F389269

General Info

Members Datasets Scaffolds Average Seq Length
289 155 285 261

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10235848|Ga0265339_102358481
Length 280
Sequence MSAIPKLAVVTGASTGIGLELARLCARDGFDLIIAADEPLVDSAAKELRASGVSCTAVQTDLSDKKGVDELLQQVAATGRTVDALLANAGRGLGRAFLDQDIDEALKVAHTNIDGTIYLVYKIGQTMRSRGAGRILITGSIAGLMPGTFQAVYNGTKAFLDSFSVALANELKDSGITVTCLMPGATETDFFERADMLDTKVGSGEKANAADVAKTGYEAMMKGELKVVAGFANKLRAAMTNVAPDSTLAEMHRGMAEPGKAKDKGKPTKSSRERTDHPQV

Samples

Sample ID Description Type Environment
1 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
154 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 1.04
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0
Rhizoplane 2.08
Rhizosphere 88.58
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10055962 3300001979 Bacteria 1108
2 JGI24735J21928_10032058 3300002067 Bacteria 1556
3 JGI25150J39212_1000140 3300002774 Bacteria 40705
4 Ga0032354_1061588 3300003693 Bacteria 2724
5 Ga0055536_1000713 3300003781 Bacteria 22261
6 Ga0055534_1005207 3300003784 Bacteria 3549
7 Ga0055531_10019688 3300003794 Bacteria 2714
8 Ga0055531_10041765 3300003794 Bacteria 1322
9 Ga0058863_11827908 3300004799 Bacteria 1095
10 Ga0065714_10136561 3300005288 Bacteria 1204
11 Ga0065712_10003408 3300005290 Unclassified 3755
12 Ga0065715_10005159 3300005293 Unclassified 4812
13 Ga0070658_10013524 3300005327 Bacteria 6547
14 Ga0070658_10241114 3300005327 Bacteria 1532
15 Ga0070676_10305328 3300005328 Bacteria 1080
16 Ga0070682_100180207 3300005337 Bacteria 1475
17 Ga0070682_100399281 3300005337 Bacteria 1039
18 Ga0068868_100208609 3300005338 Unclassified 1632
19 Ga0070660_100032882 3300005339 Bacteria 3906
20 Ga0070660_100046689 3300005339 Bacteria 3320
21 Ga0070660_100497042 3300005339 Bacteria 1014
22 Ga0070687_100068009 3300005343 Unclassified 1903
23 Ga0070661_100023875 3300005344 Bacteria 4386
24 Ga0070661_100157713 3300005344 Bacteria 1718
25 Ga0070675_100028595 3300005354 Unclassified 4487
26 Ga0070671_100010969 3300005355 Bacteria 7273
27 Ga0070671_100027449 3300005355 Bacteria 4686
28 Ga0070671_100105534 3300005355 Bacteria 2365
29 Ga0070673_100027335 3300005364 Bacteria 4228
30 Ga0070673_100043614 3300005364 Bacteria 3467
31 Ga0070659_100003246 3300005366 Bacteria 11571
32 Ga0070659_100431893 3300005366 Bacteria 1115
33 Ga0070667_100353782 3300005367 Bacteria 1330
34 Ga0070714_100222267 3300005435 Bacteria 1736
35 Ga0070663_100041575 3300005455 Bacteria 3225
36 Ga0070663_100267094 3300005455 Bacteria 1359
37 Ga0070678_100077824 3300005456 Bacteria 2503
38 Ga0070662_100497183 3300005457 Bacteria 1017
39 Ga0070662_100591470 3300005457 Unclassified 933
40 Ga0070681_10007142 3300005458 Bacteria 10880
41 Ga0068867_100004866 3300005459 Bacteria 9453
42 Ga0068867_100137537 3300005459 Bacteria 1906
43 Ga0070679_100093537 3300005530 Bacteria 2993
44 Ga0068853_100025465 3300005539 Bacteria 4964
45 Ga0068853_100247578 3300005539 Bacteria 1635
46 Ga0070672_100134850 3300005543 Bacteria 2033
47 Ga0070665_100000785 3300005548 Bacteria 41798
48 Ga0070665_100095664 3300005548 Bacteria 2975
49 Ga0070665_100111459 3300005548 Unclassified 2738
50 Ga0068854_100011551 3300005578 Bacteria 5757
51 Ga0068854_100418309 3300005578 Bacteria 1113
52 Ga0068856_100078813 3300005614 Bacteria 3266
53 Ga0068856_100725397 3300005614 Unclassified 1014
54 Ga0068856_100768830 3300005614 Bacteria 983
55 Ga0068852_100179784 3300005616 Bacteria 1988
56 Ga0068852_100208814 3300005616 Bacteria 1851
57 Ga0068852_100820285 3300005616 Bacteria 945
58 Ga0068851_10022107 3300005834 Bacteria 3095
59 Ga0068858_100319702 3300005842 Bacteria 1483
60 Ga0081539_10013700 3300005985 Bacteria 6089
61 Ga0097621_100304354 3300006237 Unclassified 1409
62 Ga0068871_100077694 3300006358 Bacteria 2744
63 Ga0105245_10073371 3300009098 Bacteria 3112
64 Ga0105248_10057325 3300009177 Bacteria 4372
65 Ga0105248_10218589 3300009177 Unclassified 2145
66 Ga0105248_10548160 3300009177 Bacteria 1304
67 Ga0105249_10721814 3300009553 Bacteria 1058
68 Ga0157373_10242561 3300013100 Bacteria 1274
69 Ga0157371_10049504 3300013102 Bacteria 2985
70 Ga0157371_10063262 3300013102 Bacteria 2623
