F389197

General Info

Members Datasets Scaffolds Average Seq Length
289 150 578 180

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10007418|Ga0157375_100074184
Length 176
Sequence MAVLQIIRNLFVPTEIVETEVFVPAPATTYEIHPLTEKHLKEVMRVNLRCFKKGENYTKHTFSYLLNEPTTLSYRVAAPDEPIVGFVFVMTNQGTGHITTIGVAPEHRRRGLAEKMLAHAEEALQKREIATVSLEVRVSNIAAQSLYRGLGYTIVQRLNNYYNNGEDAFLMVKSLY

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
129 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
130 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
131 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
134 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
135 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
136 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
137 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
138 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
139 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
140 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
141 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
144 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
145 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
146 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
147 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
148 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 25.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10007418 3300013308 Bacteria 9600
2 LJQas_1000057 3300000549 Bacteria 17913
3 Ga0065704_10096367 3300005289 Bacteria 2428
4 Ga0065715_10545555 3300005293 Bacteria 745
5 Ga0070690_100060565 3300005330 Bacteria 2436
6 Ga0070670_100078916 3300005331 Bacteria 2828
7 Ga0070666_10021072 3300005335 Bacteria 4221
8 Ga0070680_100518184 3300005336 Unclassified 1021
9 Ga0070689_100051825 3300005340 Bacteria 3173
10 Ga0070689_100096533 3300005340 Unclassified 2336
11 Ga0070689_100578626 3300005340 Bacteria 970
12 Ga0070661_100757774 3300005344 Bacteria 794
13 Ga0070668_100327559 3300005347 Bacteria 1291
14 Ga0070675_101003732 3300005354 Bacteria 766
15 Ga0070671_100040582 3300005355 Bacteria 3866
16 Ga0070671_100100884 3300005355 Bacteria 2421
17 Ga0070671_100137344 3300005355 Bacteria 2061
18 Ga0070673_100290015 3300005364 Unclassified 1438
19 Ga0070688_100021286 3300005365 Unclassified 3786
20 Ga0070659_100105827 3300005366 Bacteria 2267
21 Ga0070667_100037835 3300005367 Bacteria 4045
22 Ga0070701_10469267 3300005438 Unclassified 811
23 Ga0070663_100179974 3300005455 Bacteria 1639
24 Ga0070663_100189929 3300005455 Bacteria 1598
25 Ga0070678_100172678 3300005456 Bacteria 1762
26 Ga0070662_100030311 3300005457 Bacteria 3783
27 Ga0070662_100191890 3300005457 Unclassified 1616
28 Ga0070681_10021183 3300005458 Bacteria 6514
29 Ga0070681_10046084 3300005458 Bacteria 4359
30 Ga0068867_100363067 3300005459 Unclassified 1212
31 Ga0070685_10325403 3300005466 Bacteria 1043
32 Ga0070679_100033542 3300005530 Bacteria 5083
33 Ga0068853_100004821 3300005539 Bacteria 10485
34 Ga0068853_100007824 3300005539 Bacteria 8572
35 Ga0068853_100305965 3300005539 Bacteria 1470
36 Ga0070695_100065018 3300005545 Bacteria 2374
37 Ga0070704_100003678 3300005549 Bacteria 8822
38 Ga0068855_100085997 3300005563 Bacteria 3637
39 Ga0068855_100249940 3300005563 Unclassified 1978
40 Ga0070664_100001584 3300005564 Bacteria 18178
41 Ga0070664_100011374 3300005564 Bacteria 7218
