F389401

General Info

Members Datasets Scaffolds Average Seq Length
289 197 578 302

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0020101|Ga0496113_0020101_291_1334
Length 347
Sequence MPVTQQVQRVKGREIRYMVRLMTAGLPPYERGPLMLQSPIARTDEASAAVAESLFVTAQDGLKLHVRAYGEHAHRRGLAARLPVVCLPGLARTATDFETIALALANDRERPRHVFALDYRGRGRSDYDRRPANYNVQVELADVLAVLTALGIACAVFIGTSRGGILTMLLAAARPTAIAGCVLNDIGPVIELKGLMRIKSYVGKLPRPASFHEAADILRRLFASQFPKWGDDDWVAFARSTFKEADGRIVPDYDPRLATTLKSINSDRPLPSLWKEFDALGRLPMLVIRGTNSDLLSPETVEVMRTRHCDLELFEVPDEGHAPRLSAPETVRRIADFVARCDQVGTA

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
93 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2508501050 Microvirga lupini Lut6 Isolate Nodule
197 2775506901 Microvirga ossetica V5/3m Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0.35
Rhizoplane 12.46
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0020101 3300048916 Bacteria 4687
2 Ga0070670_100266626 3300005331 Bacteria 1494
3 Ga0070682_100240350 3300005337 Bacteria 1300
4 Ga0068868_100165527 3300005338 Bacteria 1828
5 Ga0070689_100331699 3300005340 Bacteria 1273
6 Ga0070691_10135018 3300005341 Bacteria 1253
7 Ga0070661_100228410 3300005344 Bacteria 1430
8 Ga0070675_100348559 3300005354 Bacteria 1313
9 Ga0070714_100028608 3300005435 Bacteria 4626
10 Ga0070711_100012045 3300005439 Bacteria 5391
11 Ga0070711_100057981 3300005439 Bacteria 2683
12 Ga0070663_100019033 3300005455 Bacteria 4515
13 Ga0070681_10397199 3300005458 Bacteria 1290
14 Ga0068867_100479236 3300005459 Bacteria 1066
15 Ga0070685_10089739 3300005466 Bacteria 1858
16 Ga0070706_100124644 3300005467 Bacteria 2402
17 Ga0070698_100143341 3300005471 Bacteria 2339
18 Ga0070699_100136435 3300005518 Bacteria 2164
19 Ga0070697_100533875 3300005536 Unclassified 1028
20 Ga0070686_100257838 3300005544 Bacteria 1277
21 Ga0070696_100267961 3300005546 Bacteria 1298
22 Ga0070693_100233336 3300005547 Bacteria 1212
23 Ga0070702_100223459 3300005615 Bacteria 1261
24 Ga0068866_10108430 3300005718 Bacteria 1545
25 Ga0081455_10021038 3300005937 Bacteria 6126
26 Ga0081455_10023210 3300005937 Bacteria 5778
27 Ga0081455_10047908 3300005937 Bacteria 3697
28 Ga0081455_10067670 3300005937 Bacteria 2976
29 Ga0081455_10075243 3300005937 Bacteria 2786
30 Ga0081455_10219463 3300005937 Bacteria 1410
31 Ga0081455_10236473 3300005937 Unclassified 1345
32 Ga0081538_10027920 3300005981 Bacteria 3896
33 Ga0081540_1094710 3300005983 Bacteria 1304
34 Ga0070717_10001406 3300006028 Bacteria 16594
35 Ga0070717_10027774 3300006028 Unclassified 4524
36 Ga0075365_10053732 3300006038 Bacteria 2669
37 Ga0075432_10012068 3300006058 Bacteria 2936
38 Ga0070715_10042119 3300006163 Bacteria 1917
39 Ga0070716_100002272 3300006173 Bacteria 8851
40 Ga0070712_100044234 3300006175 Bacteria 3070
41 Ga0097621_100089089 3300006237 Bacteria 2579
42 Ga0097621_100128266 3300006237 Bacteria 2156
