F389332

General Info

Members Datasets Scaffolds Average Seq Length
289 170 578 190

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0051452|Ga0453683_0051452_1641_2258
Length 205
Sequence MTKQELLVDFIISLDGFAAAEGWPGWWGLEGPEYLAWLGQSPERDYTILMGANTYRLMYGFASQSGTSESDLRSEEDASMTELTNTSKVVFSSTLQSPLPWANTRLISGDAVEAVRTMKREGTSPMRTLGSLSLCRSLLKAGLVDRFRVVVFPVITGSTGYERIYDGYPDVALDMVASRTFDGRLQLLEYVPRVLAGPPGANSGS

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
105 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
106 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
107 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
168 2808606394 Promicromonospora sp. C35 Isolate Unclassified
169 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
170 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0.35
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0.35
Rhizoplane 3.46
Rhizosphere 92.04
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0051452 3300044673 Bacteria 2580
2 JGI24738J21930_10025629 3300002075 Bacteria 1211
3 JGI24744J21845_10018098 3300002077 Bacteria 1398
4 JGI25406J46586_10060881 3300003203 Bacteria 1219
5 Ga0065704_10026965 3300005289 Bacteria 1287
6 Ga0070658_10083327 3300005327 Bacteria 2628
7 Ga0070683_100013749 3300005329 Bacteria 7066
8 Ga0070683_100480319 3300005329 Bacteria 1187
9 Ga0070683_100558495 3300005329 Bacteria 1095
10 Ga0070670_100209541 3300005331 Bacteria 1694
11 Ga0070682_100036347 3300005337 Bacteria 3011
12 Ga0070682_101279604 3300005337 Unclassified 622
13 Ga0068868_100318804 3300005338 Bacteria 1324
14 Ga0070660_100029812 3300005339 Bacteria 4091
15 Ga0070689_100281368 3300005340 Bacteria 1380
16 Ga0070691_10027649 3300005341 Bacteria 2648
17 Ga0070692_10019394 3300005345 Bacteria 3282
18 Ga0070675_100120980 3300005354 Bacteria 2224
19 Ga0070674_100269836 3300005356 Bacteria 1344
20 Ga0070659_100458744 3300005366 Bacteria 1082
21 Ga0070709_11018642 3300005434 Unclassified 659
22 Ga0070701_10028669 3300005438 Bacteria 2738
23 Ga0070700_100060772 3300005441 Bacteria 2382
24 Ga0070700_100086873 3300005441 Bacteria 2031
25 Ga0070678_100009962 3300005456 Bacteria 5781
26 Ga0070678_101159543 3300005456 Bacteria 715
27 Ga0070662_100058510 3300005457 Bacteria 2805
28 Ga0068867_100130768 3300005459 Bacteria 1950
29 Ga0070685_10120281 3300005466 Bacteria 1630
30 Ga0070698_100001196 3300005471 Bacteria 28804
31 Ga0070698_100742086 3300005471 Bacteria 925
32 Ga0070684_100053468 3300005535 Bacteria 3516
33 Ga0068853_100453666 3300005539 Bacteria 1206
34 Ga0070672_100133480 3300005543 Bacteria 2042
35 Ga0070686_100135906 3300005544 Bacteria 1706
36 Ga0070686_100908807 3300005544 Bacteria 717
37 Ga0070695_101186262 3300005545 Bacteria 627
38 Ga0070665_100471364 3300005548 Bacteria 1266
39 Ga0068854_100362328 3300005578 Bacteria 1190
40 Ga0068856_100401636 3300005614 Bacteria 1390
41 Ga0070702_101138333 3300005615 Bacteria 626
42 Ga0068852_100042571 3300005616 Bacteria 3844
43 Ga0068859_100977536 3300005617 Bacteria 929
44 Ga0068864_100871899 3300005618 Bacteria 888
45 Ga0068866_10115997 3300005718 Bacteria 1501
46 Ga0068861_100148372 3300005719 Bacteria 1921
47 Ga0068858_100474360 3300005842 Bacteria 1207
