F389071

General Info

Members Datasets Scaffolds Average Seq Length
289 201 578 151

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100216163|Ga0068855_1002161632
Length 173
Sequence MSRRGDLVRRNNENSKDKNIMTTTNTNTVKLHRVLRSTPERIYRAFLDADAMAKWLPPNGFTGKVHHLDAKVGGGYKMSFTNFTTGKPHSFGGTYIELKPNERIRYSNKFDDANLPGEMQTTIILRQVFCGTEISITQEGIPSMIPAEACYLGWQESLILLGKLVEAEIPDQP

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
200 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
201 2739367700 Dyella sp. YR388 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 1.04
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 1.38
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100216163 3300005563 Bacteria 2151
2 JGI24736J21556_1023120 3300001904 Bacteria 972
3 JGI24737J22298_10018220 3300001990 Bacteria 2255
4 rootL2_10020249 3300003322 Bacteria 2090
5 Ga0055527_1005576 3300003760 Bacteria 1627
6 Ga0055529_1000015 3300003763 Bacteria 366950
7 Ga0058863_10143015 3300004799 Bacteria 674
8 Ga0065704_10001277 3300005289 Bacteria 9704
9 Ga0065715_10089908 3300005293 Bacteria 8159
10 Ga0065707_10001190 3300005295 Bacteria 10559
11 Ga0070658_11202204 3300005327 Bacteria 659
12 Ga0070683_100065421 3300005329 Bacteria 3385
13 Ga0070670_100961234 3300005331 Bacteria 776
14 Ga0070680_100263145 3300005336 Bacteria 1459
15 Ga0070680_100433654 3300005336 Bacteria 1122
16 Ga0070682_100037579 3300005337 Bacteria 2965
17 Ga0070682_100712706 3300005337 Bacteria 806
18 Ga0068868_100623398 3300005338 Bacteria 958
19 Ga0070689_100002726 3300005340 Bacteria 11582
20 Ga0070689_100323512 3300005340 Bacteria 1288
21 Ga0070689_101182671 3300005340 Bacteria 686
22 Ga0070692_10016597 3300005345 Bacteria 3503
23 Ga0070669_100265833 3300005353 Bacteria 1370
24 Ga0070675_100069343 3300005354 Bacteria 2921
25 Ga0070675_100700572 3300005354 Bacteria 922
26 Ga0070675_100853719 3300005354 Bacteria 833
27 Ga0070671_100093783 3300005355 Bacteria 2516
28 Ga0070671_100128546 3300005355 Bacteria 2133
29 Ga0070688_100841500 3300005365 Bacteria 720
30 Ga0070714_100034202 3300005435 Bacteria 4255
31 Ga0070705_100021022 3300005440 Bacteria 3465
32 Ga0070700_100149362 3300005441 Bacteria 1596
33 Ga0070694_101188782 3300005444 Bacteria 639
34 Ga0070708_100768894 3300005445 Bacteria 906
35 Ga0070663_100449162 3300005455 Bacteria 1062
36 Ga0070678_100134529 3300005456 Bacteria 1970
37 Ga0070678_101384746 3300005456 Bacteria 656
38 Ga0070681_10044493 3300005458 Bacteria 4445
39 Ga0068867_100009686 3300005459 Bacteria 6792
40 Ga0070685_10054797 3300005466 Bacteria 2315
41 Ga0070706_100160090 3300005467 Bacteria 2102
42 Ga0070679_100563278 3300005530 Bacteria 1083
43 Ga0070679_100739525 3300005530 Bacteria 926
44 Ga0070684_101648699 3300005535 Bacteria 605
45 Ga0068853_100015390 3300005539 Bacteria 6283
46 Ga0068853_100210083 3300005539 Bacteria 1774
47 Ga0068853_100402531 3300005539 Bacteria 1281
48 Ga0070704_100050447 3300005549 Bacteria 2925
49 Ga0068855_100103426 3300005563 Bacteria 3277
50 Ga0068855_101822127 3300005563 Bacteria 618
51 Ga0068857_100065063 3300005577 Bacteria 3241
52 Ga0068856_100362260 3300005614 Unclassified 1468
