F389150

General Info

Members Datasets Scaffolds Average Seq Length
289 211 578 130

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_12652923|Ga0105245_126529231
Length 148
Sequence VLNALEVVTVVIVGLMVGVEFSVAFIMNRILDALPEDSGQLGHAHGGRMLGALMPFWYIGSLVLAAVWAVAGWHHDGTGLVVTAAGLLILSVVMSLLLLVPINNQGKTWTPENRPEDWKEQMNRWDRWHYVRVAVIVAAFTLLVTALV

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
31 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
44 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
45 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
46 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
51 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
52 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
53 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
75 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
160 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
161 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
162 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
163 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
164 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
165 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
170 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
171 2643221647 Streptomyces sp. Root369 Isolate Unclassified
172 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
173 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
174 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
175 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
176 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
177 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
178 2808606448 Streptomyces sp. 193411 Isolate Unclassified
179 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
180 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
181 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
182 2862574272 Streptomyces sp. AcE210 Isolate Nodule
183 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
184 2867428634 Streptomyces sp. RP5T Isolate Unclassified
185 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
186 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
187 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
188 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
189 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
190 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
191 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
192 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
193 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
194 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
195 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
196 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
197 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
198 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
199 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
200 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
201 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
202 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
203 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
204 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
205 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
206 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
207 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
208 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
209 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
210 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
211 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.43
Metatranscriptomes 0.35
Isolates 15.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.23
Nodule 0.69
Rhizoplane 4.84
Rhizosphere 71.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_12652923 3300009098 Bacteria 554
2 rootH1_10022877 3300003323 Bacteria 17623
3 Ga0070668_100052790 3300005347 Bacteria 3134
4 Ga0070714_101090977 3300005435 Bacteria 778
5 Ga0070714_101751287 3300005435 Bacteria 607
6 Ga0070706_101360650 3300005467 Bacteria 650
7 Ga0068853_100527574 3300005539 Bacteria 1117
8 Ga0070665_101497797 3300005548 Bacteria 683
9 Ga0068863_100016982 3300005841 Bacteria 6980
10 Ga0068863_100276001 3300005841 Bacteria 1628
11 Ga0081455_10180335 3300005937 Bacteria 1599
12 Ga0075368_10008090 3300006042 Bacteria 3733
13 Ga0075363_100850247 3300006048 Bacteria 557
14 Ga0075367_10000509 3300006178 Bacteria 14668
15 Ga0105250_10049942 3300009092 Bacteria 1678
16 Ga0105247_10144596 3300009101 Bacteria 1561
17 Ga0105243_11496096 3300009148 Bacteria 699
18 Ga0105237_10493195 3300009545 Bacteria 1231
19 Ga0157369_10915357 3300013105 Bacteria 899
20 Ga0157375_10975865 3300013308 Bacteria 988
21 Ga0163163_12386838 3300014325 Bacteria 587
22 Ga0157379_10085602 3300014968 Bacteria 2825
23 Ga0206353_10037882 3300020082 Bacteria 3964
24 Ga0209758_1161553 3300025297 Bacteria 556
25 Ga0207426_1017453 3300025302 Bacteria 2551
26 Ga0207684_10411467 3300025910 Bacteria 1162
27 Ga0207671_10640221 3300025914 Bacteria 847
28 Ga0207667_10167533 3300025949 Bacteria 2258
29 Ga0207668_10053452 3300025972 Bacteria 2799
30 Ga0207639_10101211 3300026041 Bacteria 2329
31 Ga0207641_10003908 3300026088 Bacteria 13035
32 Ga0209813_10009973 3300027866 Bacteria 2445
33 Ga0268266_11453937 3300028379 Bacteria 661
34 Ga0307517_10117747 3300028786 Bacteria 1981
35 Ga0307515_10000933 3300028794 Bacteria 67151
36 Ga0307515_10053092 3300028794 Bacteria 5990
37 Ga0307511_10000161 3300030521 Bacteria 65039
38 Ga0307512_10002705 3300030522 Bacteria 21780
39 Ga0307512_10036026 3300030522 Bacteria 4204
40 Ga0307512_10365395 3300030522 Bacteria 627
41 Ga0307513_10053557 3300031456 Bacteria 4335
42 Ga0307509_10183835 3300031507 Bacteria 1951
43 Ga0307509_10445401 3300031507 Bacteria 990
44 Ga0307508_10070950 3300031616 Bacteria 3057
45 Ga0307508_10119375 3300031616 Bacteria 2239
46 Ga0307516_10007395 3300031730 Bacteria 12639
47 Ga0307518_10070681 3300031838 Bacteria 2528
48 Ga0307507_10006857 3300033179 Bacteria 17009
49 Ga0307507_10043774 3300033179 Bacteria 4437
50 Ga0307507_10142379 3300033179 Bacteria 1833
51 Ga0307510_10051488 3300033180 Bacteria 4354
52 Ga0439436_0004237 3300041404 Bacteria 4396
