F389511

General Info

Members Datasets Scaffolds Average Seq Length
289 214 578 177

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006486233|3006493900
Length 180
Sequence ASGVRKSLAKVEVALRWDPSPAGTPPNDLDIVAAVYGAADPYGQPVQVVHFGSRSPDGTITLNRDSRTGQGFGHDEVMVLELDRMRPESVRVVVGVLIQDAGPRGGHRKTFAAIGGTGVRIREGHSDLAVTDFAAVPHATAATVARFTRDGAGCWLLDTAVQGFDADAEEFVRAMGAERH

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
11 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
38 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
39 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
46 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
47 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
48 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
49 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
50 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
51 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
52 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
56 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
57 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
61 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
62 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
63 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
64 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
65 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
66 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
67 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
137 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
157 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
160 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
161 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
162 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
163 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
164 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
165 2643221647 Streptomyces sp. Root369 Isolate Unclassified
166 2643221670 Streptomyces sp. Root431 Isolate Unclassified
167 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
168 2643221714 Streptomyces sp. Root264 Isolate Unclassified
169 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
170 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
171 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
172 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
173 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
174 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
175 2808606448 Streptomyces sp. 193411 Isolate Unclassified
176 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
177 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
178 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
179 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
180 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
181 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
182 2862574272 Streptomyces sp. AcE210 Isolate Nodule
183 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
184 2867369537 Streptomyces sp. Z26 Isolate Unclassified
185 2867428634 Streptomyces sp. RP5T Isolate Unclassified
186 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
187 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
188 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
189 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
190 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
191 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
192 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
193 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
194 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
