F389275

General Info

Members Datasets Scaffolds Average Seq Length
289 204 578 282

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10098414|Ga0307413_100984142
Length 328
Sequence METSYPAKSFVLSQPGDLHRNCGKGRPAHDEFNGRMLRPLPKGWAMICVRDSLSQMALIAAATLVSAAAAHANSASPWSDDIRSSARLIAGSVTAGNVPGNSVTLRAGIEIKLQPGWKTYWRYPGDSGVPPQFDFAGSENLVSAEVLYPAPHSFKDEAGTSIGYKETVIFPVRVTPRDPSKPVKLNAKIDYAVCEKLCIPAEAKAQLVIERNGAASEALTAAEAMVPKHVPASEISLKLKRTGAKPKPLVTLDVAAPEGDPVEVFVEGPGKDWALPIPKPVQGAPKGHRHFSFDFDGLPPGADPMGKYDLIVTVVTPTRAFEAATRLD

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 9.69
Rhizosphere 83.39
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10098414 3300031824 Bacteria 1926
2 JGI25153J46596_10008159 3300003215 Bacteria 5044
3 rootH1_10161149 3300003323 Bacteria 1122
4 rootH1_10298707 3300003323 Bacteria 1258
5 Ga0070683_100519358 3300005329 Bacteria 1138
6 Ga0070690_100044998 3300005330 Bacteria 2803
7 Ga0070670_100245196 3300005331 Bacteria 1560
8 Ga0070670_100256766 3300005331 Bacteria 1523
9 Ga0068869_100234391 3300005334 Bacteria 1460
10 Ga0070680_100026107 3300005336 Bacteria 4672
11 Ga0070680_100042028 3300005336 Bacteria 3707
12 Ga0070660_100025186 3300005339 Bacteria 4420
13 Ga0070689_100002505 3300005340 Bacteria 12016
14 Ga0070669_100501199 3300005353 Unclassified 1007
15 Ga0070674_100252146 3300005356 Bacteria 1387
16 Ga0070673_100090043 3300005364 Bacteria 2506
17 Ga0070688_100217163 3300005365 Bacteria 1346
18 Ga0070667_100020239 3300005367 Bacteria 5524
19 Ga0070667_100440510 3300005367 Bacteria 1190
20 Ga0070714_100042425 3300005435 Bacteria 3843
21 Ga0070713_100052125 3300005436 Bacteria 3386
22 Ga0070713_100226455 3300005436 Bacteria 1698
23 Ga0070701_10085285 3300005438 Bacteria 1719
24 Ga0070711_100031335 3300005439 Bacteria 3530
25 Ga0070711_100042547 3300005439 Bacteria 3071
26 Ga0070708_100139893 3300005445 Bacteria 2244
27 Ga0070678_100013782 3300005456 Bacteria 5078
28 Ga0070678_100058222 3300005456 Bacteria 2835
29 Ga0070681_10179071 3300005458 Bacteria 2041
30 Ga0070699_100234031 3300005518 Bacteria 1638
31 Ga0070679_100050724 3300005530 Bacteria 4133
32 Ga0070679_100054287 3300005530 Bacteria 3988
33 Ga0070679_100072124 3300005530 Bacteria 3445
34 Ga0070697_100053613 3300005536 Bacteria 3278
35 Ga0070672_100070114 3300005543 Bacteria 2785
36 Ga0070686_100185126 3300005544 Bacteria 1482
37 Ga0070693_100086465 3300005547 Bacteria 1881
38 Ga0070704_100115795 3300005549 Bacteria 2049
39 Ga0068855_100059666 3300005563 Bacteria 4463
40 Ga0068855_100642938 3300005563 Bacteria 1140
41 Ga0068856_100450341 3300005614 Unclassified 1308
42 Ga0068859_100191980 3300005617 Bacteria 2127
43 Ga0068864_100180670 3300005618 Bacteria 1929
44 Ga0068861_100171447 3300005719 Bacteria 1799
45 Ga0068863_100095829 3300005841 Bacteria 2817
46 Ga0068860_100158737 3300005843 Bacteria 2180
47 Ga0068862_100290223 3300005844 Bacteria 1502