43 Ga0097621_100480502 3300006237 Bacteria 1123
44 Ga0068871_100061212 3300006358 Bacteria 3073
45 Ga0075428_100016439 3300006844 Bacteria 8173
46 Ga0075428_100467293 3300006844 Bacteria 1351
47 Ga0075430_100000809 3300006846 Bacteria 24373
48 Ga0075431_100006890 3300006847 Bacteria 11294
49 Ga0075431_100058684 3300006847 Bacteria 3972
50 Ga0075433_10000188 3300006852 Bacteria 34583
51 Ga0075433_10310378 3300006852 Bacteria 1396
52 Ga0075434_100006524 3300006871 Bacteria 10701
53 Ga0075434_100020895 3300006871 Bacteria 6357
54 Ga0075434_100148020 3300006871 Bacteria 2368
55 Ga0075434_100336125 3300006871 Bacteria 1531
56 Ga0075429_100004610 3300006880 Bacteria 11857
57 Ga0068865_100207687 3300006881 Bacteria 1524
58 Ga0075435_100031157 3300007076 Bacteria 4199
59 Ga0075435_100060743 3300007076 Bacteria 3065
60 Ga0075435_100062960 3300007076 Bacteria 3012
61 Ga0075435_100113910 3300007076 Bacteria 2251
62 Ga0105251_10152497 3300009011 Bacteria 1043
63 Ga0111539_10004095 3300009094 Bacteria 19127
64 Ga0111539_10280760 3300009094 Bacteria 1938
65 Ga0105245_10100613 3300009098 Bacteria 2674
66 Ga0105245_10356123 3300009098 Bacteria 1451
67 Ga0114129_10025715 3300009147 Bacteria 8339
68 Ga0114129_10040334 3300009147 Bacteria 6581
69 Ga0105243_10177359 3300009148 Bacteria 1850
70 Ga0105248_10491293 3300009177 Bacteria 1384
71 Ga0105237_10172491 3300009545 Bacteria 2163
72 Ga0105249_10099801 3300009553 Bacteria 2729
73 Ga0099796_10006070 3300010159 Bacteria 3070
74 Ga0105246_10091061 3300011119 Bacteria 2197
75 Ga0157374_10159815 3300013296 Bacteria 2195
76 Ga0157378_10100706 3300013297 Bacteria 2638
77 Ga0157378_10377852 3300013297 Bacteria 1391
78 Ga0163162_10094052 3300013306 Bacteria 3083
79 Ga0157375_10030281 3300013308 Bacteria 5101
80 Ga0157375_10187945 3300013308 Bacteria 2220
81 Ga0163163_10083085 3300014325 Bacteria 3207
82 Ga0157380_10036345 3300014326 Bacteria 3810
83 Ga0157376_10019123 3300014969 Bacteria 5271
84 Ga0157376_10416169 3300014969 Bacteria 1303
85 Ga0207653_10021101 3300025885 Bacteria 2065
86 Ga0207710_10003854 3300025900 Bacteria 6630
87 Ga0207688_10096232 3300025901 Bacteria 1705
88 Ga0207680_10290513 3300025903 Bacteria 1138
89 Ga0207699_10000587 3300025906 Bacteria 17874
90 Ga0207707_10257602 3300025912 Bacteria 1514
91 Ga0207693_10075897 3300025915 Bacteria 2633
92 Ga0207693_10084196 3300025915 Bacteria 2492
93 Ga0207663_10108087 3300025916 Bacteria 1883
94 Ga0207652_10462956 3300025921 Bacteria 1143
95 Ga0207700_10002667 3300025928 Bacteria 10278
96 Ga0207700_10024332 3300025928 Unclassified 4190
97 Ga0207664_10040970 3300025929 Bacteria 3606
98 Ga0207664_10118424 3300025929 Bacteria 2212
99 Ga0207644_10003336 3300025931 Bacteria 10355
100 Ga0207709_10098454 3300025935 Bacteria 1928
101 Ga0207704_10002693 3300025938 Bacteria 8016
102 Ga0207665_10001229 3300025939 Bacteria 17287