42 Ga0070664_100050686 3300005564 Bacteria 3514
43 Ga0070664_100182048 3300005564 Unclassified 1868
44 Ga0070664_100363584 3300005564 Bacteria 1318
45 Ga0068857_100078662 3300005577 Bacteria 2943
46 Ga0068857_100521273 3300005577 Bacteria 1117
47 Ga0068854_100011365 3300005578 Bacteria 5792
48 Ga0068854_100052424 3300005578 Bacteria 2925
49 Ga0068852_100070653 3300005616 Bacteria 3064
50 Ga0068852_100255938 3300005616 Bacteria 1679
51 Ga0068859_100007031 3300005617 Bacteria 11425
52 Ga0068859_100075738 3300005617 Bacteria 3405
53 Ga0068859_100345004 3300005617 Bacteria 1583
54 Ga0068864_100088766 3300005618 Bacteria 2723
55 Ga0068864_100131636 3300005618 Bacteria 2247
56 Ga0068864_100517853 3300005618 Bacteria 1149
57 Ga0068861_100365390 3300005719 Bacteria 1270
58 Ga0068851_10043459 3300005834 Bacteria 2266
59 Ga0068851_10129787 3300005834 Bacteria 1362
60 Ga0068870_10187010 3300005840 Bacteria 1247
61 Ga0068870_10490808 3300005840 Unclassified 817
62 Ga0068863_100285840 3300005841 Bacteria 1598
63 Ga0068863_100548379 3300005841 Bacteria 1141
64 Ga0068858_100095107 3300005842 Bacteria 2776
65 Ga0068858_100322580 3300005842 Bacteria 1476
66 Ga0068860_100069659 3300005843 Bacteria 3343
67 Ga0068862_100315318 3300005844 Unclassified 1442
68 Ga0068862_100331731 3300005844 Bacteria 1407
69 Ga0097621_100069977 3300006237 Bacteria 2897
70 Ga0097621_100730502 3300006237 Bacteria 913
71 Ga0097621_101286583 3300006237 Unclassified 690
72 Ga0068871_100210042 3300006358 Bacteria 1683
73 Ga0075428_100907897 3300006844 Bacteria 934
74 Ga0097620_100007031 3300006931 Bacteria 11425
75 Ga0097620_100075740 3300006931 Bacteria 3405
76 Ga0097620_100344988 3300006931 Bacteria 1583
77 Ga0105240_10196583 3300009093 Bacteria 2367
78 Ga0105240_10904117 3300009093 Bacteria 949
79 Ga0111539_10246221 3300009094 Bacteria 2081
80 Ga0105245_10344114 3300009098 Bacteria 1475
81 Ga0105245_11047117 3300009098 Bacteria 861
82 Ga0105245_11187793 3300009098 Unclassified 811
83 Ga0105243_10154303 3300009148 Unclassified 1973
84 Ga0105241_10014080 3300009174 Bacteria 5861
85 Ga0105241_10279194 3300009174 Bacteria 1426
86 Ga0105241_10964268 3300009174 Unclassified 796
87 Ga0105242_10006254 3300009176 Bacteria 9168
88 Ga0105248_11215382 3300009177 Bacteria 852
89 Ga0105237_10561757 3300009545 Bacteria 1148
90 Ga0105238_10198538 3300009551 Bacteria 1981
91 Ga0105249_10030153 3300009553 Bacteria 4901
92 Ga0105249_10060599 3300009553 Unclassified 3472
93 Ga0105249_10085933 3300009553 Bacteria 2933
94 Ga0105249_10911590 3300009553 Bacteria 946
95 Ga0105239_10283329 3300010375 Unclassified 1866
96 Ga0105239_11327208 3300010375 Unclassified 830
97 Ga0157373_10345014 3300013100 Bacteria 1062
98 Ga0157371_10542808 3300013102 Bacteria 861
99 Ga0157371_11092443 3300013102 Unclassified 611
100 Ga0157370_10101862 3300013104 Unclassified 2689
101 Ga0157369_10028193 3300013105 Bacteria 6215
102 Ga0157369_10094406 3300013105 Bacteria 3193
103 Ga0157369_11001840 3300013105 Bacteria 855
104 Ga0157378_10119723 3300013297 Bacteria 2425
105 Ga0163162_10198051 3300013306 Unclassified 2137
106 Ga0163162_10293882 3300013306 Unclassified 1756
107 Ga0163162_10557176 3300013306 Unclassified 1274
108 Ga0163162_10798844 3300013306 Bacteria 1061
109 Ga0157372_10120790 3300013307 Bacteria 3009
110 Ga0157372_10477512 3300013307 Bacteria 1453
111 Ga0157372_10992504 3300013307 Bacteria 973