48 Ga0068862_100283975 3300005844 Bacteria 1518
49 Ga0081538_10006155 3300005981 Bacteria 10641
50 Ga0081538_10218556 3300005981 Bacteria 759
51 Ga0081539_10027117 3300005985 Bacteria 3636
52 Ga0075365_10008977 3300006038 Bacteria 5715
53 Ga0075368_10017411 3300006042 Bacteria 2689
54 Ga0075363_100391703 3300006048 Bacteria 815
55 Ga0075364_10078326 3300006051 Bacteria 2183
56 Ga0070715_10036879 3300006163 Bacteria 2020
57 Ga0070712_100059976 3300006175 Bacteria 2681
58 Ga0097620_100977297 3300006931 Bacteria 929
59 Ga0111539_10014461 3300009094 Bacteria 9849
60 Ga0111539_10058188 3300009094 Bacteria 4586
61 Ga0111539_11930539 3300009094 Bacteria 685
62 Ga0105245_10013947 3300009098 Bacteria 6998
63 Ga0114129_10598556 3300009147 Bacteria 1429
64 Ga0105243_10005131 3300009148 Bacteria 10268
65 Ga0105242_10010061 3300009176 Bacteria 7244
66 Ga0105248_10068077 3300009177 Bacteria 3998
67 Ga0105238_10319094 3300009551 Bacteria 1539
68 Ga0105249_10017747 3300009553 Bacteria 6320
69 Ga0105249_10433772 3300009553 Bacteria 1350
70 Ga0105239_10664635 3300010375 Bacteria 1190
71 Ga0157374_10457780 3300013296 Bacteria 1278
72 Ga0157374_10653532 3300013296 Bacteria 1063
73 Ga0157372_10085953 3300013307 Bacteria 3568
74 Ga0157375_10760732 3300013308 Bacteria 1119
75 Ga0163163_10025506 3300014325 Bacteria 5636
76 Ga0157380_10015732 3300014326 Bacteria 5563
77 Ga0157380_10140144 3300014326 Bacteria 2076
78 Ga0157377_10094292 3300014745 Bacteria 1773
79 Ga0157376_10604961 3300014969 Bacteria 1091
80 Ga0224712_10142568 3300022467 Bacteria 1056
81 Ga0207642_10794788 3300025899 Bacteria 601
82 Ga0207688_10013769 3300025901 Bacteria 4396
83 Ga0207688_10330803 3300025901 Bacteria 936
84 Ga0207688_10390909 3300025901 Bacteria 861
85 Ga0207647_10037127 3300025904 Bacteria 3091
86 Ga0207685_10016890 3300025905 Bacteria 2346
87 Ga0207645_10041240 3300025907 Bacteria 2955
88 Ga0207663_10154107 3300025916 Bacteria 1615
89 Ga0207662_10085034 3300025918 Bacteria 1936
90 Ga0207657_10323349 3300025919 Bacteria 1219
91 Ga0207690_10229881 3300025932 Bacteria 1423
92 Ga0207686_10012123 3300025934 Bacteria 4736
93 Ga0207709_10097672 3300025935 Bacteria 1935
94 Ga0207691_10022402 3300025940 Bacteria 5957
95 Ga0207661_10216738 3300025944 Bacteria 1690
96 Ga0207661_10266584 3300025944 Bacteria 1527
97 Ga0207661_10495928 3300025944 Bacteria 1116
98 Ga0207679_10350030 3300025945 Bacteria 1287
99 Ga0207640_10081913 3300025981 Bacteria 2208
100 Ga0207677_10241674 3300026023 Bacteria 1461
101 Ga0207708_10019674 3300026075 Bacteria 5092
102 Ga0207648_10006192 3300026089 Bacteria 11915
103 Ga0207648_10876807 3300026089 Bacteria 838
104 Ga0207676_10750667 3300026095 Bacteria 949
105 Ga0207675_100010074 3300026118 Bacteria 8862
106 Ga0207683_11105687 3300026121 Bacteria 735
107 Ga0207428_10035258 3300027907 Bacteria 4090
108 Ga0307408_100126286 3300031548 Bacteria 1990
109 Ga0307408_100133413 3300031548 Bacteria 1940
110 Ga0307405_10038890 3300031731 Bacteria 2871
111 Ga0307405_10403119 3300031731 Bacteria 1071
112 Ga0307410_10003048 3300031852 Bacteria 8288
113 Ga0307410_10011492 3300031852 Bacteria 5068
114 Ga0307410_10082319 3300031852 Bacteria 2264
115 Ga0307406_10052462 3300031901 Bacteria 2594