53 Ga0070702_100020512 3300005615 Bacteria 3464
54 Ga0068859_100122618 3300005617 Bacteria 2666
55 Ga0068859_100842812 3300005617 Bacteria 1003
56 Ga0068859_101565644 3300005617 Bacteria 728
57 Ga0068866_10907969 3300005718 Bacteria 620
58 Ga0068870_10646776 3300005840 Bacteria 724
59 Ga0068863_100010901 3300005841 Bacteria 8814
60 Ga0068863_100349517 3300005841 Bacteria 1439
61 Ga0068863_100363845 3300005841 Bacteria 1410
62 Ga0068858_100119168 3300005842 Bacteria 2467
63 Ga0068858_100695527 3300005842 Bacteria 989
64 Ga0068860_100016293 3300005843 Bacteria 7248
65 Ga0068860_100194012 3300005843 Bacteria 1966
66 Ga0068860_101020082 3300005843 Unclassified 846
67 Ga0068862_100405674 3300005844 Bacteria 1276
68 Ga0070715_10926337 3300006163 Bacteria 538
69 Ga0097621_100005847 3300006237 Bacteria 8689
70 Ga0097621_100900283 3300006237 Unclassified 824
71 Ga0097621_101679687 3300006237 Bacteria 604
72 Ga0068871_100020248 3300006358 Bacteria 5094
73 Ga0068871_100032744 3300006358 Unclassified 4109
74 Ga0075433_10041458 3300006852 Bacteria 3989
75 Ga0097620_100122624 3300006931 Bacteria 2666
76 Ga0097620_100842742 3300006931 Bacteria 1003
77 Ga0097620_101565574 3300006931 Bacteria 728
78 Ga0075435_100476890 3300007076 Bacteria 1077
79 Ga0105250_10213291 3300009092 Bacteria 817
80 Ga0105240_10093559 3300009093 Bacteria 3668
81 Ga0105240_10157608 3300009093 Bacteria 2699
82 Ga0105240_10299951 3300009093 Bacteria 1838
83 Ga0111539_10790922 3300009094 Bacteria 1104
84 Ga0111539_11917167 3300009094 Bacteria 687
85 Ga0105245_10051307 3300009098 Bacteria 3698
86 Ga0105245_10533093 3300009098 Bacteria 1194
87 Ga0105245_10836668 3300009098 Bacteria 960
88 Ga0105243_10356231 3300009148 Bacteria 1345
89 Ga0105241_10416996 3300009174 Bacteria 1181
90 Ga0105242_10174834 3300009176 Bacteria 1890
91 Ga0105242_10320842 3300009176 Bacteria 1421
92 Ga0105248_10034622 3300009177 Bacteria 5650
93 Ga0105248_10283241 3300009177 Unclassified 1866
94 Ga0105237_10945921 3300009545 Bacteria 868
95 Ga0105238_10340608 3300009551 Bacteria 1487
96 Ga0105238_10719974 3300009551 Bacteria 1010
97 Ga0157371_10904147 3300013102 Bacteria 670
98 Ga0157370_10146040 3300013104 Bacteria 2202
99 Ga0157370_11450867 3300013104 Bacteria 617
100 Ga0157369_11235759 3300013105 Bacteria 762
101 Ga0157374_10092824 3300013296 Unclassified 2881
102 Ga0157374_10234424 3300013296 Bacteria 1804
103 Ga0157374_10426617 3300013296 Bacteria 1325
104 Ga0157378_10183576 3300013297 Bacteria 1969
105 Ga0157378_11201024 3300013297 Bacteria 798
106 Ga0163162_10026196 3300013306 Bacteria 5763
107 Ga0163162_10035418 3300013306 Unclassified 4972
108 Ga0163162_10184353 3300013306 Bacteria 2214
109 Ga0163162_10701960 3300013306 Bacteria 1133
110 Ga0157372_10068734 3300013307 Bacteria 3983
111 Ga0157372_10755456 3300013307 Bacteria 1131
112 Ga0157372_11178215 3300013307 Bacteria 886
113 Ga0157375_11148259 3300013308 Bacteria 910
114 Ga0163163_10607405 3300014325 Bacteria 1157
115 Ga0157377_10233911 3300014745 Bacteria 1183
116 Ga0157379_10091526 3300014968 Bacteria 2728
117 Ga0157376_10001379 3300014969 Bacteria 15994
118 Ga0157376_10016791 3300014969 Bacteria 5567