195 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
196 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
197 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
198 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
199 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
200 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
201 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
202 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
203 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
204 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
205 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
206 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
207 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
208 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
209 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
210 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
211 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
212 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
213 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
214 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.93
Metatranscriptomes 0.69
Isolates 19.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 1.04
Rhizoplane 0.69
Rhizosphere 75.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10030629 3300002067 Bacteria 1598
2 rootH1_10078465 3300003316 Bacteria 2390
3 rootH2_10051043 3300003320 Bacteria 6972
4 rootL2_10040677 3300003322 Bacteria 8308
5 rootL2_10124234 3300003322 Bacteria 1332
6 rootH1_10029713 3300003323 Bacteria 3782
7 rootH1_10082725 3300003323 Bacteria 2604
8 Ga0006562J51391_1191639 3300003578 Bacteria 764
9 Ga0070683_100110239 3300005329 Bacteria 2596
10 Ga0068853_101135079 3300005539 Bacteria 754
11 Ga0075365_10599632 3300006038 Bacteria 779
12 Ga0075370_10204281 3300006353 Bacteria 1166
13 Ga0099826_10137280 3300006948 Bacteria 1418
14 Ga0105244_10067959 3300009036 Bacteria 1782
15 Ga0105245_10334487 3300009098 Bacteria 1496
16 Ga0105239_11015393 3300010375 Bacteria 954
17 Ga0157369_10168414 3300013105 Bacteria 2309
18 Ga0157372_10113158 3300013307 Bacteria 3110
19 Ga0182008_10003472 3300014497 Bacteria 9508
20 Ga0182007_10000461 3300015262 Bacteria 24586
21 Ga0183367_1019 3300015688 Bacteria 100516
22 Ga0209758_1001363 3300025297 Bacteria 29239
23 Ga0207426_1003121 3300025302 Bacteria 9445
24 Ga0207426_1043329 3300025302 Bacteria 1383
25 Ga0207647_10004230 3300025904 Bacteria 10639
26 Ga0207687_10328587 3300025927 Bacteria 1240
27 Ga0207709_10181441 3300025935 Bacteria 1487
28 Ga0207661_10338658 3300025944 Bacteria 1355
29 Ga0207702_11053185 3300026078 Bacteria 807
30 Ga0207674_10366745 3300026116 Bacteria 1392
31 Ga0207674_11076596 3300026116 Bacteria 773
32 Ga0209813_10337097 3300027866 Bacteria 594
33 Ga0307515_10007489 3300028794 Bacteria 21571
34 Ga0307515_10018493 3300028794 Bacteria 12602
35 Ga0307511_10161018 3300030521 Bacteria 1260
36 Ga0307512_10006501 3300030522 Bacteria 11827
37 Ga0307513_10006299 3300031456 Bacteria 15544
38 Ga0307509_10009981 3300031507 Bacteria 11726
39 Ga0307508_10028679 3300031616 Bacteria 5032
40 Ga0307514_10003493 3300031649 Bacteria 15072
41 Ga0307516_10016314 3300031730 Bacteria 7773
42 Ga0307516_10237066 3300031730 Bacteria 1525
43 Ga0307405_10194160 3300031731 Bacteria 1469
44 Ga0307507_10144103 3300033179 Bacteria 1816
45 Ga0307510_10079678 3300033180 Bacteria 3191
46 Ga0307510_10107988 3300033180 Bacteria 2539
47 Ga0307510_10216528 3300033180 Bacteria 1431
48 Ga0395900_0057727 3300037418 Bacteria 3996
49 Ga0395900_0780793 3300037418 Bacteria 884
50 Ga0395898_0002468 3300037466 Bacteria 21814