71 Ga0157371_10101355 3300013102 Bacteria 2042
72 Ga0157374_10072841 3300013296 Bacteria 3242
73 Ga0157374_10119904 3300013296 Unclassified 2537
74 Ga0157374_10331553 3300013296 Unclassified 1509
75 Ga0157378_10126712 3300013297 Bacteria 2359
76 Ga0163162_10435870 3300013306 Unclassified 1443
77 Ga0157372_10102759 3300013307 Bacteria 3265
78 Ga0213876_10013599 3300021384 Bacteria 4318
79 Ga0213875_10028062 3300021388 Bacteria 2676
80 Ga0209565_1039895 3300025263 Bacteria 879
81 Ga0207666_1000258 3300025271 Bacteria 7761
82 Ga0207673_1002049 3300025290 Unclassified 2256
83 Ga0209675_1000126 3300025291 Bacteria 104792
84 Ga0209676_1000566 3300025292 Bacteria 55814
85 Ga0209676_1011468 3300025292 Bacteria 3569
86 Ga0209025_1039482 3300025294 Bacteria 2057
87 Ga0209758_1052906 3300025297 Bacteria 1400
88 Ga0209050_1000047 3300025298 Bacteria 380561
89 Ga0209257_1002394 3300025304 Bacteria 18771
90 Ga0209257_1028767 3300025304 Bacteria 1823
91 Ga0207697_10002738 3300025315 Bacteria 8989
92 Ga0207680_10174888 3300025903 Bacteria 1448
93 Ga0207705_10023413 3300025909 Bacteria 4405
94 Ga0207705_10034880 3300025909 Bacteria 3598
95 Ga0207705_10158343 3300025909 Bacteria 1700
96 Ga0207705_10236611 3300025909 Bacteria 1390
97 Ga0207705_10301403 3300025909 Bacteria 1229
98 Ga0207707_10045987 3300025912 Bacteria 3801
99 Ga0207662_10076514 3300025918 Unclassified 2034
100 Ga0207657_10004197 3300025919 Bacteria 15264
101 Ga0207657_10019980 3300025919 Bacteria 6345
102 Ga0207657_10028389 3300025919 Bacteria 5104
103 Ga0207657_10037480 3300025919 Bacteria 4328
104 Ga0207652_10024504 3300025921 Bacteria 5007
105 Ga0207652_10074111 3300025921 Bacteria 2963
106 Ga0207652_10550221 3300025921 Unclassified 1037
107 Ga0207694_10510512 3300025924 Bacteria 1007
108 Ga0207659_10051286 3300025926 Bacteria 2934
109 Ga0207664_10258223 3300025929 Bacteria 1523
110 Ga0207644_10324981 3300025931 Bacteria 1244
111 Ga0207690_10049033 3300025932 Bacteria 2812
112 Ga0207706_10022092 3300025933 Bacteria 5710
113 Ga0207706_10067026 3300025933 Bacteria 3158
114 Ga0207669_10062577 3300025937 Unclassified 2293
115 Ga0207691_10031650 3300025940 Bacteria 4936
116 Ga0207691_10235932 3300025940 Unclassified 1582
117 Ga0207651_10019292 3300025960 Bacteria 4082
118 Ga0207651_10025925 3300025960 Unclassified 3652
119 Ga0207712_10521378 3300025961 Bacteria 1018
120 Ga0207640_10006524 3300025981 Bacteria 6405
121 Ga0207640_10113967 3300025981 Bacteria 1923
122 Ga0207658_10744445 3300025986 Bacteria 887
123 Ga0207677_10150378 3300026023 Unclassified 1795
124 Ga0207703_10288761 3300026035 Bacteria 1492
125 Ga0207639_10001411 3300026041 Bacteria 16222
126 Ga0207639_10211170 3300026041 Bacteria 1671
127 Ga0207678_10019099 3300026067 Bacteria 6018
128 Ga0207678_10125412 3300026067 Bacteria 2190
129 Ga0207678_10360508 3300026067 Bacteria 1254
130 Ga0207648_10027903 3300026089 Bacteria 5008
131 Ga0207648_10101676 3300026089 Bacteria 2519
132 Ga0207676_10103936 3300026095 Bacteria 2362
133 Ga0207683_10064446 3300026121 Bacteria 3229
134 Ga0207698_10086215 3300026142 Bacteria 2553
135 Ga0207698_10164550 3300026142 Bacteria 1945
136 Ga0207698_10176581 3300026142 Bacteria 1887
137 Ga0207698_10286174 3300026142 Bacteria 1527
138 Ga0207698_10355617 3300026142 Bacteria 1385
139 Ga0268266_10000315 3300028379 Bacteria 76532
140 Ga0268266_10072968 3300028379 Bacteria 2977
141 Ga0268264_10222569 3300028381 Bacteria 1738
142 Ga0265339_10235848 3300031249 Bacteria 890
143 Ga0307408_100001207 3300031548 Bacteria 19481
144 Ga0307408_100211200 3300031548 Bacteria 1577
145 Ga0307408_100387892 3300031548 Bacteria 1196
146 Ga0307408_100497816 3300031548 Bacteria 1066
147 Ga0307405_10185356 3300031731 Bacteria 1498
148 Ga0307405_10201315 3300031731 Bacteria 1446
149 Ga0307413_10000666 3300031824 Bacteria 11694
150 Ga0307413_10024883 3300031824 Bacteria 3272
151 Ga0307413_10098313 3300031824 Bacteria 1926
152 Ga0307413_10127668 3300031824 Bacteria 1734
153 Ga0307413_10249321 3300031824 Bacteria 1316
154 Ga0307410_10003448 3300031852 Bacteria 7937
155 Ga0307410_10011390 3300031852 Bacteria 5083
156 Ga0307410_10028511 3300031852 Bacteria 3543
157 Ga0307410_10036028 3300031852 Bacteria 3218
