005765
404 Ga0495628_0033031
405 Ga0495630_0082278
406 Ga0495630_0419570
407 Ga0495631_0078096
408 Ga0495643_0023477
409 Ga0495643_0078591
410 Ga0495648_0031909
411 Ga0495652_0020430
412 Ga0495652_0068171
413 Ga0495652_0470353
414 Ga0495640_0038662
415 Ga0495640_0058228
416 Ga0495609_0053147
417 Ga0495597_0043948
418 Ga0495645_0020223
419 Ga0495622_0037310
420 Ga0495668_0042318
421 Ga0495634_0001005
422 Ga0495634_0196218
423 Ga0495625_0005251
424 Ga0495625_0131665
425 Ga0495625_0289417
426 Ga0495635_0001170
427 Ga0495661_0026483
428 Ga0495588_0026426
429 Ga0495588_0197355
430 Ga0495657_0001985
431 Ga0495657_0037682
432 Ga0495599_0139650
433 Ga0495623_0034631
434 Ga0495646_0003220
435 Ga0495658_0019995
436 Ga0495613_0002233
437 Ga0495613_0004270
438 Ga0495624_0318086
439 Ga0495670_0024834
440 Ga0495670_0233784
441 Ga0495671_0002438
442 Ga0495671_0042228
443 Ga0495649_0018945
444 Ga0495649_0032625
445 Ga0495589_0009987
446 Ga0495589_0020412
447 Ga0495600_0159712
448 Ga0495660_0047569
449 Ga0495581_0004422
450 Ga0495604_0000237
451 Ga0495604_0074495
452 Ga0495636_0000447
453 Ga0495636_0044944
454 Ga0495636_0079618
455 Ga0495674_0091252
456 Ga0495674_0237412
457 Ga0495672_0095661
458 Ga0495676_0016481
459 Ga0495676_0040350
460 Ga0495680_0019877
461 Ga0495683_0015578
462 Ga0495687_000551
463 Ga0495687_015732
464 Ga0495687_020456
465 Ga0495675_0035709
466 Ga0495685_000880
467 Ga0495685_001572
468 Ga0495685_006258
469 Ga0495685_009895
470 Ga0495681_0000405
471 Ga0495681_0000617
472 Ga0495681_0042979
473 Ga0495684_0123812
474 Ga0495686_0022663
475 Ga0495686_0048098
476 Ga0495686_0104230
477 Ga0495593_0033495
478 Ga0495602_0137455
479 Ga0495614_0003140
480 Ga0495614_0026597
481 Ga0495626_0012766
482 Ga0495678_010135
483 Ga0501031_0021837
484 Ga0501032_0205427
485 Ga0501037_0116888
486 Ga0501038_0003491
487 Ga0501042_0040434
488 Ga0501046_0054012
489 Ga0501047_0000025
490 Ga0501047_0031786
491 Ga0501047_0037548
492 Ga0501047_0556223
493 Ga0501070_0353866
494 Ga0501072_0497142
495 Ga0501080_0330986
496 Ga0501035_0039551
497 Ga0501035_0050105
498 Ga0501044_0028161
499 Ga0501044_0319112
500 nmdc:mga03n38_5690_c1
501 nmdc:mga06z11_31041_c1
502 nmdc:mga04h51_32868_c1
503 Ga0500578_0118813
504 Ga0500644_0053569
505 Ga0500566_0023436
506 Ga0500640_001141
507 Ga0500654_038388
508 Ga0500660_041313
509 Ga0500553_117572
510 Ga0500569_036072
511 Ga0500614_011208
512 Ga0500628_052083
513 Ga0500652_044264
514 Ga0500658_0113127
515 Ga0500561_0000796
516 Ga0500573_0231157
517 Ga0500600_0003865
518 Ga0500600_0212328
519 Ga0500616_0012075
520 Ga0500633_0015890
521 Ga0500634_0017484
522 Ga0466962_0063030
523 2547406967
524 2585309228
525 2585319786
526 2616697678
527 2644263242
528 2644436545
529 2644625610
530 2785344105
531 2785368768
532 2786669874
533 2793980714
534 2808841437
535 2808920003
536 2811848393
537 2812358809
538 2852641905
539 2862184770
540 2862287945
541 2862383067
542 2862512974
543 2862579845
544 2863405368
545 2867371297
546 2867433728
547 2873156445
548 2877681747
549 2912720717
550 2912724865
551 2912760061
552 2919473555
553 2946067063
554 2946075365
555 2947230172
556 2954003381
557 2954386888
558 2954676303
559 2954687866
560 2954697706
561 2954704510
562 2954716843
563 2954726791
564 2954735005
565 2954745714
566 2954753876
567 2954764687
568 2990067204
569 2997608038
570 3006321747
571 3006501503
572 8008559717
573 8033691064
574 8047898736
575 8048131532
576 8048360182
577 8048375698
578 8048382507
579 8048413360
580 8056672415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

19

263

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqk-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate 0.8539 1 261
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.8535 1 261
2qum-assembly1.cif.gz_B crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii with d-tagatose 0.8528 2 258
4pfh-assembly1.cif.gz_B crystal structure of engineered d-tagatose 3-epimerase pcdte-idf8 0.8493 2 259
3cqk-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate 0.848 1 261
ID Description Score Start End Superfamily
3vnmD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8459 1 258 3.20.20.150
4xslC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8441 2 262 3.20.20.150
4xslC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8382 2 262 3.20.20.150
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8363 2 261 3.20.20.150
3cqiB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8333 1 261 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A6G3DCZ8-F1-model_v4 TIM barrel protein 0.9996 139 262
AF-A0A6I5CBP4-F1-model_v4 TIM barrel protein 0.9965 111 262
AF-A0A542HMJ9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.993 1 262 GO:0016853
AF-A0A6I5C3N8-F1-model_v4 TIM barrel protein 0.9926 1 95
AF-A0A6I5NES9-F1-model_v4 deleted 0.9919 74 262

Map