53 Ga0439439_0020731 3300041406 Bacteria 1635
54 Ga0451797_0582136 3300041453 Bacteria 763
55 Ga0451849_0354072 3300041505 Bacteria 1165
56 Ga0451853_0321639 3300041512 Bacteria 535
57 Ga0451853_1084021 3300041512 Bacteria 2575
58 Ga0439433_0036977 3300041999 Bacteria 1129
59 Ga0439449_0017424 3300042007 Bacteria 2697
60 Ga0439449_0029878 3300042007 Bacteria 2030
61 Ga0439455_0019797 3300042012 Bacteria 1590
62 Ga0439457_008459 3300042014 Bacteria 2426
63 Ga0450903_007468 3300042138 Bacteria 1798
64 Ga0439458_0006943 3300042157 Bacteria 2525
65 Ga0466969_0010431 3300044656 Bacteria 4925
66 Ga0466972_0006220 3300044658 Bacteria 5999
67 Ga0466972_0068979 3300044658 Bacteria 1689
68 Ga0466965_0008388 3300044683 Bacteria 4780
69 Ga0466966_0005289 3300044684 Bacteria 8487
70 Ga0466966_0013796 3300044684 Bacteria 5346
71 Ga0466966_0114266 3300044684 Bacteria 1662
72 Ga0466961_0004994 3300044693 Bacteria 8338
73 Ga0466961_0010532 3300044693 Bacteria 5896
74 Ga0466961_0304341 3300044693 Bacteria 973
75 Ga0466963_0013042 3300044694 Bacteria 5095
76 Ga0466964_0149117 3300044706 Bacteria 1082
77 Ga0466971_0001696 3300044719 Bacteria 9338
78 Ga0466971_0002958 3300044719 Bacteria 7213
79 Ga0466971_0475724 3300044719 Bacteria 615
80 Ga0466970_0056118 3300044765 Bacteria 2104
81 Ga0466957_0000429 3300044842 Bacteria 20707
82 Ga0466960_0632012 3300044901 Bacteria 638
83 Ga0466959_0005923 3300045049 Bacteria 8421
84 Ga0466959_0059933 3300045049 Bacteria 2770
85 Ga0466959_0111062 3300045049 Bacteria 1956
86 Ga0466958_0030721 3300045836 Bacteria 3192
87 Ga0466958_0210811 3300045836 Bacteria 1237
88 Ga0466967_0007468 3300045976 Bacteria 7887
89 Ga0466967_0974588 3300045976 Bacteria 844
90 Ga0495592_0006486 3300046454 Bacteria 8710
91 Ga0495603_0003718 3300046455 Bacteria 9080
92 Ga0495603_0004433 3300046455 Bacteria 8369
93 Ga0495603_0035770 3300046455 Bacteria 2981
94 Ga0495603_0052217 3300046455 Bacteria 2427
95 Ga0495603_0122139 3300046455 Bacteria 1517
96 Ga0495603_0148597 3300046455 Bacteria 1361
97 Ga0495629_0001944 3300046459 Bacteria 16104
98 Ga0495629_0002043 3300046459 Bacteria 15679
99 Ga0495629_0004656 3300046459 Bacteria 10269
100 Ga0495629_0031329 3300046459 Bacteria 3766
101 Ga0495629_0057519 3300046459 Bacteria 2719
102 Ga0495638_0166052 3300046460 Bacteria 1270
103 Ga0495651_0002900 3300046462 Bacteria 13279
104 Ga0495651_0012502 3300046462 Bacteria 6547
105 Ga0495651_0132537 3300046462 Bacteria 1818
106 Ga0495653_0048551 3300046463 Bacteria 3275
107 Ga0495653_0476658 3300046463 Bacteria 781
108 Ga0495580_0032352 3300046472 Bacteria 3775
109 Ga0495605_0012773 3300046474 Bacteria 4649
110 Ga0495662_0001291 3300046476 Bacteria 12398
111 Ga0495662_0003400 3300046476 Bacteria 8066
112 Ga0495662_0008493 3300046476 Bacteria 5052
113 Ga0495664_0026469 3300046477 Bacteria 3377
114 Ga0495585_0035158 3300046492 Bacteria 2833
115 Ga0495585_0052222 3300046492 Bacteria 2263
116 Ga0495585_0128686 3300046492 Bacteria 1334
117 Ga0495594_0002631 3300046499 Bacteria 9331
118 Ga0495594_0110632 3300046499 Bacteria 1549
119 Ga0495594_0801888 3300046499 Bacteria 531