158 Ga0307410_10152913 3300031852 Bacteria 1720
159 Ga0307406_10103837 3300031901 Bacteria 1941
160 Ga0307406_10162127 3300031901 Bacteria 1608
161 Ga0307406_10373573 3300031901 Bacteria 1122
162 Ga0307407_10000195 3300031903 Bacteria 18328
163 Ga0307407_10088095 3300031903 Bacteria 1896
164 Ga0307407_10258085 3300031903 Bacteria 1197
165 Ga0307407_10269698 3300031903 Bacteria 1174
166 Ga0307412_10061805 3300031911 Bacteria 2519
167 Ga0307412_10151906 3300031911 Bacteria 1710
168 Ga0307412_10195730 3300031911 Bacteria 1531
169 Ga0307412_10330481 3300031911 Bacteria 1216
170 Ga0307409_100007246 3300031995 Bacteria 6614
171 Ga0307409_100026025 3300031995 Bacteria 4118
172 Ga0307409_100039187 3300031995 Bacteria 3514
173 Ga0307409_100054125 3300031995 Bacteria 3088
174 Ga0307409_100073286 3300031995 Bacteria 2730
175 Ga0307409_100108801 3300031995 Bacteria 2319
176 Ga0307409_100153676 3300031995 Bacteria 2002
177 Ga0307409_100197757 3300031995 Bacteria 1795
178 Ga0307416_100005131 3300032002 Bacteria 7998
179 Ga0307416_100188858 3300032002 Bacteria 1940
180 Ga0307416_100467811 3300032002 Bacteria 1317
181 Ga0307414_10006616 3300032004 Bacteria 6475
182 Ga0307414_10007724 3300032004 Bacteria 6059
183 Ga0307414_10016690 3300032004 Bacteria 4472
184 Ga0307414_10042508 3300032004 Bacteria 3088
185 Ga0307414_10094291 3300032004 Bacteria 2234
186 Ga0307411_10000206 3300032005 Bacteria 18997
187 Ga0307411_10016230 3300032005 Bacteria 4213
188 Ga0307411_10017851 3300032005 Bacteria 4057
189 Ga0307411_10062314 3300032005 Bacteria 2487
190 Ga0307411_10108643 3300032005 Bacteria 1979
191 Ga0307411_10115509 3300032005 Bacteria 1930
192 Ga0307411_10441207 3300032005 Bacteria 1086
193 Ga0307411_10550074 3300032005 Bacteria 984
194 Ga0307415_100013821 3300032126 Bacteria 4725
195 Ga0307415_100082264 3300032126 Bacteria 2303
196 Ga0307415_100156734 3300032126 Bacteria 1759
197 Ga0395899_0004801 3300037312 Bacteria 10525
198 Ga0395899_0259656 3300037312 Bacteria 1189
199 Ga0395900_0009356 3300037418 Bacteria 10047
200 Ga0395900_0013973 3300037418 Bacteria 8194
201 Ga0395900_0245090 3300037418 Bacteria 1796
202 Ga0395900_0396603 3300037418 Bacteria 1345
203 Ga0395900_0514770 3300037418 Bacteria 1145
204 Ga0395898_0006984 3300037466 Bacteria 12002
205 Ga0395905_0009719 3300037471 Bacteria 9384
206 Ga0395905_0085902 3300037471 Bacteria 2948
207 Ga0395905_0148072 3300037471 Bacteria 2209
208 Ga0395905_0224906 3300037471 Bacteria 1756
209 Ga0395905_0272025 3300037471 Bacteria 1580
210 Ga0436364_0130435 3300037853 Bacteria 29193
211 Ga0395901_0005033 3300038443 Bacteria 13343
212 Ga0436365_1327753 3300039437 Bacteria 5237
213 Ga0451837_1525730 3300041494 Bacteria 1670
214 Ga0439432_063506 3300042006 Bacteria 1135
215 Ga0466969_0121591 3300044656 Bacteria 1215
216 Ga0466972_0054828 3300044658 Bacteria 1918
217 Ga0466966_0040814 3300044684 Bacteria 2985
218 Ga0466966_0065289 3300044684 Bacteria 2289
219 Ga0466966_0101135 3300044684 Bacteria 1783
220 Ga0466966_0170082 3300044684 Bacteria 1324
221 Ga0466961_0065287 3300044693 Bacteria 2312
222 Ga0466961_0118095 3300044693 Bacteria 1666
223 Ga0466961_0230732 3300044693 Bacteria 1139
224 Ga0466963_0026279 3300044694 Bacteria 3722
225 Ga0466963_0032447 3300044694 Bacteria 3382
226 Ga0466963_0034038 3300044694 Bacteria 3313
227 Ga0466963_0118444 3300044694 Bacteria 1821
228 Ga0466963_0651907 3300044694 Bacteria 743
229 Ga0466964_0027456 3300044706 Bacteria 2236
230 Ga0466971_0190777 3300044719 Bacteria 965
231 Ga0466970_0069276 3300044765 Bacteria 1896
232 Ga0466957_0002271 3300044842 Bacteria 10298
233 Ga0466957_0009530 3300044842 Bacteria 5545
234 Ga0466957_0015649 3300044842 Bacteria 4431
235 Ga0466960_0112244 3300044901 Bacteria 1418
236 Ga0466960_0294152 3300044901 Bacteria 913
237 Ga0466959_0035022 3300045049 Bacteria 3713
238 Ga0466959_0051934 3300045049 Bacteria 3004
239 Ga0466959_0053657 3300045049 Bacteria 2946
240 Ga0466959_0115194 3300045049 Bacteria 1915
241 Ga0466958_0007060 3300045836 Bacteria 6147
242 Ga0466958_0047258 3300045836 Bacteria 2598
243 Ga0466958_0049336 3300045836 Bacteria 2546
244 Ga0466958_0058436 3300045836 Bacteria 2345