116 Ga0307406_10144943 3300031901 Bacteria 1686
117 Ga0307407_10003008 3300031903 Bacteria 6776
118 Ga0307407_10173360 3300031903 Bacteria 1423
119 Ga0307407_10478203 3300031903 Bacteria 909
120 Ga0307409_100004245 3300031995 Bacteria 8001
121 Ga0307409_100011486 3300031995 Bacteria 5589
122 Ga0307409_100072372 3300031995 Bacteria 2745
123 Ga0307416_100002429 3300032002 Bacteria 10695
124 Ga0307416_100084614 3300032002 Bacteria 2696
125 Ga0307416_100861353 3300032002 Bacteria 1004
126 Ga0307414_10948758 3300032004 Bacteria 790
127 Ga0307411_10170154 3300032005 Bacteria 1642
128 Ga0307415_100000049 3300032126 Bacteria 51581
129 Ga0307415_100162960 3300032126 Bacteria 1730
130 Ga0307415_100239883 3300032126 Bacteria 1466
131 Ga0307415_100400221 3300032126 Bacteria 1172
132 Ga0307415_100468858 3300032126 Bacteria 1093
133 Ga0395900_0252971 3300037418 Bacteria 1762
134 Ga0451847_0821163 3300041503 Bacteria 527
135 Ga0451853_2258377 3300041512 Bacteria 854
136 Ga0439431_0129420 3300041997 Bacteria 708
137 Ga0439455_0049975 3300042012 Bacteria 1091
138 Ga0439457_072429 3300042014 Bacteria 786
139 Ga0450915_007067 3300042119 Bacteria 728
140 Ga0450919_020980 3300042121 Bacteria 737
141 Ga0451577_0436988 3300042876 Unclassified 1188
142 Ga0453683_0409962 3300044673 Archaea 874
143 Ga0466965_0057098 3300044683 Bacteria 1945
144 Ga0466966_0041966 3300044684 Bacteria 2938
145 Ga0466961_0022262 3300044693 Bacteria 4077
146 Ga0466963_0064241 3300044694 Bacteria 2458
147 Ga0466963_0530288 3300044694 Bacteria 831
148 Ga0453684_0749214 3300044712 Bacteria 1057
149 Ga0453684_1096400 3300044712 Bacteria 841
150 Ga0466971_0189261 3300044719 Bacteria 969
151 Ga0466970_0174362 3300044765 Bacteria 1192
152 Ga0466957_0287897 3300044842 Bacteria 1101
153 Ga0466959_0126161 3300045049 Bacteria 1816
154 Ga0451576_0025476 3300045051 Bacteria 6371
155 Ga0451576_0391649 3300045051 Bacteria 1456
156 Ga0466967_0094905 3300045976 Bacteria 2717
157 Ga0495629_0211964 3300046459 Bacteria 1338
158 Ga0495664_0161176 3300046477 Bacteria 1361
159 Ga0495594_0010431 3300046499 Bacteria 4819
160 Ga0495668_0190652 3300046616 Bacteria 1123
161 Ga0496100_0495753 3300048903 Unclassified 941
162 Ga0496101_0484441 3300048904 Bacteria 977
163 Ga0496102_0228410 3300048905 Bacteria 1755
164 Ga0496104_0906906 3300048907 Bacteria 786
165 Ga0496108_0737603 3300048911 Bacteria 853
166 Ga0496109_0593837 3300048912 Bacteria 1043
167 Ga0496109_1016204 3300048912 Bacteria 767
168 Ga0496110_0086246 3300048913 Bacteria 2803
169 Ga0496111_0396013 3300048914 Bacteria 1021
170 Ga0496114_0109592 3300048917 Bacteria 2364
171 Ga0501031_0037882 3300049568 Bacteria 3147
172 Ga0501032_0235609 3300049569 Bacteria 1190
173 Ga0501033_0065967 3300049570 Bacteria 2662
174 Ga0501036_0012553 3300049572 Bacteria 7027
175 Ga0501036_0038118 3300049572 Bacteria 4067
176 Ga0501036_0145936 3300049572 Bacteria 1996
177 Ga0501036_0406423 3300049572 Bacteria 1136
178 Ga0501038_0234406 3300049574 Bacteria 1459
179 Ga0501039_0004363 3300049575 Bacteria 10659
180 Ga0501039_0043161 3300049575 Bacteria 3484
181 Ga0501039_0137911 3300049575 Bacteria 1916
182 Ga0501039_0500447 3300049575 Bacteria 954
183 Ga0501039_0717005 3300049575 Bacteria 782