48 Ga0081455_10000969 3300005937 Bacteria 36631
49 Ga0081538_10016099 3300005981 Bacteria 5748
50 Ga0081540_1007396 3300005983 Bacteria 7831
51 Ga0081540_1009366 3300005983 Bacteria 6753
52 Ga0070715_10005044 3300006163 Bacteria 4376
53 Ga0070716_100039334 3300006173 Bacteria 2624
54 Ga0070712_100124250 3300006175 Bacteria 1946
55 Ga0075366_10031057 3300006195 Bacteria 3143
56 Ga0097621_100456369 3300006237 Bacteria 1152
57 Ga0075428_100023942 3300006844 Bacteria 6756
58 Ga0075430_100018996 3300006846 Bacteria 5848
59 Ga0075430_100035443 3300006846 Bacteria 4233
60 Ga0075431_100001738 3300006847 Bacteria 20487
61 Ga0075431_100019500 3300006847 Bacteria 6916
62 Ga0075431_100060933 3300006847 Bacteria 3894
63 Ga0075431_100347911 3300006847 Bacteria 1491
64 Ga0075434_100084976 3300006871 Bacteria 3163
65 Ga0075429_100008057 3300006880 Bacteria 9161
66 Ga0097620_100191970 3300006931 Bacteria 2127
67 Ga0075435_100029434 3300007076 Bacteria 4309
68 Ga0105240_10019295 3300009093 Bacteria 9113
69 Ga0105240_10108328 3300009093 Bacteria 3366
70 Ga0111539_10002925 3300009094 Bacteria 22643
71 Ga0105245_10651940 3300009098 Bacteria 1083
72 Ga0114129_10003274 3300009147 Bacteria 22735
73 Ga0114129_10016494 3300009147 Bacteria 10517
74 Ga0114129_10092330 3300009147 Bacteria 4194
75 Ga0114129_10205474 3300009147 Bacteria 2665
76 Ga0105243_10203055 3300009148 Bacteria 1740
77 Ga0105242_10437935 3300009176 Bacteria 1229
78 Ga0105238_10312837 3300009551 Bacteria 1556
79 Ga0099796_10021111 3300010159 Bacteria 2001
80 Ga0157370_10539548 3300013104 Bacteria 1070
81 Ga0163162_10154984 3300013306 Bacteria 2410
82 Ga0157372_11143256 3300013307 Unclassified 900
83 Ga0157375_10307392 3300013308 Bacteria 1750
84 Ga0163163_10019435 3300014325 Bacteria 6382
85 Ga0157380_10216690 3300014326 Bacteria 1710
86 Ga0157376_10387115 3300014969 Bacteria 1348
87 Ga0163161_10391028 3300017792 Unclassified 1113
88 Ga0206353_10333313 3300020082 Bacteria 3622
89 Ga0213876_10084023 3300021384 Bacteria 1684
90 Ga0209758_1000382 3300025297 Bacteria 76653
91 Ga0207697_10018334 3300025315 Bacteria 2871
92 Ga0207653_10029437 3300025885 Bacteria 1769
93 Ga0207692_10001821 3300025898 Bacteria 8096
94 Ga0207699_10008089 3300025906 Bacteria 5172
95 Ga0207684_10006292 3300025910 Bacteria 10830
96 Ga0207707_10129240 3300025912 Bacteria 2209
97 Ga0207693_10004287 3300025915 Bacteria 12087
98 Ga0207693_10202013 3300025915 Bacteria 1563
99 Ga0207663_10117696 3300025916 Bacteria 1814
100 Ga0207657_10037453 3300025919 Bacteria 4330
101 Ga0207652_10035704 3300025921 Bacteria 4198
102 Ga0207652_10095543 3300025921 Bacteria 2618
103 Ga0207652_10266914 3300025921 Bacteria 1544
104 Ga0207652_10444383 3300025921 Bacteria 1169
105 Ga0207694_10259077 3300025924 Bacteria 1424
106 Ga0207659_10043756 3300025926 Bacteria 3147
107 Ga0207659_10282660 3300025926 Bacteria 1357