103 Ga0207665_10089670 3300025939 Bacteria 2130
104 Ga0207711_10009288 3300025941 Bacteria 8210
105 Ga0207661_10297848 3300025944 Bacteria 1445
106 Ga0207679_10101557 3300025945 Bacteria 2250
107 Ga0207712_10050530 3300025961 Bacteria 2903
108 Ga0207668_10205388 3300025972 Bacteria 1572
109 Ga0207703_10015325 3300026035 Bacteria 5980
110 Ga0207678_10014031 3300026067 Bacteria 7045
111 Ga0207708_10299875 3300026075 Bacteria 1307
112 Ga0207702_10160968 3300026078 Bacteria 2050
113 Ga0207648_10076064 3300026089 Bacteria 2926
114 Ga0207676_10092581 3300026095 Bacteria 2486
115 Ga0207683_10324477 3300026121 Bacteria 1411
116 Ga0209998_10010199 3300027717 Bacteria 1945
117 Ga0207428_10000292 3300027907 Bacteria 67070
118 Ga0268266_10023335 3300028379 Bacteria 5267
119 Ga0373934_0040047 3300035086 Bacteria 1848
120 Ga0373944_0032494 3300035089 Bacteria 1576
121 Ga0373949_0040716 3300035090 Bacteria 1141
122 Ga0373951_0013554 3300035091 Bacteria 1832
123 Ga0373932_0008145 3300035112 Bacteria 2502
124 Ga0373932_0038189 3300035112 Bacteria 1372
125 Ga0373932_0041789 3300035112 Bacteria 1326
126 Ga0373939_0015679 3300035114 Bacteria 1987
127 Ga0373939_0016605 3300035114 Bacteria 1944
128 Ga0373939_0020741 3300035114 Unclassified 1790
129 Ga0373941_0035607 3300035115 Bacteria 1509
130 Ga0373945_0047744 3300035116 Bacteria 1566
131 Ga0373954_0021270 3300035118 Bacteria 2937
132 Ga0373956_0102724 3300035119 Bacteria 1327
133 Ga0373957_0003477 3300035120 Bacteria 4660
134 Ga0373960_0029249 3300035121 Bacteria 1526
135 Ga0373943_0010785 3300035170 Bacteria 4102
136 Ga0373943_0068618 3300035170 Bacteria 1790
137 Ga0373955_0009613 3300035172 Bacteria 4538
138 Ga0373961_0041151 3300035241 Unclassified 1334
139 Ga0373931_0009549 3300035691 Unclassified 4640
140 Ga0373935_0170491 3300035692 Bacteria 1488
141 Ga0373935_0312382 3300035692 Bacteria 1113
142 Ga0373927_0002642 3300035695 Bacteria 13053
143 Ga0373927_0016851 3300035695 Bacteria 4818
144 Ga0373927_0105257 3300035695 Bacteria 1837
145 Ga0373927_0112965 3300035695 Bacteria 1770
146 Ga0373933_0020116 3300035724 Bacteria 3781
147 Ga0373947_0003106 3300035725 Bacteria 9889
148 Ga0373947_0035783 3300035725 Unclassified 2941
149 Ga0373937_0104781 3300036401 Bacteria 2627
150 Ga0373925_0034041 3300037068 Bacteria 3755
151 Ga0395900_0024017 3300037418 Bacteria 6238
152 Ga0395900_0169019 3300037418 Bacteria 2227
153 Ga0395898_0059066 3300037466 Bacteria 3732
154 Ga0395898_0070786 3300037466 Bacteria 3371
155 Ga0436364_0318172 3300037853 Bacteria 79481
156 Ga0395901_0004944 3300038443 Bacteria 13452
157 Ga0395901_0419958 3300038443 Bacteria 1372
158 Ga0436361_0656294 3300039447 Unclassified 2734
159 Ga0451576_0069831 3300045051 Bacteria 3656
160 Ga0495603_0032587 3300046455 Unclassified 3135
161 Ga0495603_0162903 3300046455 Bacteria 1293
162 Ga0495603_0202231 3300046455 Unclassified 1148