51 Ga0395898_0003982 3300037466 Bacteria 16260
52 Ga0395898_0317308 3300037466 Bacteria 1487
53 Ga0395898_0444494 3300037466 Bacteria 1235
54 Ga0395905_0886274 3300037471 Bacteria 795
55 Ga0395901_0414418 3300038443 Bacteria 1382
56 Ga0439436_0004156 3300041404 Bacteria 4437
57 Ga0439439_0012710 3300041406 Bacteria 2038
58 Ga0451789_0664541 3300041443 Bacteria 658
59 Ga0451795_0293980 3300041456 Bacteria 1803
60 Ga0451833_0107976 3300041491 Bacteria 906
61 Ga0451835_0008613 3300041492 Bacteria 1133
62 Ga0451837_1176593 3300041494 Bacteria 3748
63 Ga0451839_1501497 3300041496 Bacteria 1221
64 Ga0451849_1168535 3300041505 Bacteria 1245
65 Ga0451853_0583806 3300041512 Bacteria 5296
66 Ga0451853_3156304 3300041512 Bacteria 4442
67 Ga0451853_3487188 3300041512 Bacteria 1106
68 Ga0451853_3503045 3300041512 Bacteria 1632
69 Ga0439433_0022668 3300041999 Bacteria 1410
70 Ga0439433_0141455 3300041999 Bacteria 616
71 Ga0439442_014051 3300042002 Bacteria 1647
72 Ga0439448_0038492 3300042005 Bacteria 1539
73 Ga0439454_019167 3300042011 Bacteria 993
74 Ga0439455_0055320 3300042012 Bacteria 1043
75 Ga0439455_0081198 3300042012 Bacteria 881
76 Ga0439457_002113 3300042014 Bacteria 5780
77 Ga0450894_000126 3300042131 Bacteria 13227
78 Ga0450896_000099 3300042133 Bacteria 6168
79 Ga0450898_002804 3300042134 Bacteria 2447
80 Ga0450899_000588 3300042135 Bacteria 4140
81 Ga0450903_001310 3300042138 Bacteria 4656
82 Ga0450903_012123 3300042138 Bacteria 1379
83 Ga0450906_000297 3300042145 Bacteria 9985
84 Ga0439458_0000345 3300042157 Bacteria 11592
85 Ga0450908_002612 3300042184 Bacteria 3534
86 Ga0466969_0025212 3300044656 Bacteria 3059
87 Ga0466972_0000956 3300044658 Bacteria 13908
88 Ga0466972_0001106 3300044658 Bacteria 12903
89 Ga0466972_0088560 3300044658 Bacteria 1469
90 Ga0466965_0145218 3300044683 Bacteria 1237
91 Ga0466966_0002018 3300044684 Bacteria 13169
92 Ga0466966_0028583 3300044684 Bacteria 3630
93 Ga0466961_0001016 3300044693 Bacteria 17332
94 Ga0466961_0456025 3300044693 Bacteria 773
95 Ga0466963_0001521 3300044694 Bacteria 12555
96 Ga0466971_0022148 3300044719 Bacteria 2829
97 Ga0466970_0029732 3300044765 Bacteria 2878
98 Ga0466970_0113497 3300044765 Bacteria 1480
99 Ga0466957_0000945 3300044842 Bacteria 14884
100 Ga0466960_0001403 3300044901 Bacteria 8761
101 Ga0466960_0205794 3300044901 Bacteria 1077
102 Ga0466959_0281812 3300045049 Bacteria 1140
103 Ga0466958_0000675 3300045836 Bacteria 14793
104 Ga0466967_0066621 3300045976 Bacteria 3209
105 Ga0466967_0081762 3300045976 Bacteria 2918
106 Ga0495617_012546 3300046452 Bacteria 2889
107 Ga0495603_0018182 3300046455 Bacteria 4252
108 Ga0495603_0021740 3300046455 Bacteria 3884
109 Ga0495603_0156306 3300046455 Bacteria 1323
110 Ga0495629_0001280 3300046459 Bacteria 19767
111 Ga0495629_0013133 3300046459 Bacteria 5982
112 Ga0495629_0040255 3300046459 Bacteria 3287
113 Ga0495629_0286091 3300046459 Bacteria 1130
114 Ga0495629_0903830 3300046459 Bacteria 579
115 Ga0495638_0032083 3300046460 Bacteria 3370
116 Ga0495580_0176588 3300046472 Bacteria 1475
117 Ga0495605_0012784 3300046474 Bacteria 4646
118 Ga0495662_0025051 3300046476 Bacteria 2880
119 Ga0495662_0036884 3300046476 Bacteria 2359
120 Ga0495662_0075873 3300046476 Bacteria 1631
121 Ga0495664_0195203 3300046477 Bacteria 1227
122 Ga0495585_0017080 3300046492 Bacteria 4199
123 Ga0495585_0054786 3300046492 Bacteria 2204
124 Ga0495594_0000488 3300046499 Bacteria 20249
125 Ga0495583_0047571 3300046506 Bacteria 1971
126 Ga0495606_0021816 3300046507 Bacteria 4684
127 Ga0495608_0082106 3300046511 Bacteria 2093
128 Ga0495610_0066497 3300046512 Bacteria 1697
129 Ga0495616_0024789 3300046513 Bacteria 3212