112 Ga0157372_11143795 3300013307 Unclassified 900
113 Ga0157375_10331304 3300013308 Bacteria 1687
114 Ga0157375_10741587 3300013308 Unclassified 1134
115 Ga0157375_10772975 3300013308 Unclassified 1110
116 Ga0163163_10118410 3300014325 Unclassified 2681
117 Ga0157380_10097999 3300014326 Bacteria 2435
118 Ga0157379_10185208 3300014968 Bacteria 1881
119 Ga0163161_10001229 3300017792 Bacteria 19210
120 Ga0163161_10378718 3300017792 Bacteria 1131
121 Ga0207697_10164257 3300025315 Bacteria 969
122 Ga0207710_10128906 3300025900 Bacteria 1214
123 Ga0207680_10326330 3300025903 Bacteria 1074
124 Ga0207654_10067753 3300025911 Bacteria 2110
125 Ga0207707_10008610 3300025912 Bacteria 8848
126 Ga0207695_10422703 3300025913 Unclassified 1217
127 Ga0207660_10181261 3300025917 Bacteria 1636
128 Ga0207649_10009414 3300025920 Bacteria 5344
129 Ga0207649_10483487 3300025920 Bacteria 939
130 Ga0207652_10186068 3300025921 Bacteria 1867
131 Ga0207650_10010742 3300025925 Bacteria 6285
132 Ga0207650_10873949 3300025925 Bacteria 763
133 Ga0207644_10210476 3300025931 Unclassified 1537
134 Ga0207644_10442520 3300025931 Bacteria 1067
135 Ga0207706_10041568 3300025933 Bacteria 4075
136 Ga0207706_10221762 3300025933 Unclassified 1655
137 Ga0207670_10066313 3300025936 Bacteria 2480
138 Ga0207670_10262168 3300025936 Unclassified 1340
139 Ga0207691_10363799 3300025940 Unclassified 1236
140 Ga0207711_11247310 3300025941 Unclassified 685
141 Ga0207679_10525819 3300025945 Bacteria 1058
142 Ga0207667_10148892 3300025949 Bacteria 2409
143 Ga0207667_10558762 3300025949 Bacteria 1157
144 Ga0207667_11607260 3300025949 Unclassified 619
145 Ga0207712_10139282 3300025961 Bacteria 1860
146 Ga0207668_10163331 3300025972 Bacteria 1738
147 Ga0207668_10449835 3300025972 Bacteria 1099
148 Ga0207640_10036452 3300025981 Bacteria 3088
149 Ga0207640_10395377 3300025981 Unclassified 1124
150 Ga0207640_11266880 3300025981 Bacteria 657
151 Ga0207658_10262513 3300025986 Bacteria 1472
152 Ga0207658_10554811 3300025986 Bacteria 1028
153 Ga0207703_10113618 3300026035 Bacteria 2315
154 Ga0207639_10015424 3300026041 Bacteria 5392
155 Ga0207639_10016469 3300026041 Bacteria 5232
156 Ga0207639_10297048 3300026041 Bacteria 1426
157 Ga0207678_10361427 3300026067 Bacteria 1253
158 Ga0207678_10413171 3300026067 Bacteria 1169
159 Ga0207641_10261915 3300026088 Bacteria 1619
160 Ga0207676_10144275 3300026095 Unclassified 2042
161 Ga0207674_10061491 3300026116 Bacteria 3795
162 Ga0207674_10127858 3300026116 Unclassified 2505
163 Ga0207674_10730070 3300026116 Bacteria 956
164 Ga0207675_100254895 3300026118 Bacteria 1699
165 Ga0207698_10058526 3300026142 Bacteria 2987
166 Ga0207698_10393342 3300026142 Bacteria 1322
167 Ga0207698_11207921 3300026142 Unclassified 770
168 Ga0209974_10195647 3300027876 Unclassified 745
169 Ga0268265_10073813 3300028380 Bacteria 2666
170 Ga0268265_10131020 3300028380 Unclassified 2084
171 Ga0307408_100003013 3300031548 Bacteria 11642
172 Ga0307408_100012957 3300031548 Bacteria 5528
173 Ga0307408_100310987 3300031548 Unclassified 1324
174 Ga0307408_100467795 3300031548 Unclassified 1097
175 Ga0307408_100494928 3300031548 Bacteria 1069
176 Ga0307408_100803758 3300031548 Unclassified 854
177 Ga0307408_101431309 3300031548 Bacteria 652
178 Ga0307405_10002044 3300031731 Bacteria 8761
179 Ga0307405_10094681 3300031731 Bacteria 1987
180 Ga0307405_10105762 3300031731 Bacteria 1896