163 Ga0495629_0001462 3300046459 Bacteria 18609
164 Ga0495629_0018918 3300046459 Bacteria 4924
165 Ga0495629_0038248 3300046459 Bacteria 3380
166 Ga0495641_0054649 3300046461 Unclassified 1814
167 Ga0495641_0085643 3300046461 Bacteria 1410
168 Ga0495651_0001089 3300046462 Bacteria 20919
169 Ga0495653_0060846 3300046463 Bacteria 2859
170 Ga0495582_0049854 3300046473 Bacteria 2306
171 Ga0495639_0118418 3300046475 Bacteria 1262
172 Ga0495662_0017000 3300046476 Bacteria 3520
173 Ga0495664_0019547 3300046477 Bacteria 3896
174 Ga0495664_0030306 3300046477 Bacteria 3168
175 Ga0495594_0047876 3300046499 Bacteria 2348
176 Ga0495594_0054453 3300046499 Bacteria 2205
177 Ga0495608_0019591 3300046511 Bacteria 4655
178 Ga0495618_0084236 3300046514 Bacteria 2031
179 Ga0495628_0132132 3300046516 Bacteria 1908
180 Ga0495630_0033035 3300046517 Bacteria 3858
181 Ga0495630_0144119 3300046517 Bacteria 1811
182 Ga0495666_0031512 3300046526 Bacteria 2597
183 Ga0495652_0028578 3300046529 Bacteria 4904
184 Ga0495640_0029316 3300046533 Bacteria 3952
185 Ga0495586_0192737 3300046535 Bacteria 1154
186 Ga0495587_0128744 3300046536 Bacteria 1447
187 Ga0495645_0193656 3300046543 Bacteria 1383
188 Ga0495622_0133984 3300046557 Bacteria 1127
189 Ga0495667_0100408 3300046559 Bacteria 1872
190 Ga0495635_0121829 3300046663 Bacteria 1778
191 Ga0495657_0259912 3300046675 Bacteria 1043
192 Ga0495599_0023535 3300046678 Bacteria 3851
193 Ga0495623_0006149 3300046679 Bacteria 7803
194 Ga0495647_0030173 3300046681 Unclassified 2010
195 Ga0495658_0004637 3300046683 Bacteria 6759
196 Ga0495658_0035573 3300046683 Bacteria 2741
197 Ga0495613_0147088 3300046689 Bacteria 1681
198 Ga0495624_0082958 3300046690 Unclassified 1983
199 Ga0495624_0094403 3300046690 Bacteria 1844
200 Ga0495581_0043101 3300047315 Bacteria 2611
201 Ga0495604_0045961 3300047317 Bacteria 3405
202 Ga0495674_0072487 3300047319 Bacteria 2970
203 Ga0495680_0011357 3300047322 Bacteria 7887
204 Ga0495680_0053188 3300047322 Bacteria 3153
205 Ga0495675_0017226 3300047444 Bacteria 4577
206 Ga0495684_0056258 3300047471 Bacteria 2999
207 Ga0495684_0098535 3300047471 Bacteria 2210
208 Ga0495593_0177674 3300047673 Bacteria 1072
209 Ga0495593_0182286 3300047673 Bacteria 1057
210 Ga0495602_0046404 3300048088 Bacteria 3924
211 Ga0496100_0005274 3300048903 Bacteria 6943
212 Ga0496100_0005304 3300048903 Bacteria 6927
213 Ga0496101_0087908 3300048904 Bacteria 2307
214 Ga0496101_0176125 3300048904 Bacteria 1645
215 Ga0496101_0279765 3300048904 Bacteria 1304
216 Ga0496102_0199389 3300048905 Bacteria 1886
217 Ga0496102_0383535 3300048905 Bacteria 1322
218 Ga0496103_0004912 3300048906 Bacteria 8071
219 Ga0496103_0227726 3300048906 Bacteria 1199
220 Ga0496104_0085180 3300048907 Bacteria 3016
221 Ga0496104_0387791 3300048907 Bacteria 1309
222 Ga0496105_0017499 3300048908 Bacteria 5748