120 Ga0495594_0883920 3300046499 Bacteria 502
121 Ga0495583_0088952 3300046506 Bacteria 1332
122 Ga0495608_0004832 3300046511 Bacteria 9631
123 Ga0495616_0043801 3300046513 Bacteria 2272
124 Ga0495618_0036729 3300046514 Bacteria 3075
125 Ga0495618_0757164 3300046514 Bacteria 568
126 Ga0495628_0021988 3300046516 Bacteria 5241
127 Ga0495628_0038924 3300046516 Bacteria 3804
128 Ga0495630_0009162 3300046517 Bacteria 7119
129 Ga0495632_0262558 3300046519 Bacteria 772
130 Ga0495644_0261112 3300046523 Bacteria 674
131 Ga0495666_0003304 3300046526 Bacteria 8145
132 Ga0495652_0007579 3300046529 Bacteria 10005
133 Ga0495652_0126592 3300046529 Bacteria 2028
134 Ga0495665_0001982 3300046531 Bacteria 11064
135 Ga0495640_0019104 3300046533 Bacteria 5064
136 Ga0495586_0001638 3300046535 Bacteria 12278
137 Ga0495587_0136940 3300046536 Bacteria 1398
138 Ga0495597_0119738 3300046542 Bacteria 1098
139 Ga0495645_0049926 3300046543 Bacteria 3046
140 Ga0495622_0001123 3300046557 Bacteria 13977
141 Ga0495622_0386917 3300046557 Bacteria 603
142 Ga0495622_0398143 3300046557 Bacteria 593
143 Ga0495667_0022816 3300046559 Bacteria 4215
144 Ga0495668_0045997 3300046616 Bacteria 2425
145 Ga0495668_0122439 3300046616 Bacteria 1423
146 Ga0495668_0502956 3300046616 Bacteria 668
147 Ga0495634_0118776 3300046642 Bacteria 1694
148 Ga0495634_0302656 3300046642 Bacteria 966
149 Ga0495611_0245064 3300046648 Bacteria 831
150 Ga0495625_0017090 3300046660 Bacteria 5685
151 Ga0495625_0109706 3300046660 Bacteria 1887
152 Ga0495625_0553624 3300046660 Bacteria 696
153 Ga0495635_0137532 3300046663 Bacteria 1664
154 Ga0495661_0307862 3300046665 Bacteria 791
155 Ga0495657_0010980 3300046675 Bacteria 6792
156 Ga0495657_0022884 3300046675 Bacteria 4471
157 Ga0495657_0058250 3300046675 Bacteria 2566
158 Ga0495599_0088375 3300046678 Bacteria 1934
159 Ga0495623_0010150 3300046679 Bacteria 6094
160 Ga0495623_0025775 3300046679 Bacteria 3786
161 Ga0495646_0100772 3300046680 Bacteria 1656
162 Ga0495658_0500729 3300046683 Bacteria 777
163 Ga0495613_0014975 3300046689 Bacteria 5755
164 Ga0495613_0023374 3300046689 Bacteria 4605
165 Ga0495613_0029648 3300046689 Bacteria 4067
166 Ga0495613_0240678 3300046689 Bacteria 1265
167 Ga0495671_0044632 3300046692 Bacteria 2221
168 Ga0495649_0178953 3300046694 Bacteria 1107
169 Ga0495589_0015322 3300046794 Bacteria 3947
170 Ga0495589_0040480 3300046794 Bacteria 2327
171 Ga0495589_0218356 3300046794 Bacteria 896
172 Ga0495600_0023776 3300046809 Bacteria 3942
173 Ga0495660_0103696 3300046810 Bacteria 1461
174 Ga0495660_0430716 3300046810 Bacteria 573
175 Ga0495581_0004665 3300047315 Bacteria 7917
176 Ga0495581_0077528 3300047315 Bacteria 1923
177 Ga0495604_0000132 3300047317 Bacteria 63177
178 Ga0495604_0027105 3300047317 Bacteria 4559
179 Ga0495604_0051408 3300047317 Bacteria 3195
180 Ga0495636_0608572 3300047318 Bacteria 534
181 Ga0495674_0168367 3300047319 Bacteria 1829
182 Ga0495676_0006195 3300047321 Bacteria 10999
183 Ga0495676_0063644 3300047321 Bacteria 2873
184 Ga0495676_0785389 3300047321 Bacteria 613
185 Ga0495683_0091387 3300047323 Bacteria 1474
186 Ga0495687_007553 3300047443 Bacteria 6381