108 Ga0207700_10041959 3300025928 Bacteria 3351
109 Ga0207700_10507553 3300025928 Bacteria 1068
110 Ga0207664_10084748 3300025929 Bacteria 2585
111 Ga0207664_10382957 3300025929 Bacteria 1249
112 Ga0207686_10319755 3300025934 Bacteria 1159
113 Ga0207670_10029206 3300025936 Bacteria 3510
114 Ga0207670_10156735 3300025936 Bacteria 1696
115 Ga0207669_10020462 3300025937 Bacteria 3471
116 Ga0207704_10027890 3300025938 Bacteria 3124
117 Ga0207665_10004653 3300025939 Bacteria 9114
118 Ga0207665_10223230 3300025939 Bacteria 1382
119 Ga0207691_10069646 3300025940 Bacteria 3178
120 Ga0207689_10443300 3300025942 Bacteria 1085
121 Ga0207661_10436417 3300025944 Bacteria 1191
122 Ga0207668_10166265 3300025972 Bacteria 1725
123 Ga0207640_10023375 3300025981 Bacteria 3714
124 Ga0207708_10131531 3300026075 Bacteria 1957
125 Ga0207708_10204331 3300026075 Bacteria 1577
126 Ga0207708_10382084 3300026075 Bacteria 1161
127 Ga0207641_10093695 3300026088 Bacteria 2633
128 Ga0207648_10338112 3300026089 Bacteria 1355
129 Ga0207676_10021664 3300026095 Bacteria 4718
130 Ga0207675_100204295 3300026118 Bacteria 1898
131 Ga0207683_10026785 3300026121 Bacteria 4979
132 Ga0207683_10083657 3300026121 Bacteria 2836
133 Ga0207428_10042442 3300027907 Bacteria 3678
134 Ga0265339_10000016 3300031249 Bacteria 185313
135 Ga0265339_10012187 3300031249 Bacteria 5259
136 Ga0265316_10241164 3300031344 Bacteria 1329
137 Ga0265313_10000060 3300031595 Bacteria 107224
138 Ga0316579_10012512 3300031691 Bacteria 3633
139 Ga0265342_10000681 3300031712 Bacteria 35543
140 Ga0316578_10029432 3300031728 Bacteria 3117
141 Ga0307416_100590976 3300032002 Bacteria 1189
142 Ga0373953_0019872 3300035117 Bacteria 2504
143 Ga0373954_0013559 3300035118 Bacteria 3634
144 Ga0373956_0008073 3300035119 Bacteria 4257
145 Ga0373955_0067263 3300035172 Bacteria 1994
146 Ga0373961_0002339 3300035241 Bacteria 4945
147 Ga0316574_0003152 3300035398 Bacteria 8440
148 Ga0373924_0034069 3300035410 Bacteria 2060
149 Ga0373935_0043914 3300035692 Bacteria 2815
150 Ga0373927_0018509 3300035695 Bacteria 4577
151 Ga0373927_0036648 3300035695 Bacteria 3189
152 Ga0373933_0231343 3300035724 Unclassified 1187
153 Ga0373937_0003492 3300036401 Bacteria 13220
154 Ga0316584_0029387 3300036712 Bacteria 4056
155 Ga0373925_0087241 3300037068 Bacteria 2382
156 Ga0373925_0113223 3300037068 Bacteria 2098
157 Ga0373925_0168583 3300037068 Bacteria 1728
158 Ga0395900_0003699 3300037418 Bacteria 16435
159 Ga0395900_0015404 3300037418 Bacteria 7793
160 Ga0395898_0017310 3300037466 Bacteria 7362
161 Ga0395898_0055726 3300037466 Bacteria 3856
162 Ga0395898_0070660 3300037466 Bacteria 3374
163 Ga0395901_0121902 3300038443 Bacteria 2740
164 Ga0436365_0304759 3300039437 Bacteria 17649
165 Ga0436365_0924133 3300039437 Bacteria 3510
166 Ga0436365_0937536 3300039437 Bacteria 2586
167 Ga0436365_1240129 3300039437 Bacteria 5706