130 Ga0495618_0211281 3300046514 Bacteria 1226
131 Ga0495620_0008057 3300046515 Bacteria 5671
132 Ga0495628_0229085 3300046516 Bacteria 1393
133 Ga0495630_0103557 3300046517 Bacteria 2154
134 Ga0495631_0007658 3300046518 Bacteria 5485
135 Ga0495631_0086973 3300046518 Bacteria 1346
136 Ga0495637_0216553 3300046520 Bacteria 698
137 Ga0495643_0005709 3300046522 Bacteria 8331
138 Ga0495648_0239208 3300046524 Bacteria 883
139 Ga0495666_0007175 3300046526 Bacteria 5594
140 Ga0495652_0363037 3300046529 Bacteria 1034
141 Ga0495640_0009613 3300046533 Bacteria 7520
142 Ga0495609_0023794 3300046538 Bacteria 2812
143 Ga0495609_0172244 3300046538 Bacteria 914
144 Ga0495622_0001945 3300046557 Bacteria 10157
145 Ga0495622_0007416 3300046557 Bacteria 5088
146 Ga0495633_0005894 3300046558 Bacteria 7369
147 Ga0495634_0179638 3300046642 Bacteria 1325
148 Ga0495611_0044006 3300046648 Bacteria 1996
149 Ga0495611_0094621 3300046648 Bacteria 1382
150 Ga0495625_0037120 3300046660 Bacteria 3576
151 Ga0495625_0129202 3300046660 Bacteria 1712
152 Ga0495661_0033252 3300046665 Bacteria 3253
153 Ga0495588_0017970 3300046674 Bacteria 3443
154 Ga0495588_0033667 3300046674 Bacteria 2588
155 Ga0495657_0001882 3300046675 Bacteria 17849
156 Ga0495657_0102792 3300046675 Bacteria 1818
157 Ga0495613_0010841 3300046689 Bacteria 6762
158 Ga0495613_0042829 3300046689 Bacteria 3348
159 Ga0495613_0286160 3300046689 Bacteria 1143
160 Ga0495670_0200712 3300046691 Bacteria 1056
161 Ga0495671_0011726 3300046692 Bacteria 4807
162 Ga0495649_0157729 3300046694 Bacteria 1190
163 Ga0495649_0235003 3300046694 Bacteria 945
164 Ga0495589_0009979 3300046794 Bacteria 4933
165 Ga0495589_0027358 3300046794 Bacteria 2883
166 Ga0495589_0053995 3300046794 Bacteria 1982
167 Ga0495600_0122545 3300046809 Bacteria 1691
168 Ga0495581_0031334 3300047315 Bacteria 3082
169 Ga0495581_0415606 3300047315 Bacteria 784
170 Ga0495636_0004467 3300047318 Bacteria 5479
171 Ga0495636_0029539 3300047318 Bacteria 2238
172 Ga0495636_0136741 3300047318 Bacteria 1092
173 Ga0495636_0421493 3300047318 Bacteria 638
174 Ga0495672_0068735 3300047320 Bacteria 2013
175 Ga0495676_0044745 3300047321 Bacteria 3610
176 Ga0495676_0059726 3300047321 Bacteria 2992
177 Ga0495676_0083652 3300047321 Bacteria 2410
178 Ga0495676_0125604 3300047321 Bacteria 1859
179 Ga0495676_0174486 3300047321 Bacteria 1510
180 Ga0495676_0573250 3300047321 Bacteria 736
181 Ga0495680_0027284 3300047322 Bacteria 4693
182 Ga0495683_0177630 3300047323 Bacteria 974
183 Ga0495687_003063 3300047443 Bacteria 12533
184 Ga0495687_039589 3300047443 Bacteria 2084
185 Ga0495687_085337 3300047443 Bacteria 1224
186 Ga0495687_139197 3300047443 Bacteria 847
187 Ga0495679_041653 3300047446 Bacteria 1421
188 Ga0495685_008941 3300047447 Bacteria 3339
189 Ga0495685_010286 3300047447 Bacteria 3135
190 Ga0495685_048592 3300047447 Bacteria 1442
191 Ga0495681_0156811 3300047470 Bacteria 951
192 Ga0495686_0092313 3300047472 Bacteria 1836
193 Ga0495686_0247769 3300047472 Bacteria 1002
194 Ga0495593_0270333 3300047673 Bacteria 850
195 Ga0495602_0409249 3300048088 Bacteria 966
196 Ga0495614_0009019 3300048089 Bacteria 4425
197 Ga0495626_0211925 3300048091 Bacteria 790
198 Ga0501308_054045 3300049128 Bacteria 594
199 Ga0495678_027733 3300049459 Bacteria 2399
200 Ga0501032_0287891 3300049569 Bacteria 1063
201 Ga0501033_0006164 3300049570 Bacteria 9401
202 Ga0501033_0038082 3300049570 Bacteria 3597
203 Ga0501033_0273166 3300049570 Bacteria 1194
204 Ga0501034_0004275 3300049571 Bacteria 15928
205 Ga0501034_0090751 3300049571 Bacteria 3053
206 Ga0501036_0011380 3300049572 Bacteria 7362
207 Ga0501036_0069639 3300049572 Bacteria 2975
208 Ga0501038_0003967 3300049574 Bacteria 13745