119 Ga0157376_10236236 3300014969 Bacteria 1701
120 Ga0157376_10443525 3300014969 Bacteria 1264
121 Ga0157376_10532881 3300014969 Bacteria 1159
122 Ga0163161_10071884 3300017792 Bacteria 2532
123 Ga0154015_1666860 3300020610 Bacteria 938
124 Ga0209672_100831 3300025228 Bacteria 14391
125 Ga0209437_111772 3300025233 Bacteria 1298
126 Ga0209646_1000125 3300025246 Bacteria 135847
127 Ga0209455_1000031 3300025272 Bacteria 519952
128 Ga0209455_1005885 3300025272 Bacteria 3706
129 Ga0209257_1042364 3300025304 Bacteria 1344
130 Ga0207647_10013511 3300025904 Bacteria 5654
131 Ga0207643_10407923 3300025908 Bacteria 860
132 Ga0207684_10134751 3300025910 Bacteria 2120
133 Ga0207654_10274072 3300025911 Bacteria 1139
134 Ga0207707_10019850 3300025912 Bacteria 5866
135 Ga0207707_10806929 3300025912 Bacteria 781
136 Ga0207695_10133664 3300025913 Bacteria 2436
137 Ga0207695_10231308 3300025913 Bacteria 1753
138 Ga0207695_10724409 3300025913 Bacteria 875
139 Ga0207671_10256840 3300025914 Bacteria 1375
140 Ga0207671_10337417 3300025914 Bacteria 1194
141 Ga0207660_10408849 3300025917 Bacteria 1093
142 Ga0207662_11181649 3300025918 Unclassified 544
143 Ga0207649_10286737 3300025920 Bacteria 1199
144 Ga0207652_10397604 3300025921 Bacteria 1243
145 Ga0207652_10965781 3300025921 Bacteria 750
146 Ga0207694_10009940 3300025924 Bacteria 7180
147 Ga0207694_10269461 3300025924 Bacteria 1397
148 Ga0207650_11020928 3300025925 Bacteria 704
149 Ga0207659_10591962 3300025926 Bacteria 945
150 Ga0207659_11733239 3300025926 Bacteria 532
151 Ga0207700_11281780 3300025928 Bacteria 653
152 Ga0207700_11633818 3300025928 Bacteria 570
153 Ga0207664_10011090 3300025929 Bacteria 6387
154 Ga0207644_10114358 3300025931 Bacteria 2045
155 Ga0207686_10486429 3300025934 Bacteria 955
156 Ga0207709_10006800 3300025935 Bacteria 6398
157 Ga0207670_10000619 3300025936 Bacteria 19127
158 Ga0207670_11074443 3300025936 Bacteria 679
159 Ga0207670_11287219 3300025936 Bacteria 620
160 Ga0207711_10165601 3300025941 Bacteria 2003
161 Ga0207689_10215027 3300025942 Bacteria 1588
162 Ga0207689_11039142 3300025942 Unclassified 691
163 Ga0207661_10179209 3300025944 Bacteria 1850
164 Ga0207667_10076743 3300025949 Bacteria 3467
165 Ga0207667_10403302 3300025949 Bacteria 1392
166 Ga0207712_10260872 3300025961 Bacteria 1405
167 Ga0207677_10197543 3300026023 Bacteria 1596
168 Ga0207703_10110581 3300026035 Bacteria 2344
169 Ga0207703_10400746 3300026035 Bacteria 1273
170 Ga0207639_10019268 3300026041 Bacteria 4864
171 Ga0207639_10306993 3300026041 Bacteria 1404
172 Ga0207639_10489639 3300026041 Bacteria 1122
173 Ga0207678_10020500 3300026067 Bacteria 5796
174 Ga0207678_10069397 3300026067 Bacteria 3022
175 Ga0207708_10013327 3300026075 Bacteria 6141
176 Ga0207702_10246360 3300026078 Bacteria 1676
177 Ga0207641_10084598 3300026088 Unclassified 2762
178 Ga0207641_10142338 3300026088 Bacteria 2165
179 Ga0207641_10374392 3300026088 Bacteria 1362
180 Ga0207648_10054288 3300026089 Bacteria 3500
181 Ga0207676_11115916 3300026095 Bacteria 780
182 Ga0207674_10079994 3300026116 Bacteria 3272
183 Ga0207683_10014894 3300026121 Bacteria 6619
184 Ga0207698_10711903 3300026142 Bacteria 1000