187 Ga0495687_017060 3300047443 Bacteria 3635
188 Ga0495687_024069 3300047443 Bacteria 2900
189 Ga0495687_258116 3300047443 Bacteria 516
190 Ga0495675_0036399 3300047444 Bacteria 3139
191 Ga0495675_0347068 3300047444 Bacteria 873
192 Ga0495675_0761307 3300047444 Bacteria 538
193 Ga0495685_031597 3300047447 Bacteria 1819
194 Ga0495685_046230 3300047447 Bacteria 1481
195 Ga0495685_057581 3300047447 Bacteria 1312
196 Ga0495681_0022725 3300047470 Bacteria 3349
197 Ga0495684_0084422 3300047471 Bacteria 2408
198 Ga0495686_0187783 3300047472 Bacteria 1193
199 Ga0495686_0429737 3300047472 Bacteria 705
200 Ga0495593_0028475 3300047673 Bacteria 3068
201 Ga0495602_0244506 3300048088 Bacteria 1340
202 Ga0495614_0026708 3300048089 Bacteria 2488
203 Ga0495626_0169167 3300048091 Bacteria 912
204 Ga0496100_0184007 3300048903 Bacteria 1512
205 Ga0496101_0097334 3300048904 Bacteria 2197
206 Ga0496102_0000042 3300048905 Bacteria 196538
207 Ga0496103_0000441 3300048906 Bacteria 35759
208 Ga0496104_0152956 3300048907 Bacteria 2214
209 Ga0496105_0192011 3300048908 Bacteria 1669
210 Ga0496106_0572574 3300048909 Bacteria 906
211 Ga0496108_0045041 3300048911 Bacteria 3684
212 Ga0496108_0936910 3300048911 Bacteria 742
213 Ga0496109_0197201 3300048912 Bacteria 1893
214 Ga0496110_0139447 3300048913 Bacteria 2192
215 Ga0496114_0434876 3300048917 Bacteria 1162
216 Ga0496116_0000945 3300048919 Bacteria 35787
217 Ga0496117_0000339 3300048920 Bacteria 82597
218 Ga0496118_0000241 3300048921 Bacteria 96484
219 Ga0496119_0004018 3300048922 Bacteria 14865
220 Ga0496120_0007420 3300048923 Bacteria 8154
221 Ga0496121_0049766 3300048924 Bacteria 3548
222 Ga0496124_0177014 3300048927 Bacteria 1645
223 Ga0496126_0001023 3300048929 Bacteria 47541
224 Ga0501043_0060383 3300049579 Bacteria 2976
225 Ga0501047_0036181 3300049581 Bacteria 4770
226 Ga0501035_0811481 3300049822 Bacteria 747
227 Ga0501044_0022138 3300049823 Bacteria 6777
228 Ga0501044_0430746 3300049823 Bacteria 1228
229 nmdc:mga03n38_737429_c1 3300050490 Bacteria 570
230 nmdc:mga06z11_4282_c1 3300050494 Bacteria 5605
231 nmdc:mga04h51_98370_c1 3300050495 Bacteria 1063
232 Ga0495601_0001513 3300053077 Bacteria 12823
233 Ga0495601_0026446 3300053077 Bacteria 3583
234 Ga0495619_0045553 3300053085 Bacteria 2882
235 Ga0500660_036665 3300053100 Bacteria 2524
236 Ga0500560_181775 3300053107 Bacteria 687
237 Ga0500593_090677 3300053117 Bacteria 1294
238 Ga0500652_230690 3300053131 Bacteria 741
239 Ga0500573_0061884 3300053140 Bacteria 2144
240 Ga0500600_0392204 3300053149 Bacteria 554
241 Ga0500604_0083334 3300053151 Bacteria 1036
242 Ga0500616_0020204 3300053153 Bacteria 3743
243 Ga0500633_0054063 3300053160 Bacteria 1395
244 Ga0466962_0000287 3300061719 Bacteria 21361
245 Ga0466962_0002342 3300061719 Bacteria 8984
246 2585302765 2582581313 Bacteria 10042643
247 2585321507 2582581314 Bacteria 11452267
248 2644265153 2643221647 Bacteria 10741251
249 2644429658 2643221677 Bacteria 7584031
250 2644441325 2643221678 Bacteria 9540101
251 2785369326 2784746768 Bacteria 10036182
252 2786667223 2786546132 Bacteria 10419719
253 2793984672 2791355406 Bacteria 11364898