209 Ga0501038_0065692 3300049574 Bacteria 3090
210 Ga0501038_0238288 3300049574 Bacteria 1445
211 Ga0501039_0002683 3300049575 Bacteria 13280
212 Ga0501043_0001700 3300049579 Bacteria 19050
213 Ga0501043_0080512 3300049579 Bacteria 2559
214 Ga0501047_0191009 3300049581 Bacteria 1911
215 Ga0501047_0717722 3300049581 Bacteria 817
216 Ga0501068_0226209 3300049584 Bacteria 1189
217 Ga0501070_0000559 3300049586 Bacteria 33924
218 Ga0501070_0613597 3300049586 Bacteria 866
219 Ga0501074_0027286 3300049590 Bacteria 4140
220 Ga0501035_0001289 3300049822 Bacteria 25877
221 Ga0501035_0046283 3300049822 Bacteria 3913
222 Ga0501044_0002062 3300049823 Bacteria 23165
223 Ga0501044_0029717 3300049823 Bacteria 5762
224 Ga0501044_0146265 3300049823 Bacteria 2348
225 Ga0501044_0411233 3300049823 Bacteria 1264
226 nmdc:mga0yw44_150606_c1 3300050492 Bacteria 1517
227 nmdc:mga06z11_27072_c1 3300050494 Bacteria 2738
228 nmdc:mga04h51_372567_c1 3300050495 Bacteria 594
229 nmdc:mga07m45_145325_c1 3300050496 Bacteria 1374
230 nmdc:mga07m45_73808_c1 3300050496 Bacteria 1942
231 Ga0500578_0361935 3300053086 Bacteria 845
232 Ga0500600_0181559 3300053149 Bacteria 1012
233 Ga0466962_0001941 3300061719 Bacteria 9745
234 3006493900 3006486233 Bacteria 8157040
235 2547407293 2547132111 Bacteria 8013147
236 2585310054 2582581313 Bacteria 10042643
237 2616699300 2616644814 Bacteria 11555299
238 2616905103 2616644941 Bacteria 8510691
239 2643943020 2643221587 Bacteria 7586415
240 2644267075 2643221647 Bacteria 10741251
241 2644388467 2643221670 Bacteria 6497041
242 2644442313 2643221678 Bacteria 9540101
243 2644626439 2643221714 Bacteria 9015452
244 2784590785 2784132148 Bacteria 8627943
245 2785340773 2784746763 Bacteria 9783172
246 2785371998 2784746768 Bacteria 10036182
247 2786673114 2786546132 Bacteria 10419719
248 2808844501 2808606359 Bacteria 9866990
249 2808914073 2808606375 Bacteria 9466072
250 2809234533 2808606448 Bacteria 8656184
251 2812355528 2811994879 Bacteria 9313447
252 2812478374 2811994917 Bacteria 7761064
253 2819697720 2818991463 Bacteria 7948711
254 2852641586 2852635781 Bacteria 8251373
255 2862284185 2862281513 Bacteria 9621493
256 2862510577 2862507626 Bacteria 9425308
257 2862577016 2862574272 Bacteria 10567477
258 2863409065 2863404153 Bacteria 9672205
259 2867374219 2867369537 Bacteria 6501581
260 2867430435 2867428634 Bacteria 9590268
261 2873153674 2873151551 Bacteria 8625867
262 2875397144 2875391855 Bacteria 7600475
263 2877678576 2877676314 Bacteria 9512378
264 2912717158 2912715099 Bacteria 9460473
265 2912729759 2912723979 Bacteria 8557534
266 2918506964 2918501144 Bacteria 8668083
267 2919474137 2919468124 Bacteria 9133025
268 2946070279 2946064051 Bacteria 8957905
269 2946078150 2946072368 Bacteria 8999607
270 2954010655 2954002825 Bacteria 9173742
271 2954383547 2954380949 Bacteria 10050426
272 2954679430 2954673503 Bacteria 9685905
273 2954684726 2954682443 Bacteria 9862841
274 2954694339 2954691527 Bacteria 10720516
275 2954709542 2954701450 Bacteria 10834262
276 2954723815 2954721474 Bacteria 10456478
277 2954738020 2954731030 Bacteria 10243860
278 2954742715 2954740390 Bacteria 10229294
279 2954756879 2954749733 Bacteria 10366972
280 2966600451 2966598605 Bacteria 7676064
281 2990067420 2990059506 Bacteria 9321252
282 3006399315 3006393351 Bacteria 6615579
283 3006494145 3006493962 Bacteria 8825450
284 8008563229 8008558824 Bacteria 10610750
285 8008576738 8008574985 Bacteria 7815457
286 8023627612 8023623736 Bacteria 8593882
287 8025480608 8025478263 Bacteria 8209203
288 8048408732 8048406513 Bacteria 8936924
289 8056830076 8056829672 Bacteria 9045328
290 JGI24735J21928_10030629