185 Ga0207428_10030722 3300027907 Bacteria 4439
186 Ga0268265_10063618 3300028380 Bacteria 2839
187 Ga0268264_10014751 3300028381 Bacteria 6418
188 Ga0268264_10152504 3300028381 Bacteria 2073
189 Ga0268264_10521431 3300028381 Unclassified 1162
190 Ga0307515_10567135 3300028794 Bacteria 745
191 Ga0265338_10050990 3300028800 Bacteria 3733
192 Ga0265338_10603591 3300028800 Bacteria 764
193 Ga0307511_10192704 3300030521 Bacteria 1074
194 Ga0316181_1124910 3300030744 Bacteria 984
195 Ga0307408_100003289 3300031548 Bacteria 11118
196 Ga0265314_10029149 3300031711 Bacteria 4106
197 Ga0307406_10003413 3300031901 Bacteria 8653
198 Ga0307407_10005035 3300031903 Bacteria 5691
199 Ga0307409_100000745 3300031995 Bacteria 14659
200 Ga0307416_100036566 3300032002 Bacteria 3767
201 Ga0373928_0000565 3300035084 Bacteria 7235
202 Ga0373929_0011050 3300035085 Bacteria 1695
203 Ga0373940_0245497 3300035088 Bacteria 602
204 Ga0373949_0006068 3300035090 Bacteria 2673
205 Ga0373932_0000001 3300035112 Bacteria 1459067
206 Ga0373945_0014236 3300035116 Bacteria 2661
207 Ga0373962_0000265 3300035242 Bacteria 11207
208 Ga0373931_0000008 3300035691 Bacteria 362269
209 Ga0373925_0002695 3300037068 Bacteria 14084
210 Ga0395898_0081736 3300037466 Bacteria 3115
211 Ga0395901_1191219 3300038443 Bacteria 728
212 Ga0451853_2370455 3300041512 Bacteria 521
213 Ga0453683_0278595 3300044673 Bacteria 1068
214 Ga0453684_0017341 3300044712 Bacteria 11159
215 Ga0451576_0043187 3300045051 Bacteria 4757
216 Ga0451576_0071657 3300045051 Bacteria 3607
217 Ga0451576_1653986 3300045051 Bacteria 663
218 Ga0495592_0000027 3300046454 Bacteria 132938
219 Ga0495638_0000290 3300046460 Bacteria 66116
220 Ga0495638_0001087 3300046460 Bacteria 26471
221 Ga0495641_0020394 3300046461 Bacteria 3361
222 Ga0495653_0000035 3300046463 Bacteria 129875
223 Ga0495650_0000210 3300046471 Bacteria 125249
224 Ga0495650_0001085 3300046471 Bacteria 29863
225 Ga0495582_0055404 3300046473 Bacteria 2186
226 Ga0495662_0007902 3300046476 Bacteria 5237
227 Ga0495585_0014155 3300046492 Bacteria 4654
228 Ga0495594_0101595 3300046499 Bacteria 1618
229 Ga0495583_0019601 3300046506 Bacteria 3527
230 Ga0495606_0000016 3300046507 Bacteria 284865
231 Ga0495606_0000512 3300046507 Bacteria 63012
232 Ga0495606_0003804 3300046507 Bacteria 15681
233 Ga0495618_0014157 3300046514 Bacteria 4856
234 Ga0495628_0699883 3300046516 Bacteria 716
235 Ga0495630_0045845 3300046517 Bacteria 3267
236 Ga0495630_0201831 3300046517 Bacteria 1517
237 Ga0495643_0000058 3300046522 Bacteria 194398
238 Ga0495642_0009872 3300046528 Bacteria 3658
239 Ga0495642_0029714 3300046528 Bacteria 2183
240 Ga0495640_0003597 3300046533 Bacteria 12449
241 Ga0495586_0000995 3300046535 Bacteria 16052
242 Ga0495586_0023500 3300046535 Bacteria 3293
243 Ga0495586_0098570 3300046535 Bacteria 1620
244 Ga0495597_0052033 3300046542 Bacteria 1804
245 Ga0495622_0008284 3300046557 Bacteria 4815
246 Ga0495656_0150396 3300046615 Bacteria 1124
247 Ga0495625_0037135 3300046660 Bacteria 3576
248 Ga0495625_0066771 3300046660 Bacteria 2533
249 Ga0495625_0203968 3300046660 Bacteria 1303
250 Ga0495657_0283370 3300046675 Bacteria 991