245 Ga0466967_0011212 3300045976 Bacteria 6775
246 Ga0466967_0019253 3300045976 Bacteria 5484
247 Ga0466967_0048877 3300045976 Bacteria 3697
248 Ga0466967_0051871 3300045976 Bacteria 3597
249 Ga0466967_0084875 3300045976 Bacteria 2866
250 Ga0466967_0133896 3300045976 Bacteria 2303
251 Ga0466967_0137801 3300045976 Bacteria 2270
252 Ga0466967_0196154 3300045976 Bacteria 1910
253 Ga0466967_0253023 3300045976 Bacteria 1683
254 Ga0466967_0272311 3300045976 Bacteria 1623
255 Ga0466967_0370427 3300045976 Bacteria 1389
256 Ga0466967_0631004 3300045976 Bacteria 1059
257 Ga0466967_0876399 3300045976 Bacteria 892
258 Ga0495663_0038748 3300046525 Bacteria 1442
259 Ga0495625_0000179 3300046660 Bacteria 98550
260 Ga0495669_0012099 3300046684 Bacteria 3667
261 Ga0495677_0002744 3300047445 Bacteria 6882
262 Ga0495685_091350 3300047447 Bacteria 1009
263 Ga0496108_0053305 3300048911 Bacteria 3391
264 Ga0496109_0161623 3300048912 Bacteria 2098
265 Ga0496110_0063648 3300048913 Bacteria 3259
266 Ga0496112_0034109 3300048915 Bacteria 4951
267 Ga0496113_0024819 3300048916 Bacteria 4266
268 Ga0496114_0239664 3300048917 Unclassified 1595
269 Ga0496118_0079788 3300048921 Bacteria 2307
270 Ga0496126_0497258 3300048929 Bacteria 975
271 Ga0501032_0000611 3300049569 Bacteria 28900
272 Ga0501033_0000215 3300049570 Bacteria 55477
273 Ga0501036_0055875 3300049572 Bacteria 3345
274 Ga0501037_0089579 3300049573 Bacteria 2226
275 Ga0501047_0009954 3300049581 Bacteria 8991
276 Ga0501080_0010054 3300049742 Bacteria 8649
277 Ga0501035_0010194 3300049822 Bacteria 8721
278 Ga0501044_0000160 3300049823 Bacteria 83543
279 Ga0500592_001345 3300053116 Bacteria 3986
280 Ga0500568_0000573 3300053139 Bacteria 26897
281 Ga0500627_0000024 3300053158 Bacteria 104034
282 Ga0587073_0025003 3300059492 Bacteria 1184
283 Ga0466962_0005724 3300061719 Bacteria 5972
284 Ga0466962_0041716 3300061719 Bacteria 2195
285 Ga0466962_0099658 3300061719 Bacteria 1395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025292 Ga0209676_1011468 Ga0209676_10114684 207
2 3300044694 Ga0466963_0651907 Ga0466963_0651907_89_733 214
3 3300032004 Ga0307414_10007724 Ga0307414_100077247 221
4 3300048917 Ga0496114_0239664 Ga0496114_0239664_67_828 222
5 iso_pu_bacteria 2852653556 2852656825 234
6 3300049573 Ga0501037_0089579 Ga0501037_0089579_18_737 238
7 3300005614 Ga0068856_100768830 Ga0068856_1007688301 248
8 3300005288 Ga0065714_10136561 Ga0065714_101365611 252
9 3300005290 Ga0065712_10003408 Ga0065712_100034081 252
10 3300005293 Ga0065715_10005159 Ga0065715_100051594 252
11 3300005338 Ga0068868_100208609 Ga0068868_1002086092 252
12 3300005343 Ga0070687_100068009 Ga0070687_1000680092 252
13 3300005354 Ga0070675_100028595 Ga0070675_1000285954 252
14 3300005355 Ga0070671_100027449 Ga0070671_1000274492 252
15 3300005364 Ga0070673_100027335 Ga0070673_1000273354 252
16 3300005457 Ga0070662_100591470 Ga0070662_1005914701 252
17 3300005543 Ga0070672_100134850 Ga0070672_1001348502 252
18 3300005548 Ga0070665_100111459 Ga0070665_1001114591 252
19 3300006237 Ga0097621_100304354 Ga0097621_1003043541 252
20 3300006358 Ga0068871_100077694 Ga0068871_1000776942 252
21 3300009098 Ga0105245_10073371 Ga0105245_100733713 252
22 3300009177 Ga0105248_10218589 Ga0105248_102185892 252
23 3300009553 Ga0105249_10721814 Ga0105249_107218141 252
24 3300013102 Ga0157371_10063262 Ga0157371_100632622 252
25 3300013296 Ga0157374_10119904 Ga0157374_101199041 252
26 3300013297 Ga0157378_10126712 Ga0157378_101267123 252
27 3300013306 Ga0163162_10435870 Ga0163162_104358701 252
28 3300025271 Ga0207666_1000258 Ga0207666_10002584 252
29 3300025290 Ga0207673_1002049 Ga0207673_10020492 252
30 3300025315 Ga0207697_10002738 Ga0207697_100027384 252
31 3300025903 Ga0207680_10174888 Ga0207680_101748881 252
32 3300025918 Ga0207662_10076514 Ga0207662_100765142 252
33 3300025926 Ga0207659_10051286 Ga0207659_100512862 252
34 3300025933 Ga0207706_10067026 Ga0207706_100670263 252
35 3300025937 Ga0207669_10062577 Ga0207669_100625772 252
36 3300025940 Ga0207691_10235932 Ga0207691_102359322 252
37 3300025960 Ga0207651_10025925 Ga0207651_100259251 252
38 3300025961 Ga0207712_10521378 Ga0207712_105213781 252