291 rootH1_10078465
292 rootH2_10051043
293 rootL2_10040677
294 rootL2_10124234
295 rootH1_10029713
296 rootH1_10082725
297 Ga0006562J51391_1191639
298 Ga0070683_100110239
299 Ga0068853_101135079
300 Ga0075365_10599632
301 Ga0075370_10204281
302 Ga0099826_10137280
303 Ga0105244_10067959
304 Ga0105245_10334487
305 Ga0105239_11015393
306 Ga0157369_10168414
307 Ga0157372_10113158
308 Ga0182008_10003472
309 Ga0182007_10000461
310 Ga0183367_1019
311 Ga0209758_1001363
312 Ga0207426_1003121
313 Ga0207426_1043329
314 Ga0207647_10004230
315 Ga0207687_10328587
316 Ga0207709_10181441
317 Ga0207661_10338658
318 Ga0207702_11053185
319 Ga0207674_10366745
320 Ga0207674_11076596
321 Ga0209813_10337097
322 Ga0307515_10007489
323 Ga0307515_10018493
324 Ga0307511_10161018
325 Ga0307512_10006501
326 Ga0307513_10006299
327 Ga0307509_10009981
328 Ga0307508_10028679
329 Ga0307514_10003493
330 Ga0307516_10016314
331 Ga0307516_10237066
332 Ga0307405_10194160
333 Ga0307507_10144103
334 Ga0307510_10079678
335 Ga0307510_10107988
336 Ga0307510_10216528
337 Ga0395900_0057727
338 Ga0395900_0780793
339 Ga0395898_0002468
340 Ga0395898_0003982
341 Ga0395898_0317308
342 Ga0395898_0444494
343 Ga0395905_0886274
344 Ga0395901_0414418
345 Ga0439436_0004156
346 Ga0439439_0012710
347 Ga0451789_0664541
348 Ga0451795_0293980
349 Ga0451833_0107976
350 Ga0451835_0008613
351 Ga0451837_1176593
352 Ga0451839_1501497
353 Ga0451849_1168535
354 Ga0451853_0583806
355 Ga0451853_3156304
356 Ga0451853_3487188
357 Ga0451853_3503045
358 Ga0439433_0022668
359 Ga0439433_0141455
360 Ga0439442_014051
361 Ga0439448_0038492
362 Ga0439454_019167
363 Ga0439455_0055320
364 Ga0439455_0081198
365 Ga0439457_002113
366 Ga0450894_000126
367 Ga0450896_000099
368 Ga0450898_002804
369 Ga0450899_000588
370 Ga0450903_001310
371 Ga0450903_012123
372 Ga0450906_000297
373 Ga0439458_0000345
374 Ga0450908_002612
375 Ga0466969_0025212
376 Ga0466972_0000956
377 Ga0466972_0001106
378 Ga0466972_0088560
379 Ga0466965_0145218
380 Ga0466966_0002018
381 Ga0466966_0028583
382 Ga0466961_0001016
383 Ga0466961_0456025
384 Ga0466963_0001521
385 Ga0466971_0022148
386 Ga0466970_0029732
387 Ga0466970_0113497
388 Ga0466957_0000945
389 Ga0466960_0001403
390 Ga0466960_0205794
391 Ga0466959_0281812
392 Ga0466958_0000675
393 Ga0466967_0066621
394 Ga0466967_0081762
395 Ga0495617_012546
396 Ga0495603_0018182
397 Ga0495603_0021740
398 Ga0495603_0156306
399 Ga0495629_0001280
400 Ga0495629_0013133
401 Ga0495629_0040255
402 Ga0495629_0286091
403 Ga0495629_0903830
404 Ga0495638_0032083
405 Ga0495580_0176588
406 Ga0495605_0012784
407 Ga0495662_0025051
408 Ga0495662_0036884
409 Ga0495662_0075873
410 Ga0495664_0195203
411 Ga0495585_0017080
412 Ga0495585_0054786
413 Ga0495594_0000488
414 Ga0495583_0047571
415 Ga0495606_0021816
416 Ga0495608_0082106
417 Ga0495610_0066497
418 Ga0495616_0024789
419 Ga0495618_0211281
420 Ga0495620_0008057
421 Ga0495628_0229085
422 Ga0495630_0103557
423 Ga0495631_0007658
424 Ga0495631_0086973
425 Ga0495637_0216553
426 Ga0495643_0005709
427 Ga0495648_0239208
428 Ga0495666_0007175
429 Ga0495652_0363037
430 Ga0495640_0009613
431 Ga0495609_0023794
432 Ga0495609_0172244
433 Ga0495622_0001945
434 Ga0495622_0007416
435 Ga0495633_0005894
436 Ga0495634_0179638
437 Ga0495611_0044006
438 Ga0495611_0094621
439 Ga0495625_0037120
440 Ga0495625_0129202
441 Ga0495661_0033252
442 Ga0495588_0017970
443 Ga0495588_0033667
444 Ga0495657_0001882
445 Ga0495657_0102792
446 Ga0495613_0010841
447 Ga0495613_0042829
448 Ga0495613_0286160
449 Ga0495670_0200712
450 Ga0495671_0011726
451 Ga0495649_0157729
452 Ga0495649_0235003
453 Ga0495589_0009979
454 Ga0495589_0027358
455 Ga0495589_0053995