251 Ga0495599_0155850 3300046678 Bacteria 1413
252 Ga0495647_0004549 3300046681 Bacteria 4514
253 Ga0495658_0082196 3300046683 Bacteria 1892
254 Ga0495658_0219679 3300046683 Bacteria 1189
255 Ga0495669_0144806 3300046684 Bacteria 1123
256 Ga0495613_0004656 3300046689 Bacteria 10287
257 Ga0495624_0068285 3300046690 Bacteria 2216
258 Ga0495624_0104056 3300046690 Bacteria 1747
259 Ga0495649_0000450 3300046694 Bacteria 35527
260 Ga0495674_0073951 3300047319 Bacteria 2936
261 Ga0495676_0108042 3300047321 Unclassified 2047
262 Ga0495686_0330421 3300047472 Bacteria 833
263 Ga0496114_0109243 3300048917 Bacteria 2368
264 Ga0496115_0002018 3300048918 Bacteria 14510
265 Ga0496115_0034587 3300048918 Bacteria 3993
266 Ga0496115_0047281 3300048918 Bacteria 3440
267 Ga0496121_0014578 3300048924 Bacteria 8325
268 Ga0496121_0132756 3300048924 Bacteria 1860
269 Ga0496121_0152349 3300048924 Unclassified 1700
270 Ga0496124_0050371 3300048927 Bacteria 3549
271 Ga0496126_0013104 3300048929 Bacteria 8456
272 Ga0496126_0020240 3300048929 Bacteria 6530
273 Ga0496126_0045723 3300048929 Bacteria 4021
274 Ga0495678_184356 3300049459 Bacteria 652
275 Ga0495682_0001620 3300049460 Bacteria 11602
276 Ga0501311_055582 3300049527 Bacteria 629
277 Ga0501033_0037122 3300049570 Bacteria 3648
278 Ga0501034_0342660 3300049571 Bacteria 1424
279 Ga0501036_0193323 3300049572 Bacteria 1712
280 Ga0501039_0424740 3300049575 Bacteria 1044
281 Ga0501043_1102052 3300049579 Bacteria 561
282 Ga0501079_0851191 3300049741 Bacteria 718
283 Ga0501083_0248314 3300049744 Bacteria 1158
284 nmdc:mga0n895_654552_c1 3300050512 Bacteria 1049
285 nmdc:mga0rr50_108902_c1 3300050513 Bacteria 2189
286 Ga0495619_1085338 3300053085 Unclassified 533
287 Ga0500592_032543 3300053116 Bacteria 841
288 2644255877 2643221646 Bacteria 6433402
289 2739733239 2739367700 Bacteria 4747630
290 Ga0068855_100216163
291 JGI24736J21556_1023120
292 JGI24737J22298_10018220
293 rootL2_10020249
294 Ga0055527_1005576
295 Ga0055529_1000015
296 Ga0058863_10143015
297 Ga0065704_10001277
298 Ga0065715_10089908
299 Ga0065707_10001190
300 Ga0070658_11202204
301 Ga0070683_100065421
302 Ga0070670_100961234
303 Ga0070680_100263145
304 Ga0070680_100433654
305 Ga0070682_100037579
306 Ga0070682_100712706
307 Ga0068868_100623398
308 Ga0070689_100002726
309 Ga0070689_100323512
310 Ga0070689_101182671
311 Ga0070692_10016597
312 Ga0070669_100265833
313 Ga0070675_100069343
314 Ga0070675_100700572
315 Ga0070675_100853719
316 Ga0070671_100093783
317 Ga0070671_100128546
318 Ga0070688_100841500
319 Ga0070714_100034202
320 Ga0070705_100021022
321 Ga0070700_100149362
322 Ga0070694_101188782
323 Ga0070708_100768894
324 Ga0070663_100449162
325 Ga0070678_100134529
326 Ga0070678_101384746
327 Ga0070681_10044493
328 Ga0068867_100009686
329 Ga0070685_10054797
330 Ga0070706_100160090
331 Ga0070679_100563278
332 Ga0070679_100739525
333 Ga0070684_101648699
334 Ga0068853_100015390
335 Ga0068853_100210083
336 Ga0068853_100402531
337 Ga0070704_100050447
338 Ga0068855_100103426
339 Ga0068855_101822127
340 Ga0068857_100065063
341 Ga0068856_100362260
342 Ga0070702_100020512
343 Ga0068859_100122618
344 Ga0068859_100842812
345 Ga0068859_101565644