39 3300026023 Ga0207677_10150378 Ga0207677_101503782 252
40 3300026121 Ga0207683_10064446 Ga0207683_100644463 252
41 3300005985 Ga0081539_10013700 Ga0081539_100137004 253
42 3300037418 Ga0395900_0396603 Ga0395900_0396603_548_1327 253
43 3300025924 Ga0207694_10510512 Ga0207694_105105121 254
44 iso_pu_bacteria 2643221560 2643822627 255
45 iso_pu_bacteria 2643221563 2643833825 255
46 iso_pu_bacteria 2643221608 2644054751 255
47 3300031548 Ga0307408_100211200 Ga0307408_1002112003 257
48 3300031731 Ga0307405_10201315 Ga0307405_102013152 257
49 3300031824 Ga0307413_10249321 Ga0307413_102493212 257
50 3300031901 Ga0307406_10162127 Ga0307406_101621272 257
51 3300031903 Ga0307407_10269698 Ga0307407_102696982 257
52 3300031911 Ga0307412_10330481 Ga0307412_103304812 257
53 3300032002 Ga0307416_100188858 Ga0307416_1001888582 257
54 3300045976 Ga0466967_0196154 Ga0466967_0196154_934_1707 257
55 3300046660 Ga0495625_0000179 Ga0495625_0000179_88643_89419 257
56 3300002774 JGI25150J39212_1000140 JGI25150J39212_100014022 258
57 3300003794 Ga0055531_10041765 Ga0055531_100417652 258
58 3300005842 Ga0068858_100319702 Ga0068858_1003197021 258
59 3300025294 Ga0209025_1039482 Ga0209025_10394822 258
60 3300025304 Ga0209257_1002394 Ga0209257_100239411 258
61 3300025304 Ga0209257_1028767 Ga0209257_10287673 258
62 3300026035 Ga0207703_10288761 Ga0207703_102887612 258
63 3300031824 Ga0307413_10024883 Ga0307413_100248833 258
64 3300031824 Ga0307413_10127668 Ga0307413_101276682 258
65 3300031852 Ga0307410_10028511 Ga0307410_100285111 258
66 3300031911 Ga0307412_10151906 Ga0307412_101519061 258
67 3300031995 Ga0307409_100153676 Ga0307409_1001536763 258
68 3300032004 Ga0307414_10006616 Ga0307414_100066164 258
69 3300032005 Ga0307411_10108643 Ga0307411_101086432 258
70 3300032005 Ga0307411_10115509 Ga0307411_101155092 258
71 3300044901 Ga0466960_0112244 Ga0466960_0112244_492_1271 258
72 3300044901 Ga0466960_0294152 Ga0466960_0294152_13_789 258
73 3300048921 Ga0496118_0079788 Ga0496118_0079788_1447_2229 258
74 3300001979 JGI24740J21852_10055962 JGI24740J21852_100559622 259
75 3300002067 JGI24735J21928_10032058 JGI24735J21928_100320582 259
76 3300003693 Ga0032354_1061588 Ga0032354_10615883 259
77 3300003781 Ga0055536_1000713 Ga0055536_100071310 259
78 3300003784 Ga0055534_1005207 Ga0055534_10052072 259
79 3300003794 Ga0055531_10019688 Ga0055531_100196882 259
80 3300004799 Ga0058863_11827908 Ga0058863_118279082 259
81 3300005327 Ga0070658_10013524 Ga0070658_100135245 259
82 3300005327 Ga0070658_10241114 Ga0070658_102411142 259
83 3300005328 Ga0070676_10305328 Ga0070676_103053282 259
84 3300005337 Ga0070682_100180207 Ga0070682_1001802072 259
85 3300005337 Ga0070682_100399281 Ga0070682_1003992811 259
86 3300005339 Ga0070660_100032882 Ga0070660_1000328822 259
87 3300005339 Ga0070660_100046689 Ga0070660_1000466893 259
88 3300005339 Ga0070660_100497042 Ga0070660_1004970421 259
89 3300005344 Ga0070661_100023875 Ga0070661_1000238754 259
90 3300005344 Ga0070661_100157713 Ga0070661_1001577132 259
91 3300005355 Ga0070671_100010969 Ga0070671_1000109695 259
92 3300005355 Ga0070671_100105534 Ga0070671_1001055342 259
93 3300005364 Ga0070673_100043614 Ga0070673_1000436143 259
94 3300005366 Ga0070659_100003246 Ga0070659_10000324613 259
95 3300005366 Ga0070659_100431893 Ga0070659_1004318931 259
96 3300005367 Ga0070667_100353782 Ga0070667_1003537821 259
97 3300005435 Ga0070714_100222267 Ga0070714_1002222672 259
98 3300005455 Ga0070663_100041575 Ga0070663_1000415752 259
99 3300005455 Ga0070663_100267094 Ga0070663_1002670942 259
100 3300005456 Ga0070678_100077824 Ga0070678_1000778242 259
101 3300005457 Ga0070662_100497183 Ga0070662_1004971832 259
102 3300005458 Ga0070681_10007142 Ga0070681_1000714212 259
103 3300005459 Ga0068867_100004866 Ga0068867_1000048665 259
104 3300005459 Ga0068867_100137537 Ga0068867_1001375373 259
105 3300005530 Ga0070679_100093537 Ga0070679_1000935373 259
106 3300005539 Ga0068853_100025465 Ga0068853_1000254653 259
107 3300005539 Ga0068853_100247578 Ga0068853_1002475782 259
108 3300005548 Ga0070665_100000785 Ga0070665_10000078530 259
109 3300005548 Ga0070665_100095664 Ga0070665_1000956644 259