456 Ga0495600_0122545
457 Ga0495581_0031334
458 Ga0495581_0415606
459 Ga0495636_0004467
460 Ga0495636_0029539
461 Ga0495636_0136741
462 Ga0495636_0421493
463 Ga0495672_0068735
464 Ga0495676_0044745
465 Ga0495676_0059726
466 Ga0495676_0083652
467 Ga0495676_0125604
468 Ga0495676_0174486
469 Ga0495676_0573250
470 Ga0495680_0027284
471 Ga0495683_0177630
472 Ga0495687_003063
473 Ga0495687_039589
474 Ga0495687_085337
475 Ga0495687_139197
476 Ga0495679_041653
477 Ga0495685_008941
478 Ga0495685_010286
479 Ga0495685_048592
480 Ga0495681_0156811
481 Ga0495686_0092313
482 Ga0495686_0247769
483 Ga0495593_0270333
484 Ga0495602_0409249
485 Ga0495614_0009019
486 Ga0495626_0211925
487 Ga0501308_054045
488 Ga0495678_027733
489 Ga0501032_0287891
490 Ga0501033_0006164
491 Ga0501033_0038082
492 Ga0501033_0273166
493 Ga0501034_0004275
494 Ga0501034_0090751
495 Ga0501036_0011380
496 Ga0501036_0069639
497 Ga0501038_0003967
498 Ga0501038_0065692
499 Ga0501038_0238288
500 Ga0501039_0002683
501 Ga0501043_0001700
502 Ga0501043_0080512
503 Ga0501047_0191009
504 Ga0501047_0717722
505 Ga0501068_0226209
506 Ga0501070_0000559
507 Ga0501070_0613597
508 Ga0501074_0027286
509 Ga0501035_0001289
510 Ga0501035_0046283
511 Ga0501044_0002062
512 Ga0501044_0029717
513 Ga0501044_0146265
514 Ga0501044_0411233
515 nmdc:mga0yw44_150606_c1
516 nmdc:mga06z11_27072_c1
517 nmdc:mga04h51_372567_c1
518 nmdc:mga07m45_145325_c1
519 nmdc:mga07m45_73808_c1
520 Ga0500578_0361935
521 Ga0500600_0181559
522 Ga0466962_0001941
523 3006493900
524 2547407293
525 2585310054
526 2616699300
527 2616905103
528 2643943020
529 2644267075
530 2644388467
531 2644442313
532 2644626439
533 2784590785
534 2785340773
535 2785371998
536 2786673114
537 2808844501
538 2808914073
539 2809234533
540 2812355528
541 2812478374
542 2819697720
543 2852641586
544 2862284185
545 2862510577
546 2862577016
547 2863409065
548 2867374219
549 2867430435
550 2873153674
551 2875397144
552 2877678576
553 2912717158
554 2912729759
555 2918506964
556 2919474137
557 2946070279
558 2946078150
559 2954010655
560 2954383547
561 2954679430
562 2954684726
563 2954694339
564 2954709542
565 2954723815
566 2954738020
567 2954742715
568 2954756879
569 2966600451
570 2990067420
571 3006399315
572 3006494145
573 8008563229
574 8008576738
575 8023627612
576 8025480608
577 8048408732
578 8056830076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02342

TerD

TerD domain

2

174

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qng-assembly1.cif.gz_A crystal structure of unknown function protein sav2460 0.9779 6 175
2qz7-assembly2.cif.gz_B the crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2) 0.9727 7 172
2qng-assembly1.cif.gz_A crystal structure of unknown function protein sav2460 0.9722 6 175
2qz7-assembly2.cif.gz_B the crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2) 0.9502 7 172
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8731 6 175
ID Description Score Start End Superfamily
2qz7B01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9715 7 169 2.60.60.30
2qz7B01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9598 7 169 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8867 7 160 2.60.60.30
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.845 8 156 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8167 7 160 2.60.60.30
ID Description Score Start End GO Terms
AF-A0A6B3D154-F1-model_v4 TerD family protein 0.9859 66 147
AF-A0A3N6H4T5-F1-model_v4 Bacterial stress protein 0.9782 7 176
AF-A0A561TCE3-F1-model_v4 Stress response protein SCP2 0.978 1 177
AF-A0A0M9Y587-F1-model_v4 deleted 0.9759 8 175
AF-H0BR65-F1-model_v4 Putative TerD-family protein 0.9757 5 175

Map