346 Ga0068866_10907969
347 Ga0068870_10646776
348 Ga0068863_100010901
349 Ga0068863_100349517
350 Ga0068863_100363845
351 Ga0068858_100119168
352 Ga0068858_100695527
353 Ga0068860_100016293
354 Ga0068860_100194012
355 Ga0068860_101020082
356 Ga0068862_100405674
357 Ga0070715_10926337
358 Ga0097621_100005847
359 Ga0097621_100900283
360 Ga0097621_101679687
361 Ga0068871_100020248
362 Ga0068871_100032744
363 Ga0075433_10041458
364 Ga0097620_100122624
365 Ga0097620_100842742
366 Ga0097620_101565574
367 Ga0075435_100476890
368 Ga0105250_10213291
369 Ga0105240_10093559
370 Ga0105240_10157608
371 Ga0105240_10299951
372 Ga0111539_10790922
373 Ga0111539_11917167
374 Ga0105245_10051307
375 Ga0105245_10533093
376 Ga0105245_10836668
377 Ga0105243_10356231
378 Ga0105241_10416996
379 Ga0105242_10174834
380 Ga0105242_10320842
381 Ga0105248_10034622
382 Ga0105248_10283241
383 Ga0105237_10945921
384 Ga0105238_10340608
385 Ga0105238_10719974
386 Ga0157371_10904147
387 Ga0157370_10146040
388 Ga0157370_11450867
389 Ga0157369_11235759
390 Ga0157374_10092824
391 Ga0157374_10234424
392 Ga0157374_10426617
393 Ga0157378_10183576
394 Ga0157378_11201024
395 Ga0163162_10026196
396 Ga0163162_10035418
397 Ga0163162_10184353
398 Ga0163162_10701960
399 Ga0157372_10068734
400 Ga0157372_10755456
401 Ga0157372_11178215
402 Ga0157375_11148259
403 Ga0163163_10607405
404 Ga0157377_10233911
405 Ga0157379_10091526
406 Ga0157376_10001379
407 Ga0157376_10016791
408 Ga0157376_10236236
409 Ga0157376_10443525
410 Ga0157376_10532881
411 Ga0163161_10071884
412 Ga0154015_1666860
413 Ga0209672_100831
414 Ga0209437_111772
415 Ga0209646_1000125
416 Ga0209455_1000031
417 Ga0209455_1005885
418 Ga0209257_1042364
419 Ga0207647_10013511
420 Ga0207643_10407923
421 Ga0207684_10134751
422 Ga0207654_10274072
423 Ga0207707_10019850
424 Ga0207707_10806929
425 Ga0207695_10133664
426 Ga0207695_10231308
427 Ga0207695_10724409
428 Ga0207671_10256840
429 Ga0207671_10337417
430 Ga0207660_10408849
431 Ga0207662_11181649
432 Ga0207649_10286737
433 Ga0207652_10397604
434 Ga0207652_10965781
435 Ga0207694_10009940
436 Ga0207694_10269461
437 Ga0207650_11020928
438 Ga0207659_10591962
439 Ga0207659_11733239
440 Ga0207700_11281780
441 Ga0207700_11633818
442 Ga0207664_10011090
443 Ga0207644_10114358
444 Ga0207686_10486429
445 Ga0207709_10006800
446 Ga0207670_10000619
447 Ga0207670_11074443
448 Ga0207670_11287219
449 Ga0207711_10165601
450 Ga0207689_10215027
451 Ga0207689_11039142
452 Ga0207661_10179209
453 Ga0207667_10076743
454 Ga0207667_10403302
455 Ga0207712_10260872
456 Ga0207677_10197543
457 Ga0207703_10110581
458 Ga0207703_10400746
459 Ga0207639_10019268
460 Ga0207639_10306993
461 Ga0207639_10489639
462 Ga0207678_10020500
463 Ga0207678_10069397
464 Ga0207708_10013327
465 Ga0207702_10246360
466 Ga0207641_10084598
467 Ga0207641_10142338
468 Ga0207641_10374392
469 Ga0207648_10054288
470 Ga0207676_11115916
471 Ga0207674_10079994
472 Ga0207683_10014894
473 Ga0207698_10711903
474 Ga0207428_10030722
475 Ga0268265_10063618
476 Ga0268264_10014751
477 Ga0268264_10152504
478 Ga0268264_10521431
479 Ga0307515_10567135
480 Ga0265338_10050990
481 Ga0265338_10603591