110 3300005578 Ga0068854_100011551 Ga0068854_1000115512 259
111 3300005578 Ga0068854_100418309 Ga0068854_1004183092 259
112 3300005614 Ga0068856_100078813 Ga0068856_1000788132 259
113 3300005614 Ga0068856_100725397 Ga0068856_1007253971 259
114 3300005616 Ga0068852_100179784 Ga0068852_1001797842 259
115 3300005616 Ga0068852_100208814 Ga0068852_1002088142 259
116 3300005616 Ga0068852_100820285 Ga0068852_1008202852 259
117 3300005834 Ga0068851_10022107 Ga0068851_100221073 259
118 3300009177 Ga0105248_10057325 Ga0105248_100573255 259
119 3300009177 Ga0105248_10548160 Ga0105248_105481602 259
120 3300013100 Ga0157373_10242561 Ga0157373_102425611 259
121 3300013102 Ga0157371_10049504 Ga0157371_100495043 259
122 3300013102 Ga0157371_10101355 Ga0157371_101013551 259
123 3300013296 Ga0157374_10072841 Ga0157374_100728412 259
124 3300013296 Ga0157374_10331553 Ga0157374_103315531 259
125 3300013307 Ga0157372_10102759 Ga0157372_101027591 259
126 3300021384 Ga0213876_10013599 Ga0213876_100135993 259
127 3300021388 Ga0213875_10028062 Ga0213875_100280622 259
128 3300025263 Ga0209565_1039895 Ga0209565_10398951 259
129 3300025291 Ga0209675_1000126 Ga0209675_100012680 259
130 3300025292 Ga0209676_1000566 Ga0209676_100056639 259
131 3300025297 Ga0209758_1052906 Ga0209758_10529061 259
132 3300025298 Ga0209050_1000047 Ga0209050_100004715 259
133 3300025909 Ga0207705_10023413 Ga0207705_100234134 259
134 3300025909 Ga0207705_10034880 Ga0207705_100348804 259
135 3300025909 Ga0207705_10158343 Ga0207705_101583432 259
136 3300025909 Ga0207705_10236611 Ga0207705_102366112 259
137 3300025909 Ga0207705_10301403 Ga0207705_103014032 259
138 3300025912 Ga0207707_10045987 Ga0207707_100459873 259
139 3300025919 Ga0207657_10004197 Ga0207657_100041976 259
140 3300025919 Ga0207657_10019980 Ga0207657_100199807 259
141 3300025919 Ga0207657_10028389 Ga0207657_100283892 259
142 3300025919 Ga0207657_10037480 Ga0207657_100374805 259
143 3300025921 Ga0207652_10024504 Ga0207652_100245042 259
144 3300025921 Ga0207652_10074111 Ga0207652_100741112 259
145 3300025921 Ga0207652_10550221 Ga0207652_105502211 259
146 3300025929 Ga0207664_10258223 Ga0207664_102582232 259
147 3300025931 Ga0207644_10324981 Ga0207644_103249811 259
148 3300025932 Ga0207690_10049033 Ga0207690_100490332 259
149 3300025933 Ga0207706_10022092 Ga0207706_100220925 259
150 3300025940 Ga0207691_10031650 Ga0207691_100316504 259
151 3300025960 Ga0207651_10019292 Ga0207651_100192923 259
152 3300025981 Ga0207640_10006524 Ga0207640_100065242 259
153 3300025981 Ga0207640_10113967 Ga0207640_101139672 259
154 3300025986 Ga0207658_10744445 Ga0207658_107444451 259
155 3300026041 Ga0207639_10001411 Ga0207639_1000141116 259
156 3300026041 Ga0207639_10211170 Ga0207639_102111702 259
157 3300026067 Ga0207678_10019099 Ga0207678_100190995 259
158 3300026067 Ga0207678_10125412 Ga0207678_101254122 259
159 3300026067 Ga0207678_10360508 Ga0207678_103605081 259
160 3300026089 Ga0207648_10027903 Ga0207648_100279036 259
161 3300026089 Ga0207648_10101676 Ga0207648_101016763 259
162 3300026095 Ga0207676_10103936 Ga0207676_101039362 259
163 3300026142 Ga0207698_10086215 Ga0207698_100862152 259
164 3300026142 Ga0207698_10164550 Ga0207698_101645502 259
165 3300026142 Ga0207698_10176581 Ga0207698_101765811 259
166 3300026142 Ga0207698_10286174 Ga0207698_102861742 259
167 3300026142 Ga0207698_10355617 Ga0207698_103556171 259
168 3300028379 Ga0268266_10000315 Ga0268266_1000031515 259
169 3300028379 Ga0268266_10072968 Ga0268266_100729682 259
170 3300028381 Ga0268264_10222569 Ga0268264_102225691 259
171 3300031249 Ga0265339_10235848 Ga0265339_102358481 259
172 3300031548 Ga0307408_100001207 Ga0307408_1000012075 259
173 3300031548 Ga0307408_100387892 Ga0307408_1003878922 259
174 3300031548 Ga0307408_100497816 Ga0307408_1004978161 259
175 3300031731 Ga0307405_10185356 Ga0307405_101853562 259
176 3300031824 Ga0307413_10000666 Ga0307413_100006664 259
177 3300031824 Ga0307413_10098313 Ga0307413_100983132 259
178 3300031852 Ga0307410_10003448 Ga0307410_100034489 259
179 3300031852 Ga0307410_10011390 Ga0307410_100113902 259
180 3300031852 Ga0307410_10036028 Ga0307410_100360282 259
181 3300031852 Ga0307410_10152913 Ga0307410_101529132 259