223 Ga0496105_0043022 3300048908 Bacteria 3725
224 Ga0496105_0067210 3300048908 Bacteria 2959
225 Ga0496105_0214045 3300048908 Bacteria 1570
226 Ga0496105_0220979 3300048908 Bacteria 1542
227 Ga0496107_0009342 3300048910 Bacteria 6797
228 Ga0496107_0122210 3300048910 Bacteria 1918
229 Ga0496107_0378194 3300048910 Bacteria 1053
230 Ga0496108_0014171 3300048911 Bacteria 6504
231 Ga0496108_0032933 3300048911 Bacteria 4305
232 Ga0496108_0102060 3300048911 Bacteria 2447
233 Ga0496108_0234414 3300048911 Bacteria 1596
234 Ga0496108_0457375 3300048911 Unclassified 1115
235 Ga0496109_0031575 3300048912 Bacteria 4754
236 Ga0496109_0262616 3300048912 Bacteria 1626
237 Ga0496110_0070459 3300048913 Bacteria 3098
238 Ga0496111_0004780 3300048914 Bacteria 8593
239 Ga0496112_0046395 3300048915 Bacteria 4261
240 Ga0496114_0081170 3300048917 Bacteria 2739
241 Ga0496115_0014580 3300048918 Bacteria 5950
242 Ga0496115_0047656 3300048918 Bacteria 3427
243 Ga0496115_0065031 3300048918 Bacteria 2945
244 Ga0496115_0109951 3300048918 Bacteria 2264
245 Ga0496115_0264956 3300048918 Bacteria 1413
246 Ga0501034_0191808 3300049571 Bacteria 2005
247 Ga0501042_0365456 3300049578 Bacteria 1044
248 Ga0501047_0082660 3300049581 Bacteria 3087
249 Ga0501068_0206731 3300049584 Bacteria 1246
250 Ga0501077_0124524 3300049593 Bacteria 1634
251 Ga0501079_0099232 3300049741 Bacteria 2257
252 Ga0501080_0097243 3300049742 Bacteria 2733
253 Ga0501083_0310300 3300049744 Bacteria 1026
254 Ga0501044_0250104 3300049823 Bacteria 1714
255 nmdc:mga03683_13575_c1 3300050489 Bacteria 3001
256 nmdc:mga03n38_41785_c1 3300050490 Bacteria 1700
257 nmdc:mga0yw44_17278_c1 3300050492 Bacteria 3264
258 nmdc:mga0yw44_37305_c1 3300050492 Bacteria 2869
259 nmdc:mga06z11_31563_c1 3300050494 Bacteria 2575
260 nmdc:mga05p37_135242_c1 3300050507 Bacteria 3024
261 nmdc:mga05p37_780_c1 3300050507 Bacteria 35436
262 nmdc:mga09592_105027_c1 3300050508 Bacteria 2421
263 nmdc:mga09592_9094_c1 3300050508 Bacteria 8077
264 nmdc:mga0qj67_1411_c1 3300050509 Bacteria 16809
265 nmdc:mga0qj67_265021_c1 3300050509 Unclassified 1393
266 nmdc:mga06r32_1067_c1 3300050510 Bacteria 24630
267 nmdc:mga06r32_21847_c1 3300050510 Bacteria 5909
268 nmdc:mga08y16_174484_c1 3300050511 Bacteria 2232
269 nmdc:mga08y16_7900_c1 3300050511 Bacteria 11133
270 nmdc:mga0n895_23965_c1 3300050512 Bacteria 5745
271 nmdc:mga0n895_26281_c1 3300050512 Bacteria 5511
272 nmdc:mga0n895_45389_c1 3300050512 Bacteria 4288
273 nmdc:mga0n895_477782_c1 3300050512 Bacteria 1257
274 nmdc:mga0n895_9935_c1 3300050512 Bacteria 8372
275 nmdc:mga0rr50_106715_c1 3300050513 Bacteria 2210
276 nmdc:mga0rr50_117330_c1 3300050513 Bacteria 2114
277 nmdc:mga0rr50_43369_c1 3300050513 Bacteria 3291
278 nmdc:mga0rr50_5045_c1 3300050513 Bacteria 7826
279 nmdc:mga08x19_46298_c1 3300050514 Bacteria 2781
280 nmdc:mga0a205_113988_c1 3300050515 Plasmid 2602