482 Ga0307511_10192704
483 Ga0316181_1124910
484 Ga0307408_100003289
485 Ga0265314_10029149
486 Ga0307406_10003413
487 Ga0307407_10005035
488 Ga0307409_100000745
489 Ga0307416_100036566
490 Ga0373928_0000565
491 Ga0373929_0011050
492 Ga0373940_0245497
493 Ga0373949_0006068
494 Ga0373932_0000001
495 Ga0373945_0014236
496 Ga0373962_0000265
497 Ga0373931_0000008
498 Ga0373925_0002695
499 Ga0395898_0081736
500 Ga0395901_1191219
501 Ga0451853_2370455
502 Ga0453683_0278595
503 Ga0453684_0017341
504 Ga0451576_0043187
505 Ga0451576_0071657
506 Ga0451576_1653986
507 Ga0495592_0000027
508 Ga0495638_0000290
509 Ga0495638_0001087
510 Ga0495641_0020394
511 Ga0495653_0000035
512 Ga0495650_0000210
513 Ga0495650_0001085
514 Ga0495582_0055404
515 Ga0495662_0007902
516 Ga0495585_0014155
517 Ga0495594_0101595
518 Ga0495583_0019601
519 Ga0495606_0000016
520 Ga0495606_0000512
521 Ga0495606_0003804
522 Ga0495618_0014157
523 Ga0495628_0699883
524 Ga0495630_0045845
525 Ga0495630_0201831
526 Ga0495643_0000058
527 Ga0495642_0009872
528 Ga0495642_0029714
529 Ga0495640_0003597
530 Ga0495586_0000995
531 Ga0495586_0023500
532 Ga0495586_0098570
533 Ga0495597_0052033
534 Ga0495622_0008284
535 Ga0495656_0150396
536 Ga0495625_0037135
537 Ga0495625_0066771
538 Ga0495625_0203968
539 Ga0495657_0283370
540 Ga0495599_0155850
541 Ga0495647_0004549
542 Ga0495658_0082196
543 Ga0495658_0219679
544 Ga0495669_0144806
545 Ga0495613_0004656
546 Ga0495624_0068285
547 Ga0495624_0104056
548 Ga0495649_0000450
549 Ga0495674_0073951
550 Ga0495676_0108042
551 Ga0495686_0330421
552 Ga0496114_0109243
553 Ga0496115_0002018
554 Ga0496115_0034587
555 Ga0496115_0047281
556 Ga0496121_0014578
557 Ga0496121_0132756
558 Ga0496121_0152349
559 Ga0496124_0050371
560 Ga0496126_0013104
561 Ga0496126_0020240
562 Ga0496126_0045723
563 Ga0495678_184356
564 Ga0495682_0001620
565 Ga0501311_055582
566 Ga0501033_0037122
567 Ga0501034_0342660
568 Ga0501036_0193323
569 Ga0501039_0424740
570 Ga0501043_1102052
571 Ga0501079_0851191
572 Ga0501083_0248314
573 nmdc:mga0n895_654552_c1
574 nmdc:mga0rr50_108902_c1
575 Ga0495619_1085338
576 Ga0500592_032543
577 2644255877
578 2739733239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

36

166

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9951 7 148
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9945 7 148
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9925 7 148
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9808 7 148
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9785 7 148
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.995 7 148 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9805 7 148 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8745 1 144 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8606 8 144 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8473 7 143 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A419EKS9-F1-model_v4 Polyketide cyclase 1 7 151
AF-A0A023XIA1-F1-model_v4 deleted 0.9998 6 149
AF-A0A7V9MUU5-F1-model_v4 SRPBCC family protein 0.9996 6 151
AF-A0A812J6H2-F1-model_v4 YhcX protein 0.9996 7 151 GO:0016747
AF-A0A0Q6VIA6-F1-model_v4 Toxin 0.9995 6 150

Map