168 Ga0436360_0372100 3300039438 Bacteria 1187
169 Ga0466966_0033015 3300044684 Bacteria 3351
170 Ga0466963_0071554 3300044694 Bacteria 2334
171 Ga0466971_0067543 3300044719 Bacteria 1621
172 Ga0466957_0042945 3300044842 Bacteria 2736
173 Ga0466959_0158693 3300045049 Bacteria 1591
174 Ga0466958_0153988 3300045836 Bacteria 1450
175 Ga0495618_0137374 3300046514 Bacteria 1564
176 Ga0495640_0058133 3300046533 Bacteria 2638
177 Ga0495667_0152827 3300046559 Bacteria 1486
178 Ga0495634_0179322 3300046642 Bacteria 1327
179 Ga0495657_0117056 3300046675 Bacteria 1682
180 Ga0495684_0057474 3300047471 Bacteria 2965
181 Ga0496100_0254978 3300048903 Bacteria 1299
182 Ga0496100_0348013 3300048903 Bacteria 1119
183 Ga0496100_0513898 3300048903 Bacteria 924
184 Ga0496101_0067522 3300048904 Bacteria 2611
185 Ga0496101_0101800 3300048904 Bacteria 2151
186 Ga0496102_0050521 3300048905 Bacteria 3786
187 Ga0496102_0080953 3300048905 Bacteria 2993
188 Ga0496103_0080129 3300048906 Bacteria 2053
189 Ga0496104_0023276 3300048907 Bacteria 5695
190 Ga0496104_0058641 3300048907 Bacteria 3644
191 Ga0496105_0290879 3300048908 Bacteria 1315
192 Ga0496106_0238648 3300048909 Bacteria 1452
193 Ga0496107_0054426 3300048910 Bacteria 2888
194 Ga0496108_0020300 3300048911 Bacteria 5460
195 Ga0496108_0221579 3300048911 Bacteria 1644
196 Ga0496109_0056287 3300048912 Bacteria 3589
197 Ga0496109_0103824 3300048912 Bacteria 2638
198 Ga0496110_0150168 3300048913 Bacteria 2109
199 Ga0496111_0012356 3300048914 Bacteria 5778
200 Ga0496111_0236808 3300048914 Bacteria 1356
201 Ga0496112_0123838 3300048915 Bacteria 2556
202 Ga0496112_0149737 3300048915 Bacteria 2301
203 Ga0496113_0161176 3300048916 Bacteria 1773
204 Ga0496114_0456648 3300048917 Bacteria 1131
205 Ga0496115_0041302 3300048918 Bacteria 3670
206 Ga0496115_0080715 3300048918 Bacteria 2648
207 Ga0496115_0086902 3300048918 Bacteria 2552
208 Ga0496115_0134791 3300048918 Bacteria 2036
209 Ga0496126_0220509 3300048929 Bacteria 1593
210 Ga0501031_0011122 3300049568 Bacteria 5864
211 Ga0501032_0021578 3300049569 Bacteria 4475
212 Ga0501033_0013167 3300049570 Bacteria 6301
213 Ga0501034_0032869 3300049571 Bacteria 5267
214 Ga0501034_0122269 3300049571 Bacteria 2589
215 Ga0501034_0274360 3300049571 Bacteria 1627
216 Ga0501036_0016232 3300049572 Bacteria 6219
217 Ga0501036_0089715 3300049572 Bacteria 2597
218 Ga0501037_0061728 3300049573 Bacteria 2733
219 Ga0501037_0262237 3300049573 Bacteria 1207
220 Ga0501038_0024089 3300049574 Bacteria 5432
221 Ga0501038_0088453 3300049574 Bacteria 2600
222 Ga0501039_0013212 3300049575 Bacteria 6311
223 Ga0501043_0138517 3300049579 Bacteria 1906
224 Ga0501047_0008986 3300049581 Bacteria 9433
225 Ga0501047_0128315 3300049581 Bacteria 2416
226 Ga0501067_0013484 3300049583 Bacteria 4529
227 Ga0501070_0036639 3300049586 Bacteria 4096
228 Ga0501071_0015440 3300049587 Bacteria 5242