281 nmdc:mga0a205_28111_c1 3300050515 Bacteria 5374
282 nmdc:mga0a205_780_c1 3300050515 Bacteria 25831
283 Ga0495601_0002031 3300053077 Bacteria 11361
284 Ga0495595_0125596 3300053084 Bacteria 1251
285 Ga0495619_0000798 3300053085 Bacteria 20628
286 Ga0495619_0003574 3300053085 Bacteria 10026
287 Ga0501082_0373263 3300060353 Unclassified 1244
288 2508732620 2508501050 Bacteria 9633614
289 2776259487 2775506901 Bacteria 9631051
290 Ga0496113_0020101
291 Ga0070670_100266626
292 Ga0070682_100240350
293 Ga0068868_100165527
294 Ga0070689_100331699
295 Ga0070691_10135018
296 Ga0070661_100228410
297 Ga0070675_100348559
298 Ga0070714_100028608
299 Ga0070711_100012045
300 Ga0070711_100057981
301 Ga0070663_100019033
302 Ga0070681_10397199
303 Ga0068867_100479236
304 Ga0070685_10089739
305 Ga0070706_100124644
306 Ga0070698_100143341
307 Ga0070699_100136435
308 Ga0070697_100533875
309 Ga0070686_100257838
310 Ga0070696_100267961
311 Ga0070693_100233336
312 Ga0070702_100223459
313 Ga0068866_10108430
314 Ga0081455_10021038
315 Ga0081455_10023210
316 Ga0081455_10047908
317 Ga0081455_10067670
318 Ga0081455_10075243
319 Ga0081455_10219463
320 Ga0081455_10236473
321 Ga0081538_10027920
322 Ga0081540_1094710
323 Ga0070717_10001406
324 Ga0070717_10027774
325 Ga0075365_10053732
326 Ga0075432_10012068
327 Ga0070715_10042119
328 Ga0070716_100002272
329 Ga0070712_100044234
330 Ga0097621_100089089
331 Ga0097621_100128266
332 Ga0097621_100480502
333 Ga0068871_100061212
334 Ga0075428_100016439
335 Ga0075428_100467293
336 Ga0075430_100000809
337 Ga0075431_100006890
338 Ga0075431_100058684
339 Ga0075433_10000188
340 Ga0075433_10310378
341 Ga0075434_100006524
342 Ga0075434_100020895
343 Ga0075434_100148020
344 Ga0075434_100336125
345 Ga0075429_100004610
346 Ga0068865_100207687
347 Ga0075435_100031157
348 Ga0075435_100060743
349 Ga0075435_100062960
350 Ga0075435_100113910
351 Ga0105251_10152497
352 Ga0111539_10004095
353 Ga0111539_10280760
354 Ga0105245_10100613
355 Ga0105245_10356123
356 Ga0114129_10025715
357 Ga0114129_10040334
358 Ga0105243_10177359
359 Ga0105248_10491293
360 Ga0105237_10172491
361 Ga0105249_10099801
362 Ga0099796_10006070
363 Ga0105246_10091061
364 Ga0157374_10159815
365 Ga0157378_10100706
366 Ga0157378_10377852
367 Ga0163162_10094052
368 Ga0157375_10030281
369 Ga0157375_10187945
370 Ga0163163_10083085
371 Ga0157380_10036345
372 Ga0157376_10019123
373 Ga0157376_10416169
374 Ga0207653_10021101
375 Ga0207710_10003854
376 Ga0207688_10096232
377 Ga0207680_10290513
378 Ga0207699_10000587
379 Ga0207707_10257602
380 Ga0207693_10075897
381 Ga0207693_10084196
382 Ga0207663_10108087
383 Ga0207652_10462956
384 Ga0207700_10002667
385 Ga0207700_10024332
386 Ga0207664_10040970
387 Ga0207664_10118424
388 Ga0207644_10003336
389 Ga0207709_10098454
390 Ga0207704_10002693
391 Ga0207665_10001229
392 Ga0207665_10089670