254 2809196391 2808606439 Bacteria 5952208
255 2809231080 2808606448 Bacteria 8656184
256 2809591369 2808606522 Bacteria 9488490
257 2819745186 2818991472 Bacteria 10089953
258 2862184350 2862178590 Bacteria 8583590
259 2862581239 2862574272 Bacteria 10567477
260 2863408942 2863404153 Bacteria 9672205
261 2867429395 2867428634 Bacteria 9590268
262 2867436003 2867428634 Bacteria 9590268
263 2877681225 2877676314 Bacteria 9512378
264 2891970942 2891968417 Bacteria 5821697
265 2912720861 2912715099 Bacteria 9460473
266 2918501291 2918501144 Bacteria 8668083
267 2954389594 2954380949 Bacteria 10050426
268 2954682311 2954673503 Bacteria 9685905
269 2954690613 2954682443 Bacteria 9862841
270 2954692009 2954691527 Bacteria 10720516
271 2954707076 2954701450 Bacteria 10834262
272 2954718768 2954711539 Bacteria 10867210
273 2954728738 2954721474 Bacteria 10456478
274 2954733072 2954731030 Bacteria 10243860
275 2954747636 2954740390 Bacteria 10229294
276 2954751953 2954749733 Bacteria 10366972
277 2954766752 2954759201 Bacteria 9358192
278 2966602701 2966598605 Bacteria 7676064
279 8023628611 8023623736 Bacteria 8593882
280 8025532131 8025530807 Bacteria 8495698
281 8047897934 8047893842 Bacteria 11723082
282 8048128688 8048127548 Bacteria 11053136
283 8048360960 8048356638 Bacteria 11044339
284 8048374897 8048369669 Bacteria 11666822
285 8048383325 8048379754 Bacteria 11877923
286 8054915733 8054913762 Bacteria 7713009
287 8056060571 8056060235 Bacteria 7259403
288 8056448579 8056447290 Bacteria 7680491
289 8056836448 8056829672 Bacteria 9045328
290 Ga0105245_12652923
291 rootH1_10022877
292 Ga0070668_100052790
293 Ga0070714_101090977
294 Ga0070714_101751287
295 Ga0070706_101360650
296 Ga0068853_100527574
297 Ga0070665_101497797
298 Ga0068863_100016982
299 Ga0068863_100276001
300 Ga0081455_10180335
301 Ga0075368_10008090
302 Ga0075363_100850247
303 Ga0075367_10000509
304 Ga0105250_10049942
305 Ga0105247_10144596
306 Ga0105243_11496096
307 Ga0105237_10493195
308 Ga0157369_10915357
309 Ga0157375_10975865
310 Ga0163163_12386838
311 Ga0157379_10085602
312 Ga0206353_10037882
313 Ga0209758_1161553
314 Ga0207426_1017453
315 Ga0207684_10411467
316 Ga0207671_10640221
317 Ga0207667_10167533
318 Ga0207668_10053452
319 Ga0207639_10101211
320 Ga0207641_10003908
321 Ga0209813_10009973
322 Ga0268266_11453937
323 Ga0307517_10117747
324 Ga0307515_10000933
325 Ga0307515_10053092
326 Ga0307511_10000161
327 Ga0307512_10002705
328 Ga0307512_10036026
329 Ga0307512_10365395
330 Ga0307513_10053557
331 Ga0307509_10183835
332 Ga0307509_10445401
333 Ga0307508_10070950
334 Ga0307508_10119375
335 Ga0307516_10007395
336 Ga0307518_10070681
337 Ga0307507_10006857
338 Ga0307507_10043774
339 Ga0307507_10142379
340 Ga0307510_10051488
341 Ga0439436_0004237
342 Ga0439439_0020731
343 Ga0451797_0582136
344 Ga0451849_0354072
345 Ga0451853_0321639
346 Ga0451853_1084021
347 Ga0439433_0036977
348 Ga0439449_0017424
349 Ga0439449_0029878
350 Ga0439455_0019797
351 Ga0439457_008459
352 Ga0450903_007468
353 Ga0439458_0006943
354 Ga0466969_0010431
355 Ga0466972_0006220
356 Ga0466972_0068979
357 Ga0466965_0008388