229 Ga0501072_0011471 3300049588 Bacteria 6775
230 Ga0501072_0024956 3300049588 Bacteria 4654
231 Ga0501072_0120224 3300049588 Bacteria 2093
232 Ga0501073_0007286 3300049589 Bacteria 8233
233 Ga0501073_0069828 3300049589 Bacteria 2447
234 Ga0501074_0038328 3300049590 Bacteria 3474
235 Ga0501074_0078578 3300049590 Bacteria 2368
236 Ga0501075_0009087 3300049591 Bacteria 6941
237 Ga0501075_0249041 3300049591 Bacteria 1354
238 Ga0501076_0056131 3300049592 Bacteria 3125
239 Ga0501076_0171422 3300049592 Bacteria 1769
240 Ga0501077_0073308 3300049593 Bacteria 2169
241 Ga0501079_0023956 3300049741 Bacteria 4683
242 Ga0501079_0074817 3300049741 Bacteria 2619
243 Ga0501080_0111777 3300049742 Bacteria 2532
244 Ga0501080_0189179 3300049742 Bacteria 1892
245 Ga0501080_0190096 3300049742 Bacteria 1887
246 Ga0501080_0193666 3300049742 Bacteria 1867
247 Ga0501081_0383069 3300049743 Bacteria 1039
248 Ga0501083_0135677 3300049744 Bacteria 1612
249 Ga0501083_0330071 3300049744 Unclassified 992
250 Ga0501035_0050257 3300049822 Bacteria 3736
251 Ga0501035_0109315 3300049822 Bacteria 2424
252 Ga0501044_0022460 3300049823 Bacteria 6722
253 Ga0501044_0164364 3300049823 Bacteria 2194
254 Ga0501044_0214083 3300049823 Bacteria 1880
255 Ga0501044_0403894 3300049823 Bacteria 1278
256 Ga0501044_0460371 3300049823 Bacteria 1177
257 nmdc:mga03683_42089_c1 3300050489 Bacteria 1878
258 nmdc:mga0k408_81961_c1 3300050493 Bacteria 1890
259 nmdc:mga05p37_16446_c1 3300050507 Bacteria 8914
260 nmdc:mga05p37_344669_c1 3300050507 Bacteria 1756
261 nmdc:mga05p37_968_c2 3300050507 Bacteria 22586
262 nmdc:mga09592_11757_c1 3300050508 Bacteria 7116
263 nmdc:mga09592_119914_c1 3300050508 Bacteria 2259
264 nmdc:mga0qj67_18592_c1 3300050509 Bacteria 5297
265 nmdc:mga0qj67_411583_c1 3300050509 Bacteria 1091
266 nmdc:mga0qj67_8658_c1 3300050509 Bacteria 7550
267 nmdc:mga06r32_1261_c1 3300050510 Bacteria 22739
268 nmdc:mga06r32_20509_c1 3300050510 Bacteria 6087
269 nmdc:mga08y16_5394_c1 3300050511 Bacteria 13370
270 nmdc:mga0n895_32858_c1 3300050512 Bacteria 4982
271 nmdc:mga08x19_2061_c1 3300050514 Bacteria 12326
272 nmdc:mga0a205_148709_c1 3300050515 Bacteria 2242
273 Ga0495601_0076323 3300053077 Bacteria 2146
274 Ga0495601_0114497 3300053077 Bacteria 1748
275 Ga0495612_0087397 3300053078 Bacteria 1316
276 Ga0495595_0029308 3300053084 Bacteria 2462
277 Ga0495595_0206384 3300053084 Bacteria 979
278 Ga0495619_0028572 3300053085 Bacteria 3598
279 Ga0500643_031945 3300053087 Bacteria 1601
280 Ga0500566_0055855 3300053094 Bacteria 2247
281 Ga0500641_0003305 3300053096 Bacteria 5708
282 Ga0500593_049921 3300053117 Bacteria 1859
283 Ga0500595_000006 3300053119 Bacteria 300857
284 Ga0500642_0022930 3300053130 Bacteria 2499
285 Ga0500627_0007372 3300053158 Bacteria 3823
286 Ga0501082_0124227 3300060353 Bacteria 2238
287 Ga0501082_0150337 3300060353 Bacteria 2022