184 Ga0501039_0806009 3300049575 Bacteria 732
185 Ga0501040_0008015 3300049576 Bacteria 6860
186 Ga0501040_0050978 3300049576 Bacteria 2832
187 Ga0501040_0067319 3300049576 Bacteria 2468
188 Ga0501040_0341307 3300049576 Bacteria 1072
189 Ga0501040_0424709 3300049576 Bacteria 955
190 Ga0501041_0001125 3300049577 Bacteria 14664
191 Ga0501041_0033383 3300049577 Bacteria 3114
192 Ga0501041_0056086 3300049577 Bacteria 2406
193 Ga0501041_0217786 3300049577 Bacteria 1198
194 Ga0501041_0220626 3300049577 Bacteria 1190
195 Ga0501042_0003952 3300049578 Bacteria 9383
196 Ga0501042_0036481 3300049578 Bacteria 3488
197 Ga0501042_0361367 3300049578 Bacteria 1051
198 Ga0501043_0161086 3300049579 Bacteria 1753
199 Ga0501046_0010760 3300049580 Bacteria 7845
200 Ga0501046_0120014 3300049580 Bacteria 2001
201 Ga0501048_0002467 3300049582 Bacteria 14118
202 Ga0501048_0544292 3300049582 Bacteria 833
203 Ga0501068_0069202 3300049584 Bacteria 2152
204 Ga0501068_0122429 3300049584 Bacteria 1623
205 Ga0501069_0335408 3300049585 Bacteria 890
206 Ga0501070_0164220 3300049586 Bacteria 1830
207 Ga0501071_0119092 3300049587 Bacteria 1956
208 Ga0501071_0162595 3300049587 Bacteria 1669
209 Ga0501071_0164104 3300049587 Unclassified 1661
210 Ga0501071_0296431 3300049587 Bacteria 1225
211 Ga0501071_0347681 3300049587 Bacteria 1128
212 Ga0501071_0544457 3300049587 Bacteria 891
213 Ga0501072_0004070 3300049588 Bacteria 11067
214 Ga0501072_0010011 3300049588 Bacteria 7211
215 Ga0501072_0044166 3300049588 Bacteria 3504
216 Ga0501072_0095713 3300049588 Bacteria 2360
217 Ga0501072_0215729 3300049588 Bacteria 1529
218 Ga0501072_0308344 3300049588 Bacteria 1258
219 Ga0501072_0999876 3300049588 Bacteria 652
220 Ga0501074_0002546 3300049590 Bacteria 12717
221 Ga0501074_0150597 3300049590 Bacteria 1663
222 Ga0501074_0183401 3300049590 Bacteria 1493
223 Ga0501074_0244346 3300049590 Bacteria 1276
224 Ga0501075_0007450 3300049591 Bacteria 7588
225 Ga0501075_0025849 3300049591 Bacteria 4315
226 Ga0501075_0048639 3300049591 Bacteria 3187
227 Ga0501075_0182790 3300049591 Bacteria 1599
228 Ga0501075_0274837 3300049591 Bacteria 1284
229 Ga0501075_0396271 3300049591 Bacteria 1052
230 Ga0501075_0591777 3300049591 Bacteria 846
231 Ga0501076_0002125 3300049592 Bacteria 13600
232 Ga0501076_0003084 3300049592 Bacteria 11607
233 Ga0501076_0044372 3300049592 Bacteria 3506
234 Ga0501076_0156525 3300049592 Bacteria 1855
235 Ga0501076_0179037 3300049592 Bacteria 1728
236 Ga0501076_0248774 3300049592 Bacteria 1454
237 Ga0501076_0434657 3300049592 Bacteria 1080
238 Ga0501076_0438545 3300049592 Bacteria 1075
239 Ga0501077_0119658 3300049593 Bacteria 1669
240 Ga0501079_0073025 3300049741 Bacteria 2652
241 Ga0501079_0083483 3300049741 Bacteria 2471
242 Ga0501079_0144127 3300049741 Bacteria 1856
243 Ga0501080_0064031 3300049742 Bacteria 3421
244 Ga0501080_0251716 3300049742 Bacteria 1611
245 Ga0501080_0525110 3300049742 Bacteria 1056
246 Ga0501081_0000646 3300049743 Bacteria 19907
247 Ga0501081_0013126 3300049743 Bacteria 5448
248 Ga0501081_0053508 3300049743 Bacteria 2787
249 Ga0501081_0120678 3300049743 Unclassified 1867
250 Ga0501035_0018801 3300049822 Bacteria 6365
251 Ga0501035_0524646 3300049822 Bacteria 973