181 Ga0307413_10001585 3300031824 Bacteria 8770
182 Ga0307413_10069463 3300031824 Bacteria 2211
183 Ga0307413_10141366 3300031824 Unclassified 1664
184 Ga0307413_10153576 3300031824 Bacteria 1607
185 Ga0307413_10402147 3300031824 Viruses 1073
186 Ga0307410_10000275 3300031852 Bacteria 19831
187 Ga0307410_10010071 3300031852 Bacteria 5338
188 Ga0307410_10015656 3300031852 Unclassified 4504
189 Ga0307410_10023125 3300031852 Bacteria 3857
190 Ga0307410_10125283 3300031852 Unclassified 1880
191 Ga0307410_10370171 3300031852 Bacteria 1150
192 Ga0307410_11176246 3300031852 Unclassified 667
193 Ga0307406_10007921 3300031901 Bacteria 5915
194 Ga0307406_10033293 3300031901 Bacteria 3154
195 Ga0307406_10038779 3300031901 Bacteria 2951
196 Ga0307406_10132702 3300031901 Unclassified 1751
197 Ga0307406_10246763 3300031901 Bacteria 1342
198 Ga0307406_10450281 3300031901 Unclassified 1033
199 Ga0307406_10750962 3300031901 Bacteria 819
200 Ga0307407_10001701 3300031903 Bacteria 8179
201 Ga0307407_10010450 3300031903 Bacteria 4378
202 Ga0307407_10055578 3300031903 Bacteria 2288
203 Ga0307407_10109677 3300031903 Bacteria 1730
204 Ga0307407_10149930 3300031903 Bacteria 1514
205 Ga0307407_10186441 3300031903 Unclassified 1379
206 Ga0307407_10463916 3300031903 Bacteria 922
207 Ga0307412_10003238 3300031911 Bacteria 9057
208 Ga0307412_10027021 3300031911 Bacteria 3574
209 Ga0307412_10041766 3300031911 Bacteria 2975
210 Ga0307409_100001443 3300031995 Bacteria 11674
211 Ga0307409_100003222 3300031995 Bacteria 8789
212 Ga0307409_100005014 3300031995 Bacteria 7542
213 Ga0307409_100012822 3300031995 Bacteria 5361
214 Ga0307409_100216640 3300031995 Unclassified 1725
215 Ga0307409_100277041 3300031995 Bacteria 1548
216 Ga0307409_100581356 3300031995 Bacteria 1104
217 Ga0307409_100585903 3300031995 Bacteria 1100
218 Ga0307416_100002398 3300032002 Bacteria 10741
219 Ga0307416_100003215 3300032002 Bacteria 9573
220 Ga0307416_100003415 3300032002 Bacteria 9322
221 Ga0307416_100083078 3300032002 Bacteria 2716
222 Ga0307416_100142924 3300032002 Bacteria 2179
223 Ga0307416_100153203 3300032002 Bacteria 2118
224 Ga0307416_100438067 3300032002 Unclassified 1356
225 Ga0307416_102179577 3300032002 Bacteria 655
226 Ga0307414_10008611 3300032004 Bacteria 5800
227 Ga0307414_10018302 3300032004 Bacteria 4309
228 Ga0307414_10283000 3300032004 Bacteria 1394
229 Ga0307411_10002708 3300032005 Bacteria 7944
230 Ga0307411_10019742 3300032005 Bacteria 3901
231 Ga0307411_10047081 3300032005 Bacteria 2786
232 Ga0307411_10053219 3300032005 Bacteria 2650
233 Ga0307411_10057687 3300032005 Unclassified 2566
234 Ga0307411_10069800 3300032005 Unclassified 2375
235 Ga0307411_10205883 3300032005 Bacteria 1515
236 Ga0307415_100003763 3300032126 Bacteria 7777
237 Ga0307415_100014014 3300032126 Bacteria 4697
238 Ga0307415_100044826 3300032126 Bacteria 2960
239 Ga0307415_100052404 3300032126 Bacteria 2775
240 Ga0307415_100085802 3300032126 Unclassified 2263
241 Ga0307415_100172351 3300032126 Bacteria 1689
242 Ga0307415_100180055 3300032126 Bacteria 1657
243 Ga0307415_100215633 3300032126 Bacteria 1535
244 Ga0307415_100244877 3300032126 Bacteria 1453
245 Ga0307415_100344664 3300032126 Unclassified 1252
246 Ga0307415_100462797 3300032126 Bacteria 1099
247 Ga0373937_0295478 3300036401 Unclassified 1531
248 Ga0395905_0231872 3300037471 Bacteria 1726
249 Ga0436365_1143095 3300039437 Unclassified 1338