288 Ga0501082_0536204 3300060353 Unclassified 1023
289 Ga0530510_0052606 3300061734 Bacteria 2942
290 Ga0307413_10098414
291 JGI25153J46596_10008159
292 rootH1_10161149
293 rootH1_10298707
294 Ga0070683_100519358
295 Ga0070690_100044998
296 Ga0070670_100245196
297 Ga0070670_100256766
298 Ga0068869_100234391
299 Ga0070680_100026107
300 Ga0070680_100042028
301 Ga0070660_100025186
302 Ga0070689_100002505
303 Ga0070669_100501199
304 Ga0070674_100252146
305 Ga0070673_100090043
306 Ga0070688_100217163
307 Ga0070667_100020239
308 Ga0070667_100440510
309 Ga0070714_100042425
310 Ga0070713_100052125
311 Ga0070713_100226455
312 Ga0070701_10085285
313 Ga0070711_100031335
314 Ga0070711_100042547
315 Ga0070708_100139893
316 Ga0070678_100013782
317 Ga0070678_100058222
318 Ga0070681_10179071
319 Ga0070699_100234031
320 Ga0070679_100050724
321 Ga0070679_100054287
322 Ga0070679_100072124
323 Ga0070697_100053613
324 Ga0070672_100070114
325 Ga0070686_100185126
326 Ga0070693_100086465
327 Ga0070704_100115795
328 Ga0068855_100059666
329 Ga0068855_100642938
330 Ga0068856_100450341
331 Ga0068859_100191980
332 Ga0068864_100180670
333 Ga0068861_100171447
334 Ga0068863_100095829
335 Ga0068860_100158737
336 Ga0068862_100290223
337 Ga0081455_10000969
338 Ga0081538_10016099
339 Ga0081540_1007396
340 Ga0081540_1009366
341 Ga0070715_10005044
342 Ga0070716_100039334
343 Ga0070712_100124250
344 Ga0075366_10031057
345 Ga0097621_100456369
346 Ga0075428_100023942
347 Ga0075430_100018996
348 Ga0075430_100035443
349 Ga0075431_100001738
350 Ga0075431_100019500
351 Ga0075431_100060933
352 Ga0075431_100347911
353 Ga0075434_100084976
354 Ga0075429_100008057
355 Ga0097620_100191970
356 Ga0075435_100029434
357 Ga0105240_10019295
358 Ga0105240_10108328
359 Ga0111539_10002925
360 Ga0105245_10651940
361 Ga0114129_10003274
362 Ga0114129_10016494
363 Ga0114129_10092330
364 Ga0114129_10205474
365 Ga0105243_10203055
366 Ga0105242_10437935
367 Ga0105238_10312837
368 Ga0099796_10021111
369 Ga0157370_10539548
370 Ga0163162_10154984
371 Ga0157372_11143256
372 Ga0157375_10307392
373 Ga0163163_10019435
374 Ga0157380_10216690
375 Ga0157376_10387115
376 Ga0163161_10391028
377 Ga0206353_10333313
378 Ga0213876_10084023
379 Ga0209758_1000382
380 Ga0207697_10018334
381 Ga0207653_10029437
382 Ga0207692_10001821
383 Ga0207699_10008089
384 Ga0207684_10006292
385 Ga0207707_10129240
386 Ga0207693_10004287
387 Ga0207693_10202013
388 Ga0207663_10117696
389 Ga0207657_10037453
390 Ga0207652_10035704
391 Ga0207652_10095543
392 Ga0207652_10266914
393 Ga0207652_10444383
394 Ga0207694_10259077
395 Ga0207659_10043756
396 Ga0207659_10282660
397 Ga0207700_10041959
398 Ga0207700_10507553
399 Ga0207664_10084748
400 Ga0207664_10382957
401 Ga0207686_10319755
402 Ga0207670_10029206
403 Ga0207670_10156735
404 Ga0207669_10020462
405 Ga0207704_10027890
406 Ga0207665_10004653
407 Ga0207665_10223230
408 Ga0207691_10069646