182 3300031901 Ga0307406_10103837 Ga0307406_101038372 259
183 3300031901 Ga0307406_10373573 Ga0307406_103735732 259
184 3300031903 Ga0307407_10000195 Ga0307407_1000019519 259
185 3300031903 Ga0307407_10088095 Ga0307407_100880952 259
186 3300031903 Ga0307407_10258085 Ga0307407_102580852 259
187 3300031911 Ga0307412_10061805 Ga0307412_100618052 259
188 3300031911 Ga0307412_10195730 Ga0307412_101957302 259
189 3300031995 Ga0307409_100007246 Ga0307409_1000072463 259
190 3300031995 Ga0307409_100026025 Ga0307409_1000260255 259
191 3300031995 Ga0307409_100039187 Ga0307409_1000391872 259
192 3300031995 Ga0307409_100054125 Ga0307409_1000541253 259
193 3300031995 Ga0307409_100073286 Ga0307409_1000732862 259
194 3300031995 Ga0307409_100108801 Ga0307409_1001088013 259
195 3300031995 Ga0307409_100197757 Ga0307409_1001977572 259
196 3300032002 Ga0307416_100005131 Ga0307416_1000051313 259
197 3300032002 Ga0307416_100467811 Ga0307416_1004678112 259
198 3300032004 Ga0307414_10016690 Ga0307414_100166903 259
199 3300032004 Ga0307414_10042508 Ga0307414_100425082 259
200 3300032004 Ga0307414_10094291 Ga0307414_100942912 259
201 3300032005 Ga0307411_10000206 Ga0307411_1000020617 259
202 3300032005 Ga0307411_10016230 Ga0307411_100162305 259
203 3300032005 Ga0307411_10017851 Ga0307411_100178514 259
204 3300032005 Ga0307411_10062314 Ga0307411_100623143 259
205 3300032005 Ga0307411_10441207 Ga0307411_104412072 259
206 3300032005 Ga0307411_10550074 Ga0307411_105500742 259
207 3300032126 Ga0307415_100013821 Ga0307415_1000138214 259
208 3300032126 Ga0307415_100082264 Ga0307415_1000822642 259
209 3300032126 Ga0307415_100156734 Ga0307415_1001567342 259
210 3300037312 Ga0395899_0004801 Ga0395899_0004801_4450_5229 259
211 3300037312 Ga0395899_0259656 Ga0395899_0259656_142_921 259
212 3300037418 Ga0395900_0009356 Ga0395900_0009356_920_1699 259
213 3300037418 Ga0395900_0013973 Ga0395900_0013973_1188_1967 259
214 3300037418 Ga0395900_0245090 Ga0395900_0245090_492_1271 259
215 3300037418 Ga0395900_0514770 Ga0395900_0514770_337_1116 259
216 3300037466 Ga0395898_0006984 Ga0395898_0006984_5498_6277 259
217 3300037471 Ga0395905_0009719 Ga0395905_0009719_2514_3293 259
218 3300037471 Ga0395905_0085902 Ga0395905_0085902_229_1008 259
219 3300037471 Ga0395905_0148072 Ga0395905_0148072_1068_1847 259
220 3300037471 Ga0395905_0224906 Ga0395905_0224906_793_1572 259
221 3300037471 Ga0395905_0272025 Ga0395905_0272025_199_978 259
222 3300037853 Ga0436364_0130435 Ga0436364_0130435_27914_28693 259
223 3300038443 Ga0395901_0005033 Ga0395901_0005033_11249_12028 259
224 3300039437 Ga0436365_1327753 Ga0436365_1327753_1700_2479 259
225 3300041494 Ga0451837_1525730 Ga0451837_1525730_591_1373 259
226 3300042006 Ga0439432_063506 Ga0439432_063506_138_917 259
227 3300044656 Ga0466969_0121591 Ga0466969_0121591_356_1135 259
228 3300044658 Ga0466972_0054828 Ga0466972_0054828_957_1736 259
229 3300044684 Ga0466966_0040814 Ga0466966_0040814_1803_2582 259
230 3300044684 Ga0466966_0065289 Ga0466966_0065289_727_1509 259
231 3300044684 Ga0466966_0101135 Ga0466966_0101135_673_1452 259
232 3300044684 Ga0466966_0170082 Ga0466966_0170082_285_1064 259
233 3300044693 Ga0466961_0065287 Ga0466961_0065287_1394_2173 259
234 3300044693 Ga0466961_0118095 Ga0466961_0118095_753_1535 259
235 3300044693 Ga0466961_0230732 Ga0466961_0230732_297_1076 259
236 3300044694 Ga0466963_0026279 Ga0466963_0026279_1874_2653 259
237 3300044694 Ga0466963_0032447 Ga0466963_0032447_2225_3004 259
238 3300044694 Ga0466963_0034038 Ga0466963_0034038_223_1002 259
239 3300044694 Ga0466963_0118444 Ga0466963_0118444_288_1067 259
240 3300044706 Ga0466964_0027456 Ga0466964_0027456_58_837 259
241 3300044719 Ga0466971_0190777 Ga0466971_0190777_26_805 259
242 3300044765 Ga0466970_0069276 Ga0466970_0069276_953_1732 259
243 3300044842 Ga0466957_0002271 Ga0466957_0002271_9020_9799 259
244 3300044842 Ga0466957_0009530 Ga0466957_0009530_1956_2735 259
245 3300044842 Ga0466957_0015649 Ga0466957_0015649_1397_2176 259
246 3300045049 Ga0466959_0035022 Ga0466959_0035022_2909_3688 259
247 3300045049 Ga0466959_0051934 Ga0466959_0051934_890_1672 259
248 3300045049 Ga0466959_0053657 Ga0466959_0053657_2146_2925 259