252 Ga0501045_0000806 3300049824 Bacteria 20249
253 Ga0501045_0246773 3300049824 Bacteria 1329
254 Ga0501045_0349217 3300049824 Bacteria 1101
255 Ga0501045_0392784 3300049824 Bacteria 1032
256 Ga0501045_0693684 3300049824 Bacteria 751
257 nmdc:mga0yw44_139855_c1 3300050492 Bacteria 1573
258 nmdc:mga0yw44_87831_c1 3300050492 Bacteria 1960
259 nmdc:mga04h51_192773_c1 3300050495 Bacteria 798
260 nmdc:mga07m45_122603_c1 3300050496 Bacteria 1502
261 nmdc:mga0qj67_444560_c1 3300050509 Bacteria 1044
262 nmdc:mga0qj67_702714_c1 3300050509 Bacteria 804
263 nmdc:mga0qj67_745247_c1 3300050509 Archaea 777
264 nmdc:mga08y16_60262_c1 3300050511 Bacteria 3965
265 nmdc:mga08y16_82371_c1 3300050511 Bacteria 3354
266 Ga0501084_0025926 3300054114 Bacteria 4888
267 Ga0501084_0102456 3300054114 Bacteria 2404
268 Ga0501084_0111522 3300054114 Bacteria 2299
269 Ga0501084_0656306 3300054114 Bacteria 885
270 Ga0501082_0009052 3300060353 Bacteria 8587
271 Ga0501082_0048945 3300060353 Bacteria 3644
272 Ga0501082_0068370 3300060353 Bacteria 3059
273 Ga0501082_0103289 3300060353 Bacteria 2465
274 Ga0501082_0268340 3300060353 Bacteria 1485
275 Ga0501082_0678787 3300060353 Bacteria 902
276 Ga0501082_0709225 3300060353 Bacteria 881
277 Ga0530510_0005403 3300061734 Bacteria 8846
278 Ga0530510_0007061 3300061734 Bacteria 7817
279 Ga0530510_0009005 3300061734 Bacteria 6996
280 Ga0530510_0097316 3300061734 Bacteria 2151
281 Ga0530510_0170671 3300061734 Bacteria 1611
282 Ga0530510_0175346 3300061734 Bacteria 1589
283 Ga0530510_0210902 3300061734 Bacteria 1443
284 Ga0530510_0381346 3300061734 Bacteria 1061
285 Ga0530510_0664279 3300061734 Bacteria 794
286 2739605735 2739367654 Bacteria 6049412
287 2809028975 2808606394 Bacteria 6248540
288 2819726431 2818991469 Bacteria 4644110
289 8054609730 8054609563 Bacteria 5170090
290 Ga0453683_0051452
291 JGI24738J21930_10025629
292 JGI24744J21845_10018098
293 JGI25406J46586_10060881
294 Ga0065704_10026965
295 Ga0070658_10083327
296 Ga0070683_100013749
297 Ga0070683_100480319
298 Ga0070683_100558495
299 Ga0070670_100209541
300 Ga0070682_100036347
301 Ga0070682_101279604
302 Ga0068868_100318804
303 Ga0070660_100029812
304 Ga0070689_100281368
305 Ga0070691_10027649
306 Ga0070692_10019394
307 Ga0070675_100120980
308 Ga0070674_100269836
309 Ga0070659_100458744
310 Ga0070709_11018642
311 Ga0070701_10028669
312 Ga0070700_100060772
313 Ga0070700_100086873
314 Ga0070678_100009962
315 Ga0070678_101159543
316 Ga0070662_100058510
317 Ga0068867_100130768
318 Ga0070685_10120281
319 Ga0070698_100001196
320 Ga0070698_100742086
321 Ga0070684_100053468
322 Ga0068853_100453666
323 Ga0070672_100133480
324 Ga0070686_100135906
325 Ga0070686_100908807
326 Ga0070695_101186262
327 Ga0070665_100471364
328 Ga0068854_100362328
329 Ga0068856_100401636
330 Ga0070702_101138333
331 Ga0068852_100042571
332 Ga0068859_100977536
333 Ga0068864_100871899
334 Ga0068866_10115997
335 Ga0068861_100148372
336 Ga0068858_100474360
337 Ga0068862_100283975
338 Ga0081538_10006155
339 Ga0081538_10218556
340 Ga0081539_10027117
341 Ga0075365_10008977
342 Ga0075368_10017411
343 Ga0075363_100391703
344 Ga0075364_10078326
345 Ga0070715_10036879
346 Ga0070712_100059976
347 Ga0097620_100977297