393 Ga0207711_10009288
394 Ga0207661_10297848
395 Ga0207679_10101557
396 Ga0207712_10050530
397 Ga0207668_10205388
398 Ga0207703_10015325
399 Ga0207678_10014031
400 Ga0207708_10299875
401 Ga0207702_10160968
402 Ga0207648_10076064
403 Ga0207676_10092581
404 Ga0207683_10324477
405 Ga0209998_10010199
406 Ga0207428_10000292
407 Ga0268266_10023335
408 Ga0373934_0040047
409 Ga0373944_0032494
410 Ga0373949_0040716
411 Ga0373951_0013554
412 Ga0373932_0008145
413 Ga0373932_0038189
414 Ga0373932_0041789
415 Ga0373939_0015679
416 Ga0373939_0016605
417 Ga0373939_0020741
418 Ga0373941_0035607
419 Ga0373945_0047744
420 Ga0373954_0021270
421 Ga0373956_0102724
422 Ga0373957_0003477
423 Ga0373960_0029249
424 Ga0373943_0010785
425 Ga0373943_0068618
426 Ga0373955_0009613
427 Ga0373961_0041151
428 Ga0373931_0009549
429 Ga0373935_0170491
430 Ga0373935_0312382
431 Ga0373927_0002642
432 Ga0373927_0016851
433 Ga0373927_0105257
434 Ga0373927_0112965
435 Ga0373933_0020116
436 Ga0373947_0003106
437 Ga0373947_0035783
438 Ga0373937_0104781
439 Ga0373925_0034041
440 Ga0395900_0024017
441 Ga0395900_0169019
442 Ga0395898_0059066
443 Ga0395898_0070786
444 Ga0436364_0318172
445 Ga0395901_0004944
446 Ga0395901_0419958
447 Ga0436361_0656294
448 Ga0451576_0069831
449 Ga0495603_0032587
450 Ga0495603_0162903
451 Ga0495603_0202231
452 Ga0495629_0001462
453 Ga0495629_0018918
454 Ga0495629_0038248
455 Ga0495641_0054649
456 Ga0495641_0085643
457 Ga0495651_0001089
458 Ga0495653_0060846
459 Ga0495582_0049854
460 Ga0495639_0118418
461 Ga0495662_0017000
462 Ga0495664_0019547
463 Ga0495664_0030306
464 Ga0495594_0047876
465 Ga0495594_0054453
466 Ga0495608_0019591
467 Ga0495618_0084236
468 Ga0495628_0132132
469 Ga0495630_0033035
470 Ga0495630_0144119
471 Ga0495666_0031512
472 Ga0495652_0028578
473 Ga0495640_0029316
474 Ga0495586_0192737
475 Ga0495587_0128744
476 Ga0495645_0193656
477 Ga0495622_0133984
478 Ga0495667_0100408
479 Ga0495635_0121829
480 Ga0495657_0259912
481 Ga0495599_0023535
482 Ga0495623_0006149
483 Ga0495647_0030173
484 Ga0495658_0004637
485 Ga0495658_0035573
486 Ga0495613_0147088
487 Ga0495624_0082958
488 Ga0495624_0094403
489 Ga0495581_0043101
490 Ga0495604_0045961
491 Ga0495674_0072487
492 Ga0495680_0011357
493 Ga0495680_0053188
494 Ga0495675_0017226
495 Ga0495684_0056258
496 Ga0495684_0098535
497 Ga0495593_0177674
498 Ga0495593_0182286
499 Ga0495602_0046404
500 Ga0496100_0005274
501 Ga0496100_0005304
502 Ga0496101_0087908
503 Ga0496101_0176125
504 Ga0496101_0279765
505 Ga0496102_0199389
506 Ga0496102_0383535
507 Ga0496103_0004912
508 Ga0496103_0227726
509 Ga0496104_0085180
510 Ga0496104_0387791
511 Ga0496105_0017499
512 Ga0496105_0043022
513 Ga0496105_0067210
514 Ga0496105_0214045
515 Ga0496105_0220979
516 Ga0496107_0009342
517 Ga0496107_0122210
518 Ga0496107_0378194
519 Ga0496108_0014171
520 Ga0496108_0032933
521 Ga0496108_0102060