358 Ga0466966_0005289
359 Ga0466966_0013796
360 Ga0466966_0114266
361 Ga0466961_0004994
362 Ga0466961_0010532
363 Ga0466961_0304341
364 Ga0466963_0013042
365 Ga0466964_0149117
366 Ga0466971_0001696
367 Ga0466971_0002958
368 Ga0466971_0475724
369 Ga0466970_0056118
370 Ga0466957_0000429
371 Ga0466960_0632012
372 Ga0466959_0005923
373 Ga0466959_0059933
374 Ga0466959_0111062
375 Ga0466958_0030721
376 Ga0466958_0210811
377 Ga0466967_0007468
378 Ga0466967_0974588
379 Ga0495592_0006486
380 Ga0495603_0003718
381 Ga0495603_0004433
382 Ga0495603_0035770
383 Ga0495603_0052217
384 Ga0495603_0122139
385 Ga0495603_0148597
386 Ga0495629_0001944
387 Ga0495629_0002043
388 Ga0495629_0004656
389 Ga0495629_0031329
390 Ga0495629_0057519
391 Ga0495638_0166052
392 Ga0495651_0002900
393 Ga0495651_0012502
394 Ga0495651_0132537
395 Ga0495653_0048551
396 Ga0495653_0476658
397 Ga0495580_0032352
398 Ga0495605_0012773
399 Ga0495662_0001291
400 Ga0495662_0003400
401 Ga0495662_0008493
402 Ga0495664_0026469
403 Ga0495585_0035158
404 Ga0495585_0052222
405 Ga0495585_0128686
406 Ga0495594_0002631
407 Ga0495594_0110632
408 Ga0495594_0801888
409 Ga0495594_0883920
410 Ga0495583_0088952
411 Ga0495608_0004832
412 Ga0495616_0043801
413 Ga0495618_0036729
414 Ga0495618_0757164
415 Ga0495628_0021988
416 Ga0495628_0038924
417 Ga0495630_0009162
418 Ga0495632_0262558
419 Ga0495644_0261112
420 Ga0495666_0003304
421 Ga0495652_0007579
422 Ga0495652_0126592
423 Ga0495665_0001982
424 Ga0495640_0019104
425 Ga0495586_0001638
426 Ga0495587_0136940
427 Ga0495597_0119738
428 Ga0495645_0049926
429 Ga0495622_0001123
430 Ga0495622_0386917
431 Ga0495622_0398143
432 Ga0495667_0022816
433 Ga0495668_0045997
434 Ga0495668_0122439
435 Ga0495668_0502956
436 Ga0495634_0118776
437 Ga0495634_0302656
438 Ga0495611_0245064
439 Ga0495625_0017090
440 Ga0495625_0109706
441 Ga0495625_0553624
442 Ga0495635_0137532
443 Ga0495661_0307862
444 Ga0495657_0010980
445 Ga0495657_0022884
446 Ga0495657_0058250
447 Ga0495599_0088375
448 Ga0495623_0010150
449 Ga0495623_0025775
450 Ga0495646_0100772
451 Ga0495658_0500729
452 Ga0495613_0014975
453 Ga0495613_0023374
454 Ga0495613_0029648
455 Ga0495613_0240678
456 Ga0495671_0044632
457 Ga0495649_0178953
458 Ga0495589_0015322
459 Ga0495589_0040480
460 Ga0495589_0218356
461 Ga0495600_0023776
462 Ga0495660_0103696
463 Ga0495660_0430716
464 Ga0495581_0004665
465 Ga0495581_0077528
466 Ga0495604_0000132
467 Ga0495604_0027105
468 Ga0495604_0051408
469 Ga0495636_0608572
470 Ga0495674_0168367
471 Ga0495676_0006195
472 Ga0495676_0063644
473 Ga0495676_0785389
474 Ga0495683_0091387
475 Ga0495687_007553
476 Ga0495687_017060
477 Ga0495687_024069
478 Ga0495687_258116
479 Ga0495675_0036399
480 Ga0495675_0347068
481 Ga0495675_0761307
482 Ga0495685_031597
483 Ga0495685_046230
484 Ga0495685_057581
485 Ga0495681_0022725
486 Ga0495684_0084422
487 Ga0495686_0187783
488 Ga0495686_0429737
489 Ga0495593_0028475
490 Ga0495602_0244506
491 Ga0495614_0026708
492 Ga0495626_0169167
493 Ga0496100_0184007
494 Ga0496101_0097334
495 Ga0496102_0000042
496 Ga0496103_0000441
497 Ga0496104_0152956
498 Ga0496105_0192011
499 Ga0496106_0572574