250 Ga0439466_0033173 3300041411 Bacteria 1756
251 Ga0439432_026006 3300042006 Unclassified 1917
252 Ga0495629_0699420 3300046459 Unclassified 673
253 Ga0495598_0007819 3300046537 Bacteria 2468
254 Ga0495668_0052931 3300046616 Bacteria 2245
255 Ga0496101_0548320 3300048904 Bacteria 914
256 Ga0496105_0173148 3300048908 Bacteria 1769
257 Ga0496109_0063948 3300048912 Bacteria 3366
258 Ga0496112_0364543 3300048915 Unclassified 1387
259 Ga0496114_0316220 3300048917 Bacteria 1379
260 Ga0501291_047785 3300049514 Bacteria 771
261 Ga0501072_0001556 3300049588 Bacteria 17124
262 Ga0501074_0708837 3300049590 Unclassified 710
263 Ga0501207_014756 3300049654 Bacteria 1196
264 Ga0501209_007153 3300049656 Bacteria 2124
265 Ga0501210_003336 3300049657 Unclassified 1053
266 Ga0501216_000933 3300049660 Unclassified 3721
267 Ga0501223_020648 3300049663 Unclassified 1289
268 Ga0501227_014915 3300049665 Bacteria 1731
269 Ga0501233_021381 3300049668 Bacteria 1388
270 Ga0501239_000150 3300049672 Unclassified 4848
271 Ga0501240_027224 3300049673 Unclassified 897
272 Ga0501247_000183 3300049677 Unclassified 4000
273 Ga0501249_000942 3300049679 Bacteria 6381
274 Ga0501251_009511 3300049681 Bacteria 1122
275 Ga0501261_022948 3300049690 Unclassified 906
276 Ga0501261_072753 3300049690 Unclassified 606
277 Ga0501221_010847 3300049704 Bacteria 1627
278 Ga0501221_057850 3300049704 Bacteria 889
279 Ga0501225_0002489 3300049705 Bacteria 5699
280 Ga0501225_0033691 3300049705 Unclassified 1410
281 Ga0501241_039007 3300049758 Unclassified 916
282 Ga0501241_120225 3300049758 Unclassified 583
283 Ga0501263_020378 3300049760 Unclassified 889
284 Ga0501268_000086 3300049765 Bacteria 7472
285 Ga0501270_004654 3300049767 Bacteria 1551
286 Ga0501272_006714 3300049769 Bacteria 1234
287 Ga0501273_000372 3300049770 Bacteria 3575
288 nmdc:mga08y16_238701_c1 3300050511 Bacteria 1879
289 Ga0501082_0284042 3300060353 Bacteria 1441
290 Ga0157375_10007418
291 LJQas_1000057
292 Ga0065704_10096367
293 Ga0065715_10545555
294 Ga0070690_100060565
295 Ga0070670_100078916
296 Ga0070666_10021072
297 Ga0070680_100518184
298 Ga0070689_100051825
299 Ga0070689_100096533
300 Ga0070689_100578626
301 Ga0070661_100757774
302 Ga0070668_100327559
303 Ga0070675_101003732
304 Ga0070671_100040582
305 Ga0070671_100100884
306 Ga0070671_100137344
307 Ga0070673_100290015
308 Ga0070688_100021286
309 Ga0070659_100105827
310 Ga0070667_100037835
311 Ga0070701_10469267
312 Ga0070663_100179974
313 Ga0070663_100189929
314 Ga0070678_100172678
315 Ga0070662_100030311
316 Ga0070662_100191890
317 Ga0070681_10021183
318 Ga0070681_10046084
319 Ga0068867_100363067
320 Ga0070685_10325403
321 Ga0070679_100033542
322 Ga0068853_100004821
323 Ga0068853_100007824
324 Ga0068853_100305965
325 Ga0070695_100065018
326 Ga0070704_100003678
327 Ga0068855_100085997
328 Ga0068855_100249940
329 Ga0070664_100001584
330 Ga0070664_100011374
331 Ga0070664_100050686
332 Ga0070664_100182048
333 Ga0070664_100363584
334 Ga0068857_100078662
335 Ga0068857_100521273
336 Ga0068854_100011365
337 Ga0068854_100052424
338 Ga0068852_100070653
339 Ga0068852_100255938
340 Ga0068859_100007031
341 Ga0068859_100075738
342 Ga0068859_100345004
343 Ga0068864_100088766
344 Ga0068864_100131636
345 Ga0068864_100517853
346 Ga0068861_100365390
347 Ga0068851_10043459
348 Ga0068851_10129787
349 Ga0068870_10187010
350 Ga0068870_10490808