348 Ga0111539_10014461
349 Ga0111539_10058188
350 Ga0111539_11930539
351 Ga0105245_10013947
352 Ga0114129_10598556
353 Ga0105243_10005131
354 Ga0105242_10010061
355 Ga0105248_10068077
356 Ga0105238_10319094
357 Ga0105249_10017747
358 Ga0105249_10433772
359 Ga0105239_10664635
360 Ga0157374_10457780
361 Ga0157374_10653532
362 Ga0157372_10085953
363 Ga0157375_10760732
364 Ga0163163_10025506
365 Ga0157380_10015732
366 Ga0157380_10140144
367 Ga0157377_10094292
368 Ga0157376_10604961
369 Ga0224712_10142568
370 Ga0207642_10794788
371 Ga0207688_10013769
372 Ga0207688_10330803
373 Ga0207688_10390909
374 Ga0207647_10037127
375 Ga0207685_10016890
376 Ga0207645_10041240
377 Ga0207663_10154107
378 Ga0207662_10085034
379 Ga0207657_10323349
380 Ga0207690_10229881
381 Ga0207686_10012123
382 Ga0207709_10097672
383 Ga0207691_10022402
384 Ga0207661_10216738
385 Ga0207661_10266584
386 Ga0207661_10495928
387 Ga0207679_10350030
388 Ga0207640_10081913
389 Ga0207677_10241674
390 Ga0207708_10019674
391 Ga0207648_10006192
392 Ga0207648_10876807
393 Ga0207676_10750667
394 Ga0207675_100010074
395 Ga0207683_11105687
396 Ga0207428_10035258
397 Ga0307408_100126286
398 Ga0307408_100133413
399 Ga0307405_10038890
400 Ga0307405_10403119
401 Ga0307410_10003048
402 Ga0307410_10011492
403 Ga0307410_10082319
404 Ga0307406_10052462
405 Ga0307406_10144943
406 Ga0307407_10003008
407 Ga0307407_10173360
408 Ga0307407_10478203
409 Ga0307409_100004245
410 Ga0307409_100011486
411 Ga0307409_100072372
412 Ga0307416_100002429
413 Ga0307416_100084614
414 Ga0307416_100861353
415 Ga0307414_10948758
416 Ga0307411_10170154
417 Ga0307415_100000049
418 Ga0307415_100162960
419 Ga0307415_100239883
420 Ga0307415_100400221
421 Ga0307415_100468858
422 Ga0395900_0252971
423 Ga0451847_0821163
424 Ga0451853_2258377
425 Ga0439431_0129420
426 Ga0439455_0049975
427 Ga0439457_072429
428 Ga0450915_007067
429 Ga0450919_020980
430 Ga0451577_0436988
431 Ga0453683_0409962
432 Ga0466965_0057098
433 Ga0466966_0041966
434 Ga0466961_0022262
435 Ga0466963_0064241
436 Ga0466963_0530288
437 Ga0453684_0749214
438 Ga0453684_1096400
439 Ga0466971_0189261
440 Ga0466970_0174362
441 Ga0466957_0287897
442 Ga0466959_0126161
443 Ga0451576_0025476
444 Ga0451576_0391649
445 Ga0466967_0094905
446 Ga0495629_0211964
447 Ga0495664_0161176
448 Ga0495594_0010431
449 Ga0495668_0190652
450 Ga0496100_0495753
451 Ga0496101_0484441
452 Ga0496102_0228410
453 Ga0496104_0906906
454 Ga0496108_0737603
455 Ga0496109_0593837
456 Ga0496109_1016204
457 Ga0496110_0086246
458 Ga0496111_0396013
459 Ga0496114_0109592
460 Ga0501031_0037882
461 Ga0501032_0235609
462 Ga0501033_0065967
463 Ga0501036_0012553
464 Ga0501036_0038118
465 Ga0501036_0145936
466 Ga0501036_0406423
467 Ga0501038_0234406
468 Ga0501039_0004363
469 Ga0501039_0043161
470 Ga0501039_0137911
471 Ga0501039_0500447
472 Ga0501039_0717005
473 Ga0501039_0806009
474 Ga0501040_0008015
475 Ga0501040_0050978
476 Ga0501040_0067319
477 Ga0501040_0341307
478 Ga0501040_0424709
479 Ga0501041_0001125
480 Ga0501041_0033383
481 Ga0501041_0056086
482 Ga0501041_0217786
483 Ga0501041_0220626
484 Ga0501042_0003952
485 Ga0501042_0036481
486 Ga0501042_0361367
487 Ga0501043_0161086
488 Ga0501046_0010760
489 Ga0501046_0120014