409 Ga0207689_10443300
410 Ga0207661_10436417
411 Ga0207668_10166265
412 Ga0207640_10023375
413 Ga0207708_10131531
414 Ga0207708_10204331
415 Ga0207708_10382084
416 Ga0207641_10093695
417 Ga0207648_10338112
418 Ga0207676_10021664
419 Ga0207675_100204295
420 Ga0207683_10026785
421 Ga0207683_10083657
422 Ga0207428_10042442
423 Ga0265339_10000016
424 Ga0265339_10012187
425 Ga0265316_10241164
426 Ga0265313_10000060
427 Ga0316579_10012512
428 Ga0265342_10000681
429 Ga0316578_10029432
430 Ga0307416_100590976
431 Ga0373953_0019872
432 Ga0373954_0013559
433 Ga0373956_0008073
434 Ga0373955_0067263
435 Ga0373961_0002339
436 Ga0316574_0003152
437 Ga0373924_0034069
438 Ga0373935_0043914
439 Ga0373927_0018509
440 Ga0373927_0036648
441 Ga0373933_0231343
442 Ga0373937_0003492
443 Ga0316584_0029387
444 Ga0373925_0087241
445 Ga0373925_0113223
446 Ga0373925_0168583
447 Ga0395900_0003699
448 Ga0395900_0015404
449 Ga0395898_0017310
450 Ga0395898_0055726
451 Ga0395898_0070660
452 Ga0395901_0121902
453 Ga0436365_0304759
454 Ga0436365_0924133
455 Ga0436365_0937536
456 Ga0436365_1240129
457 Ga0436360_0372100
458 Ga0466966_0033015
459 Ga0466963_0071554
460 Ga0466971_0067543
461 Ga0466957_0042945
462 Ga0466959_0158693
463 Ga0466958_0153988
464 Ga0495618_0137374
465 Ga0495640_0058133
466 Ga0495667_0152827
467 Ga0495634_0179322
468 Ga0495657_0117056
469 Ga0495684_0057474
470 Ga0496100_0254978
471 Ga0496100_0348013
472 Ga0496100_0513898
473 Ga0496101_0067522
474 Ga0496101_0101800
475 Ga0496102_0050521
476 Ga0496102_0080953
477 Ga0496103_0080129
478 Ga0496104_0023276
479 Ga0496104_0058641
480 Ga0496105_0290879
481 Ga0496106_0238648
482 Ga0496107_0054426
483 Ga0496108_0020300
484 Ga0496108_0221579
485 Ga0496109_0056287
486 Ga0496109_0103824
487 Ga0496110_0150168
488 Ga0496111_0012356
489 Ga0496111_0236808
490 Ga0496112_0123838
491 Ga0496112_0149737
492 Ga0496113_0161176
493 Ga0496114_0456648
494 Ga0496115_0041302
495 Ga0496115_0080715
496 Ga0496115_0086902
497 Ga0496115_0134791
498 Ga0496126_0220509
499 Ga0501031_0011122
500 Ga0501032_0021578
501 Ga0501033_0013167
502 Ga0501034_0032869
503 Ga0501034_0122269
504 Ga0501034_0274360
505 Ga0501036_0016232
506 Ga0501036_0089715
507 Ga0501037_0061728
508 Ga0501037_0262237
509 Ga0501038_0024089
510 Ga0501038_0088453
511 Ga0501039_0013212
512 Ga0501043_0138517
513 Ga0501047_0008986
514 Ga0501047_0128315
515 Ga0501067_0013484
516 Ga0501070_0036639
517 Ga0501071_0015440
518 Ga0501072_0011471
519 Ga0501072_0024956
520 Ga0501072_0120224
521 Ga0501073_0007286
522 Ga0501073_0069828
523 Ga0501074_0038328
524 Ga0501074_0078578
525 Ga0501075_0009087
526 Ga0501075_0249041
527 Ga0501076_0056131
528 Ga0501076_0171422
529 Ga0501077_0073308
530 Ga0501079_0023956
531 Ga0501079_0074817
532 Ga0501080_0111777
533 Ga0501080_0189179
534 Ga0501080_0190096
535 Ga0501080_0193666
536 Ga0501081_0383069
537 Ga0501083_0135677