351 Ga0068863_100285840
352 Ga0068863_100548379
353 Ga0068858_100095107
354 Ga0068858_100322580
355 Ga0068860_100069659
356 Ga0068862_100315318
357 Ga0068862_100331731
358 Ga0097621_100069977
359 Ga0097621_100730502
360 Ga0097621_101286583
361 Ga0068871_100210042
362 Ga0075428_100907897
363 Ga0097620_100007031
364 Ga0097620_100075740
365 Ga0097620_100344988
366 Ga0105240_10196583
367 Ga0105240_10904117
368 Ga0111539_10246221
369 Ga0105245_10344114
370 Ga0105245_11047117
371 Ga0105245_11187793
372 Ga0105243_10154303
373 Ga0105241_10014080
374 Ga0105241_10279194
375 Ga0105241_10964268
376 Ga0105242_10006254
377 Ga0105248_11215382
378 Ga0105237_10561757
379 Ga0105238_10198538
380 Ga0105249_10030153
381 Ga0105249_10060599
382 Ga0105249_10085933
383 Ga0105249_10911590
384 Ga0105239_10283329
385 Ga0105239_11327208
386 Ga0157373_10345014
387 Ga0157371_10542808
388 Ga0157371_11092443
389 Ga0157370_10101862
390 Ga0157369_10028193
391 Ga0157369_10094406
392 Ga0157369_11001840
393 Ga0157378_10119723
394 Ga0163162_10198051
395 Ga0163162_10293882
396 Ga0163162_10557176
397 Ga0163162_10798844
398 Ga0157372_10120790
399 Ga0157372_10477512
400 Ga0157372_10992504
401 Ga0157372_11143795
402 Ga0157375_10331304
403 Ga0157375_10741587
404 Ga0157375_10772975
405 Ga0163163_10118410
406 Ga0157380_10097999
407 Ga0157379_10185208
408 Ga0163161_10001229
409 Ga0163161_10378718
410 Ga0207697_10164257
411 Ga0207710_10128906
412 Ga0207680_10326330
413 Ga0207654_10067753
414 Ga0207707_10008610
415 Ga0207695_10422703
416 Ga0207660_10181261
417 Ga0207649_10009414
418 Ga0207649_10483487
419 Ga0207652_10186068
420 Ga0207650_10010742
421 Ga0207650_10873949
422 Ga0207644_10210476
423 Ga0207644_10442520
424 Ga0207706_10041568
425 Ga0207706_10221762
426 Ga0207670_10066313
427 Ga0207670_10262168
428 Ga0207691_10363799
429 Ga0207711_11247310
430 Ga0207679_10525819
431 Ga0207667_10148892
432 Ga0207667_10558762
433 Ga0207667_11607260
434 Ga0207712_10139282
435 Ga0207668_10163331
436 Ga0207668_10449835
437 Ga0207640_10036452
438 Ga0207640_10395377
439 Ga0207640_11266880
440 Ga0207658_10262513
441 Ga0207658_10554811
442 Ga0207703_10113618
443 Ga0207639_10015424
444 Ga0207639_10016469
445 Ga0207639_10297048
446 Ga0207678_10361427
447 Ga0207678_10413171
448 Ga0207641_10261915
449 Ga0207676_10144275
450 Ga0207674_10061491
451 Ga0207674_10127858
452 Ga0207674_10730070
453 Ga0207675_100254895
454 Ga0207698_10058526
455 Ga0207698_10393342
456 Ga0207698_11207921
457 Ga0209974_10195647
458 Ga0268265_10073813
459 Ga0268265_10131020
460 Ga0307408_100003013
461 Ga0307408_100012957
462 Ga0307408_100310987
463 Ga0307408_100467795
464 Ga0307408_100494928
465 Ga0307408_100803758
466 Ga0307408_101431309
467 Ga0307405_10002044
468 Ga0307405_10094681
469 Ga0307405_10105762
470 Ga0307413_10001585
471 Ga0307413_10069463
472 Ga0307413_10141366
473 Ga0307413_10153576
474 Ga0307413_10402147
475 Ga0307410_10000275
476 Ga0307410_10010071
477 Ga0307410_10015656
478 Ga0307410_10023125
479 Ga0307410_10125283
480 Ga0307410_10370171
481 Ga0307410_11176246
482 Ga0307406_10007921
483 Ga0307406_10033293
484 Ga0307406_10038779
485 Ga0307406_10132702
486 Ga0307406_10246763
487 Ga0307406_10450281
488 Ga0307406_10750962
489 Ga0307407_10001701
490 Ga0307407_10010450
491 Ga0307407_10055578
492 Ga0307407_10109677
493 Ga0307407_10149930
494 Ga0307407_10186441
495 Ga0307407_10463916
496 Ga0307412_10003238