500 Ga0496108_0045041
501 Ga0496108_0936910
502 Ga0496109_0197201
503 Ga0496110_0139447
504 Ga0496114_0434876
505 Ga0496116_0000945
506 Ga0496117_0000339
507 Ga0496118_0000241
508 Ga0496119_0004018
509 Ga0496120_0007420
510 Ga0496121_0049766
511 Ga0496124_0177014
512 Ga0496126_0001023
513 Ga0501043_0060383
514 Ga0501047_0036181
515 Ga0501035_0811481
516 Ga0501044_0022138
517 Ga0501044_0430746
518 nmdc:mga03n38_737429_c1
519 nmdc:mga06z11_4282_c1
520 nmdc:mga04h51_98370_c1
521 Ga0495601_0001513
522 Ga0495601_0026446
523 Ga0495619_0045553
524 Ga0500660_036665
525 Ga0500560_181775
526 Ga0500593_090677
527 Ga0500652_230690
528 Ga0500573_0061884
529 Ga0500600_0392204
530 Ga0500604_0083334
531 Ga0500616_0020204
532 Ga0500633_0054063
533 Ga0466962_0000287
534 Ga0466962_0002342
535 2585302765
536 2585321507
537 2644265153
538 2644429658
539 2644441325
540 2785369326
541 2786667223
542 2793984672
543 2809196391
544 2809231080
545 2809591369
546 2819745186
547 2862184350
548 2862581239
549 2863408942
550 2867429395
551 2867436003
552 2877681225
553 2891970942
554 2912720861
555 2918501291
556 2954389594
557 2954682311
558 2954690613
559 2954692009
560 2954707076
561 2954718768
562 2954728738
563 2954733072
564 2954747636
565 2954751953
566 2954766752
567 2966602701
568 8023628611
569 8025532131
570 8047897934
571 8048128688
572 8048360960
573 8048374897
574 8048383325
575 8054915733
576 8056060571
577 8056448579
578 8056836448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08592

Anthrone_oxy

Anthrone oxygenase

52

142

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l0c-assembly1.cif.gz_C-2 human metavinculin (residues 959-1134) in complex with pip2 0.7224 17 127
5l0g-assembly1.cif.gz_B human metavinculin mvt q971r, r975d, t978r mutant (residues 959-1134) in complex with pip2 0.6933 19 127
5l0g-assembly2.cif.gz_C human metavinculin mvt q971r, r975d, t978r mutant (residues 959-1134) in complex with pip2 0.6886 17 127
5l0c-assembly2.cif.gz_B human metavinculin (residues 959-1134) in complex with pip2 0.6806 17 127
6vqc-assembly1.cif.gz_f mammalian v-atpase from rat brain membrane-embedded vo region rotational state 1 (from focused refinement) 0.6799 58 128
ID Description Score Start End Superfamily
af_A0A1P8AP64_44_205_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.7872 24 123 1.20.140.40
af_B9DG91_27_154_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.7645 54 127 1.20.58.390
af_Q2V441_33_185_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.7563 18 125 1.20.140.40
af_Q9H160_25_121_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.7519 44 128 1.10.287.1060
af_Q9C0W5_1_160_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7449 3 127 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A5D4H8F2-F1-model_v4 DUF1772 domain-containing protein 0.9855 61 129 GO:0016020
AF-M2P304-F1-model_v4 Putative membrane protein 0.9809 63 129 GO:0016020
AF-A0A542JCN1-F1-model_v4 deleted 0.9781 15 127
AF-A0A367RXE7-F1-model_v4 DUF1772 domain-containing protein 0.9624 56 128 GO:0016020
AF-M2P304-F1-model_v4 Putative membrane protein 0.953 63 129 GO:0016020

Map