522 Ga0496108_0234414
523 Ga0496108_0457375
524 Ga0496109_0031575
525 Ga0496109_0262616
526 Ga0496110_0070459
527 Ga0496111_0004780
528 Ga0496112_0046395
529 Ga0496114_0081170
530 Ga0496115_0014580
531 Ga0496115_0047656
532 Ga0496115_0065031
533 Ga0496115_0109951
534 Ga0496115_0264956
535 Ga0501034_0191808
536 Ga0501042_0365456
537 Ga0501047_0082660
538 Ga0501068_0206731
539 Ga0501077_0124524
540 Ga0501079_0099232
541 Ga0501080_0097243
542 Ga0501083_0310300
543 Ga0501044_0250104
544 nmdc:mga03683_13575_c1
545 nmdc:mga03n38_41785_c1
546 nmdc:mga0yw44_17278_c1
547 nmdc:mga0yw44_37305_c1
548 nmdc:mga06z11_31563_c1
549 nmdc:mga05p37_135242_c1
550 nmdc:mga05p37_780_c1
551 nmdc:mga09592_105027_c1
552 nmdc:mga09592_9094_c1
553 nmdc:mga0qj67_1411_c1
554 nmdc:mga0qj67_265021_c1
555 nmdc:mga06r32_1067_c1
556 nmdc:mga06r32_21847_c1
557 nmdc:mga08y16_174484_c1
558 nmdc:mga08y16_7900_c1
559 nmdc:mga0n895_23965_c1
560 nmdc:mga0n895_26281_c1
561 nmdc:mga0n895_45389_c1
562 nmdc:mga0n895_477782_c1
563 nmdc:mga0n895_9935_c1
564 nmdc:mga0rr50_106715_c1
565 nmdc:mga0rr50_117330_c1
566 nmdc:mga0rr50_43369_c1
567 nmdc:mga0rr50_5045_c1
568 nmdc:mga08x19_46298_c1
569 nmdc:mga0a205_113988_c1
570 nmdc:mga0a205_28111_c1
571 nmdc:mga0a205_780_c1
572 Ga0495601_0002031
573 Ga0495595_0125596
574 Ga0495619_0000798
575 Ga0495619_0003574
576 Ga0501082_0373263
577 2508732620
578 2776259487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

79

304

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

83

328

0.74

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

84

334

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9316 8 295
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9253 8 295
4ose-assembly1.cif.gz_A x-ray crystal structure of a putative hydrolase from rickettsia typhi 0.8938 1 295
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8649 16 138
4ose-assembly1.cif.gz_A x-ray crystal structure of a putative hydrolase from rickettsia typhi 0.8635 1 295
ID Description Score Start End Superfamily
4oseB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9343 23 295 3.40.50.1820
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9172 11 295 3.40.50.1820
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9044 11 295 3.40.50.1820
af_A0A0R0EQP0_201_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8739 31 138 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8703 16 133 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4D7BMS4-F1-model_v4 Alpha/beta hydrolase 0.9773 8 297 GO:0016787
AF-A0A1M5GRT0-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9755 12 295
AF-A0A6N8DKA4-F1-model_v4 Alpha/beta fold hydrolase 0.9688 2 294 GO:0016787
AF-A0A4D7BMS4-F1-model_v4 Alpha/beta hydrolase 0.9674 8 297 GO:0016787
AF-A0A317DZK5-F1-model_v4 Alpha/beta hydrolase 0.9625 11 297 GO:0016020
GO:0016787

Map