497 Ga0307412_10027021
498 Ga0307412_10041766
499 Ga0307409_100001443
500 Ga0307409_100003222
501 Ga0307409_100005014
502 Ga0307409_100012822
503 Ga0307409_100216640
504 Ga0307409_100277041
505 Ga0307409_100581356
506 Ga0307409_100585903
507 Ga0307416_100002398
508 Ga0307416_100003215
509 Ga0307416_100003415
510 Ga0307416_100083078
511 Ga0307416_100142924
512 Ga0307416_100153203
513 Ga0307416_100438067
514 Ga0307416_102179577
515 Ga0307414_10008611
516 Ga0307414_10018302
517 Ga0307414_10283000
518 Ga0307411_10002708
519 Ga0307411_10019742
520 Ga0307411_10047081
521 Ga0307411_10053219
522 Ga0307411_10057687
523 Ga0307411_10069800
524 Ga0307411_10205883
525 Ga0307415_100003763
526 Ga0307415_100014014
527 Ga0307415_100044826
528 Ga0307415_100052404
529 Ga0307415_100085802
530 Ga0307415_100172351
531 Ga0307415_100180055
532 Ga0307415_100215633
533 Ga0307415_100244877
534 Ga0307415_100344664
535 Ga0307415_100462797
536 Ga0373937_0295478
537 Ga0395905_0231872
538 Ga0436365_1143095
539 Ga0439466_0033173
540 Ga0439432_026006
541 Ga0495629_0699420
542 Ga0495598_0007819
543 Ga0495668_0052931
544 Ga0496101_0548320
545 Ga0496105_0173148
546 Ga0496109_0063948
547 Ga0496112_0364543
548 Ga0496114_0316220
549 Ga0501291_047785
550 Ga0501072_0001556
551 Ga0501074_0708837
552 Ga0501207_014756
553 Ga0501209_007153
554 Ga0501210_003336
555 Ga0501216_000933
556 Ga0501223_020648
557 Ga0501227_014915
558 Ga0501233_021381
559 Ga0501239_000150
560 Ga0501240_027224
561 Ga0501247_000183
562 Ga0501249_000942
563 Ga0501251_009511
564 Ga0501261_022948
565 Ga0501261_072753
566 Ga0501221_010847
567 Ga0501221_057850
568 Ga0501225_0002489
569 Ga0501225_0033691
570 Ga0501241_039007
571 Ga0501241_120225
572 Ga0501263_020378
573 Ga0501268_000086
574 Ga0501270_004654
575 Ga0501272_006714
576 Ga0501273_000372
577 nmdc:mga08y16_238701_c1
578 Ga0501082_0284042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

86

162

0.89

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

31

155

0.83

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

40

175

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

152

0.79

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

71

154

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.9402 31 177
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9267 133 177
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9239 30 177
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.9213 30 177
7rb3-assembly1.cif.gz_A cryo-em structure of human binary natc complex with a bisubstrate inhibitor 0.9167 30 177
ID Description Score Start End Superfamily
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9891 115 177 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9814 96 158 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.956 132 177 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9452 99 177 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9439 82 138 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A534M2Y8-F1-model_v4 GNAT family N-acetyltransferase 0.9896 85 177 GO:0016747
AF-A0A7C2G8G0-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9858 29 177 GO:0008080
AF-A0A2V9ZSA8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9839 85 176 GO:0016747
AF-A0A2V8Q7Z0-F1-model_v4 N-acetyltransferase domain-containing protein 0.983 30 177 GO:0016747
AF-A0A7T9GLV4-F1-model_v4 deleted 0.9829 29 177

Map