490 Ga0501048_0002467
491 Ga0501048_0544292
492 Ga0501068_0069202
493 Ga0501068_0122429
494 Ga0501069_0335408
495 Ga0501070_0164220
496 Ga0501071_0119092
497 Ga0501071_0162595
498 Ga0501071_0164104
499 Ga0501071_0296431
500 Ga0501071_0347681
501 Ga0501071_0544457
502 Ga0501072_0004070
503 Ga0501072_0010011
504 Ga0501072_0044166
505 Ga0501072_0095713
506 Ga0501072_0215729
507 Ga0501072_0308344
508 Ga0501072_0999876
509 Ga0501074_0002546
510 Ga0501074_0150597
511 Ga0501074_0183401
512 Ga0501074_0244346
513 Ga0501075_0007450
514 Ga0501075_0025849
515 Ga0501075_0048639
516 Ga0501075_0182790
517 Ga0501075_0274837
518 Ga0501075_0396271
519 Ga0501075_0591777
520 Ga0501076_0002125
521 Ga0501076_0003084
522 Ga0501076_0044372
523 Ga0501076_0156525
524 Ga0501076_0179037
525 Ga0501076_0248774
526 Ga0501076_0434657
527 Ga0501076_0438545
528 Ga0501077_0119658
529 Ga0501079_0073025
530 Ga0501079_0083483
531 Ga0501079_0144127
532 Ga0501080_0064031
533 Ga0501080_0251716
534 Ga0501080_0525110
535 Ga0501081_0000646
536 Ga0501081_0013126
537 Ga0501081_0053508
538 Ga0501081_0120678
539 Ga0501035_0018801
540 Ga0501035_0524646
541 Ga0501045_0000806
542 Ga0501045_0246773
543 Ga0501045_0349217
544 Ga0501045_0392784
545 Ga0501045_0693684
546 nmdc:mga0yw44_139855_c1
547 nmdc:mga0yw44_87831_c1
548 nmdc:mga04h51_192773_c1
549 nmdc:mga07m45_122603_c1
550 nmdc:mga0qj67_444560_c1
551 nmdc:mga0qj67_702714_c1
552 nmdc:mga0qj67_745247_c1
553 nmdc:mga08y16_60262_c1
554 nmdc:mga08y16_82371_c1
555 Ga0501084_0025926
556 Ga0501084_0102456
557 Ga0501084_0111522
558 Ga0501084_0656306
559 Ga0501082_0009052
560 Ga0501082_0048945
561 Ga0501082_0068370
562 Ga0501082_0103289
563 Ga0501082_0268340
564 Ga0501082_0678787
565 Ga0501082_0709225
566 Ga0530510_0005403
567 Ga0530510_0007061
568 Ga0530510_0009005
569 Ga0530510_0097316
570 Ga0530510_0170671
571 Ga0530510_0175346
572 Ga0530510_0210902
573 Ga0530510_0381346
574 Ga0530510_0664279
575 2739605735
576 2809028975
577 2819726431
578 8054609730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

4

187

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7887 3 179
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7824 2 177
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7803 3 179
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7633 1 177
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7623 3 179
ID Description Score Start End Superfamily
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8115 4 177 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7987 4 177 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7611 1 180 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7573 1 177 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7559 3 183 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6B3CCB0-F1-model_v4 Dihydrofolate reductase family protein 0.972 92 183 GO:0008703
GO:0009231
AF-A0A7K2JII5-F1-model_v4 Deaminase 0.9654 48 185 GO:0008703
GO:0009231
AF-A0A7Z0ENJ9-F1-model_v4 Dihydrofolate reductase 0.9612 81 181 GO:0008703
GO:0009231
AF-A0A2S8ZYM5-F1-model_v4 Deaminase 0.9557 1 185 GO:0008703
GO:0009231
AF-A0A6V8LJH8-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9526 1 179 GO:0008703
GO:0009231

Map