249 3300045049 Ga0466959_0115194 Ga0466959_0115194_798_1580 259
250 3300045836 Ga0466958_0007060 Ga0466958_0007060_2080_2859 259
251 3300045836 Ga0466958_0047258 Ga0466958_0047258_1759_2538 259
252 3300045836 Ga0466958_0049336 Ga0466958_0049336_1498_2277 259
253 3300045836 Ga0466958_0058436 Ga0466958_0058436_1256_2035 259
254 3300045976 Ga0466967_0011212 Ga0466967_0011212_1790_2569 259
255 3300045976 Ga0466967_0019253 Ga0466967_0019253_3609_4388 259
256 3300045976 Ga0466967_0048877 Ga0466967_0048877_2788_3567 259
257 3300045976 Ga0466967_0051871 Ga0466967_0051871_118_897 259
258 3300045976 Ga0466967_0084875 Ga0466967_0084875_273_1052 259
259 3300045976 Ga0466967_0133896 Ga0466967_0133896_1437_2216 259
260 3300045976 Ga0466967_0137801 Ga0466967_0137801_1020_1799 259
261 3300045976 Ga0466967_0253023 Ga0466967_0253023_857_1636 259
262 3300045976 Ga0466967_0272311 Ga0466967_0272311_635_1414 259
263 3300045976 Ga0466967_0370427 Ga0466967_0370427_389_1168 259
264 3300045976 Ga0466967_0631004 Ga0466967_0631004_185_964 259
265 3300045976 Ga0466967_0876399 Ga0466967_0876399_19_798 259
266 3300046525 Ga0495663_0038748 Ga0495663_0038748_404_1183 259
267 3300046684 Ga0495669_0012099 Ga0495669_0012099_1553_2332 259
268 3300047445 Ga0495677_0002744 Ga0495677_0002744_725_1504 259
269 3300047447 Ga0495685_091350 Ga0495685_091350_70_849 259
270 3300048911 Ga0496108_0053305 Ga0496108_0053305_2477_3256 259
271 3300048912 Ga0496109_0161623 Ga0496109_0161623_703_1482 259
272 3300048913 Ga0496110_0063648 Ga0496110_0063648_2466_3245 259
273 3300048915 Ga0496112_0034109 Ga0496112_0034109_1710_2489 259
274 3300048916 Ga0496113_0024819 Ga0496113_0024819_2044_2823 259
275 3300048929 Ga0496126_0497258 Ga0496126_0497258_148_930 259
276 3300049569 Ga0501032_0000611 Ga0501032_0000611_3256_4038 259
277 3300049570 Ga0501033_0000215 Ga0501033_0000215_5604_6386 259
278 3300049572 Ga0501036_0055875 Ga0501036_0055875_2403_3185 259
279 3300049581 Ga0501047_0009954 Ga0501047_0009954_650_1432 259
280 3300049742 Ga0501080_0010054 Ga0501080_0010054_566_1345 259
281 3300049822 Ga0501035_0010194 Ga0501035_0010194_138_917 259
282 3300049823 Ga0501044_0000160 Ga0501044_0000160_37302_38084 259
283 3300053116 Ga0500592_001345 Ga0500592_001345_1404_2186 259
284 3300053139 Ga0500568_0000573 Ga0500568_0000573_4695_5477 259
285 3300053158 Ga0500627_0000024 Ga0500627_0000024_76665_77447 259
286 3300059492 Ga0587073_0025003 Ga0587073_0025003_349_1128 259
287 3300061719 Ga0466962_0005724 Ga0466962_0005724_635_1414 259
288 3300061719 Ga0466962_0041716 Ga0466962_0041716_963_1742 259
289 3300061719 Ga0466962_0099658 Ga0466962_0099658_536_1315 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

198

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

215

0.91

PF08659

KR

KR domain

7

188

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2v-assembly2.cif.gz_C structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.908 5 224
2q2q-assembly3.cif.gz_G structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.9073 5 227
2q2v-assembly2.cif.gz_D structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.9051 5 227
8g93-assembly1.cif.gz_A crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9029 4 237
8g93-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.8994 4 240
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9348 92 184 3.40.50.720
af_Q54CD7_32_271_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 4 215 3.40.50.720
af_Q10782_3_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9242 1 242 3.40.50.720
af_I6YB11_7_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9169 4 234 3.40.50.720
af_P9WGS3_322_571_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9111 5 230 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5C9CYI3-F1-model_v4 deleted 0.998 105 259
AF-A0A7H0G6I9-F1-model_v4 deleted 0.9961 1 259
AF-A0A4R3E829-F1-model_v4 Short subunit dehydrogenase 0.9918 80 256 GO:0016491
AF-A0A354EN24-F1-model_v4 Oxidoreductase 0.9913 24 257 GO:0016491
AF-A0A848FFC4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.991 2 258 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map