538 Ga0501083_0330071
539 Ga0501035_0050257
540 Ga0501035_0109315
541 Ga0501044_0022460
542 Ga0501044_0164364
543 Ga0501044_0214083
544 Ga0501044_0403894
545 Ga0501044_0460371
546 nmdc:mga03683_42089_c1
547 nmdc:mga0k408_81961_c1
548 nmdc:mga05p37_16446_c1
549 nmdc:mga05p37_344669_c1
550 nmdc:mga05p37_968_c2
551 nmdc:mga09592_11757_c1
552 nmdc:mga09592_119914_c1
553 nmdc:mga0qj67_18592_c1
554 nmdc:mga0qj67_411583_c1
555 nmdc:mga0qj67_8658_c1
556 nmdc:mga06r32_1261_c1
557 nmdc:mga06r32_20509_c1
558 nmdc:mga08y16_5394_c1
559 nmdc:mga0n895_32858_c1
560 nmdc:mga08x19_2061_c1
561 nmdc:mga0a205_148709_c1
562 Ga0495601_0076323
563 Ga0495601_0114497
564 Ga0495612_0087397
565 Ga0495595_0029308
566 Ga0495595_0206384
567 Ga0495619_0028572
568 Ga0500643_031945
569 Ga0500566_0055855
570 Ga0500641_0003305
571 Ga0500593_049921
572 Ga0500595_000006
573 Ga0500642_0022930
574 Ga0500627_0007372
575 Ga0501082_0124227
576 Ga0501082_0150337
577 Ga0501082_0536204
578 Ga0530510_0052606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11412

DsbD_N

Thiol:disulfide interchange protein DsbD, N-terminal

87

210

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c29-assembly3.cif.gz_C crystal structure of the n-terminal periplasmic domain of scsb from proteus mirabilis 0.7841 22 252
6c29-assembly3.cif.gz_C crystal structure of the n-terminal periplasmic domain of scsb from proteus mirabilis 0.6987 22 252
1jpe-assembly1.cif.gz_A crystal structure of dsbd-alpha; the n-terminal domain of dsbd 0.6291 27 131
1vrs-assembly1.cif.gz_A crystal structure of the disulfide-linked complex between the n-terminal and c-terminal domain of the electron transfer catalyst dsbd 0.6275 26 132
1vrs-assembly3.cif.gz_C crystal structure of the disulfide-linked complex between the n-terminal and c-terminal domain of the electron transfer catalyst dsbd 0.6233 27 129
ID Description Score Start End Superfamily
af_Q9XWM1_3_93_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6874 165 251 2.60.40.10
af_A0A0R4ITE7_297_407_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6778 161 252 2.60.40.10
af_A0A0R4ITX7_278_383_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6744 161 252 2.60.40.10
af_Q6VNS1_300_422_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6569 161 252 2.60.40.10
af_A7IT77_145_252_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6394 159 253 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1J5PCT3-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.9663 26 254
AF-A0A7W0MSE8-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.9593 25 148
AF-A0A1M5XIS4-F1-model_v4 Thiol-disulfide interchange protein, contains DsbC and DsbD domains 0.9582 25 254
AF-A0A1J5PCT3-F1-model_v4 Thiol:disulfide interchange protein DsbD N-terminal domain-containing protein 0.958 26 254
AF-A0A5A7W671-F1-model_v4 Cytochrome C biogenesis protein 0.9573 25 254

Map